From 9172996f0ef4534ca96a11b6ca0fe5ea7e2bafad Mon Sep 17 00:00:00 2001 From: refaktor Date: Tue, 4 Aug 2026 11:47:52 +0200 Subject: [PATCH] fixing failure handling back, step 1 --- embed/example/main.go | 117 - embed/go.mod | 23 - embed/go.sum | 4 - embed/rye.go | 270 - embed/vendor/golang.org/x/crypto/LICENSE | 27 - embed/vendor/golang.org/x/crypto/PATENTS | 22 - .../golang.org/x/crypto/pbkdf2/pbkdf2.go | 30 - embed/vendor/golang.org/x/text/LICENSE | 27 - embed/vendor/golang.org/x/text/PATENTS | 22 - embed/vendor/golang.org/x/text/cases/cases.go | 162 - .../vendor/golang.org/x/text/cases/context.go | 376 - embed/vendor/golang.org/x/text/cases/fold.go | 34 - embed/vendor/golang.org/x/text/cases/icu.go | 61 - embed/vendor/golang.org/x/text/cases/info.go | 82 - embed/vendor/golang.org/x/text/cases/map.go | 816 -- .../golang.org/x/text/cases/tables15.0.0.go | 2527 ----- .../golang.org/x/text/cases/tables17.0.0.go | 2642 ------ .../vendor/golang.org/x/text/cases/trieval.go | 217 - .../golang.org/x/text/internal/internal.go | 49 - .../x/text/internal/language/common.go | 16 - .../x/text/internal/language/compact.go | 29 - .../text/internal/language/compact/compact.go | 61 - .../internal/language/compact/language.go | 260 - .../text/internal/language/compact/parents.go | 120 - .../text/internal/language/compact/tables.go | 1015 --- .../x/text/internal/language/compact/tags.go | 91 - .../x/text/internal/language/compose.go | 167 - .../x/text/internal/language/coverage.go | 28 - .../x/text/internal/language/language.go | 627 -- .../x/text/internal/language/lookup.go | 412 - .../x/text/internal/language/match.go | 226 - .../x/text/internal/language/parse.go | 608 -- .../x/text/internal/language/tables.go | 3494 ------- .../x/text/internal/language/tags.go | 48 - .../golang.org/x/text/internal/match.go | 67 - .../golang.org/x/text/internal/tag/tag.go | 100 - .../golang.org/x/text/language/coverage.go | 187 - .../vendor/golang.org/x/text/language/doc.go | 98 - .../golang.org/x/text/language/language.go | 605 -- .../golang.org/x/text/language/match.go | 735 -- .../golang.org/x/text/language/parse.go | 256 - .../golang.org/x/text/language/tables.go | 298 - .../vendor/golang.org/x/text/language/tags.go | 145 - .../golang.org/x/text/transform/transform.go | 709 -- .../x/text/unicode/norm/composition.go | 512 -- .../x/text/unicode/norm/forminfo.go | 289 - .../golang.org/x/text/unicode/norm/input.go | 109 - .../golang.org/x/text/unicode/norm/iter.go | 458 - .../x/text/unicode/norm/normalize.go | 610 -- .../x/text/unicode/norm/readwriter.go | 125 - .../x/text/unicode/norm/tables15.0.0.go | 7907 ---------------- .../x/text/unicode/norm/tables17.0.0.go | 8104 ----------------- .../x/text/unicode/norm/transform.go | 88 - .../golang.org/x/text/unicode/norm/trie.go | 54 - embed/vendor/modules.txt | 20 - embed2/go.mod | 11 +- embed2/go.sum | 17 +- evaldo/evaldo.go | 66 +- examples/github/merge-dependabots.rye | 2 +- 59 files changed, 48 insertions(+), 36234 deletions(-) delete mode 100644 embed/example/main.go delete mode 100644 embed/go.mod delete mode 100644 embed/go.sum delete mode 100644 embed/rye.go delete mode 100644 embed/vendor/golang.org/x/crypto/LICENSE delete mode 100644 embed/vendor/golang.org/x/crypto/PATENTS delete mode 100644 embed/vendor/golang.org/x/crypto/pbkdf2/pbkdf2.go delete mode 100644 embed/vendor/golang.org/x/text/LICENSE delete mode 100644 embed/vendor/golang.org/x/text/PATENTS delete mode 100644 embed/vendor/golang.org/x/text/cases/cases.go delete mode 100644 embed/vendor/golang.org/x/text/cases/context.go delete mode 100644 embed/vendor/golang.org/x/text/cases/fold.go delete mode 100644 embed/vendor/golang.org/x/text/cases/icu.go delete mode 100644 embed/vendor/golang.org/x/text/cases/info.go delete mode 100644 embed/vendor/golang.org/x/text/cases/map.go delete mode 100644 embed/vendor/golang.org/x/text/cases/tables15.0.0.go delete mode 100644 embed/vendor/golang.org/x/text/cases/tables17.0.0.go delete mode 100644 embed/vendor/golang.org/x/text/cases/trieval.go delete mode 100644 embed/vendor/golang.org/x/text/internal/internal.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/common.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/compact.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/compact/compact.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/compact/language.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/compact/parents.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/compact/tables.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/compact/tags.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/compose.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/coverage.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/language.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/lookup.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/match.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/parse.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/tables.go delete mode 100644 embed/vendor/golang.org/x/text/internal/language/tags.go delete mode 100644 embed/vendor/golang.org/x/text/internal/match.go delete mode 100644 embed/vendor/golang.org/x/text/internal/tag/tag.go delete mode 100644 embed/vendor/golang.org/x/text/language/coverage.go delete mode 100644 embed/vendor/golang.org/x/text/language/doc.go delete mode 100644 embed/vendor/golang.org/x/text/language/language.go delete mode 100644 embed/vendor/golang.org/x/text/language/match.go delete mode 100644 embed/vendor/golang.org/x/text/language/parse.go delete mode 100644 embed/vendor/golang.org/x/text/language/tables.go delete mode 100644 embed/vendor/golang.org/x/text/language/tags.go delete mode 100644 embed/vendor/golang.org/x/text/transform/transform.go delete mode 100644 embed/vendor/golang.org/x/text/unicode/norm/composition.go delete mode 100644 embed/vendor/golang.org/x/text/unicode/norm/forminfo.go delete mode 100644 embed/vendor/golang.org/x/text/unicode/norm/input.go delete mode 100644 embed/vendor/golang.org/x/text/unicode/norm/iter.go delete mode 100644 embed/vendor/golang.org/x/text/unicode/norm/normalize.go delete mode 100644 embed/vendor/golang.org/x/text/unicode/norm/readwriter.go delete mode 100644 embed/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go delete mode 100644 embed/vendor/golang.org/x/text/unicode/norm/tables17.0.0.go delete mode 100644 embed/vendor/golang.org/x/text/unicode/norm/transform.go delete mode 100644 embed/vendor/golang.org/x/text/unicode/norm/trie.go delete mode 100644 embed/vendor/modules.txt diff --git a/embed/example/main.go b/embed/example/main.go deleted file mode 100644 index 953c4440..00000000 --- a/embed/example/main.go +++ /dev/null @@ -1,117 +0,0 @@ -//go:build ignore -// +build ignore - -// Example program showing how to embed Rye in a Go application using the -// minimal embed sub-module. -// -// Build & run: -// -// cd embed/example -// go run -tags "no_baseio,no_vector" main.go -package main - -import ( - "fmt" - "os" - - "github.com/refaktor/rye/embed" - "github.com/refaktor/rye/env" -) - -// --------------------------------------------------------------------------- -// 1. Register a simple Go function as a Rye builtin -// --------------------------------------------------------------------------- - -func multiply(ps *env.ProgramState, a0, a1, a2, a3, a4 env.Object) env.Object { - if a0.Type() != env.IntegerType || a1.Type() != env.IntegerType { - return *env.NewError("multiply: expected two integers") - } - x := a0.(env.Integer).Value - y := a1.(env.Integer).Value - return *env.NewInteger(x * y) -} - -func greet(ps *env.ProgramState, a0, a1, a2, a3, a4 env.Object) env.Object { - if a0.Type() != env.StringType { - return *env.NewError("greet: expected a string") - } - name := a0.(env.String).Value - return *env.NewString("Hello, " + name + "!") -} - -func main() { - // --------------------------------------------------------------------------- - // 2. Create an engine and register builtins - // --------------------------------------------------------------------------- - engine := embed.New() - - engine.RegisterBuiltinDoc("multiply", 2, "multiply a b - returns a × b", multiply) - engine.RegisterBuiltinDoc("greet", 1, "greet name - returns a greeting string", greet) - - // --------------------------------------------------------------------------- - // 3. Inject a Go value as a Rye word - // --------------------------------------------------------------------------- - engine.SetWord("app-name", *env.NewString("MyApp")) - - // --------------------------------------------------------------------------- - // 4. Evaluate Rye code and read back results - // --------------------------------------------------------------------------- - ryeCode := ` - ; use the injected word - greeting: greet app-name - - ; arithmetic - a: 6 - b: 7 - product: multiply a b - - ; native Rye arithmetic - total: a + b + product - - ; return a block so we can inspect values - total - ` - - result, err := engine.Eval(ryeCode) - if err != nil { - fmt.Fprintf(os.Stderr, "Rye error: %v\n", err) - os.Exit(1) - } - fmt.Println("total =", result) // 55 - - // Read the greeting back as a typed Go string - greeting, err := engine.EvalString(`greet "World"`) - if err != nil { - fmt.Fprintf(os.Stderr, "Rye error: %v\n", err) - os.Exit(1) - } - fmt.Println(greeting) // Hello, World! - - // Read an integer result - n, err := engine.EvalInteger("42") - if err != nil { - fmt.Fprintf(os.Stderr, "Rye error: %v\n", err) - os.Exit(1) - } - fmt.Println("integer =", n) // 42 - - // --------------------------------------------------------------------------- - // 5. Low-level: work with env.Object directly - // --------------------------------------------------------------------------- - obj, err := engine.EvalGetObject(`{ 1 2 3 }`) - if err != nil { - fmt.Fprintf(os.Stderr, "Rye error: %v\n", err) - os.Exit(1) - } - fmt.Printf("block type: %T\n", obj) // env.Block - - // --------------------------------------------------------------------------- - // 6. Use GetWord to read back a word that was set inside a script - // --------------------------------------------------------------------------- - engine.Eval(`answer: 21 + 21`) - if val, ok := engine.GetWord("answer"); ok { - fmt.Println("answer =", val.Print(*engine.ProgramState().Idx)) // 42 - } - - fmt.Println("Done.") -} diff --git a/embed/go.mod b/embed/go.mod deleted file mode 100644 index 4367e5e7..00000000 --- a/embed/go.mod +++ /dev/null @@ -1,23 +0,0 @@ -module github.com/refaktor/rye/embed - -go 1.26.1 - -// Development: replace directive points to the parent rye module in the repo. -// When using a released version, remove this replace and the require below -// will resolve to the tagged version from the Go module proxy. -replace github.com/refaktor/rye => ../ - -// The embed module only depends on rye/env, rye/evaldo, and rye/loader. -// OS I/O builtins and terminal display live in rye/baseio (not imported here). -// No build tags are needed - dependency isolation is at the package level. -// -// External dependencies pulled in transitively: -// golang.org/x/text – unicode case-folding (evaldo) -// golang.org/x/crypto – PBKDF2 (util/securesave) - -require github.com/refaktor/rye v0.0.0-00010101000000-000000000000 - -require ( - golang.org/x/crypto v0.52.0 // indirect - golang.org/x/text v0.37.0 // indirect -) diff --git a/embed/go.sum b/embed/go.sum deleted file mode 100644 index 3aa5917e..00000000 --- a/embed/go.sum +++ /dev/null @@ -1,4 +0,0 @@ -golang.org/x/crypto v0.52.0 h1:RMs7fP2rXdep0CftQlK8Uf+kibLm7qkCcradZWYz988= -golang.org/x/crypto v0.52.0/go.mod h1:1QgfPxDqh0T2M/elOJtp9RvuR95kVjir0e6/BvEmGbc= -golang.org/x/text v0.37.0 h1:Cqjiwd9eSg8e0QAkyCaQTNHFIIzWtidPahFWR83rTrc= -golang.org/x/text v0.37.0/go.mod h1:a5sjxXGs9hsn/AJVwuElvCAo9v8QYLzvavO5z2PiM38= diff --git a/embed/rye.go b/embed/rye.go deleted file mode 100644 index 15c695c0..00000000 --- a/embed/rye.go +++ /dev/null @@ -1,270 +0,0 @@ -// Package embed provides a lightweight, dependency-minimal API for embedding -// the Rye scripting language in Go applications. -// -// # Build tags -// -// This sub-module is always built with the two tags below, which exclude -// optional heavy batteries from the dependency graph: -// -// no_baseio – exclude OS/filesystem/terminal I/O builtins and their deps -// (fsnotify, keyboard, seccomp, landlock, yaml, …) -// no_vector – exclude govector / primes math extensions -// -// The only external dependencies added to a consuming project are: -// -// golang.org/x/text – unicode case-folding (builtins_base_strings) -// golang.org/x/crypto – PBKDF2 (util/securesave) -// -// # Quick start -// -// engine := embed.New() -// -// engine.RegisterBuiltin("double", 1, func(ps *env.ProgramState, a0, _, _, _, _ env.Object) env.Object { -// return *env.NewInteger(a0.(env.Integer).Value * 2) -// }) -// -// result, err := engine.Eval(`double 21`) -// fmt.Println(result) // 42 -package embed - -import ( - "errors" - "fmt" - - "github.com/refaktor/rye/env" - "github.com/refaktor/rye/evaldo" - "github.com/refaktor/rye/loader" -) - -// BuiltinFn is the Go function signature required by Rye builtins. -// ps is the running program state; a0–a4 are positional arguments. -// Unused argument slots receive env.Void{}. -type BuiltinFn = env.BuiltinFunction - -// Engine is a single Rye interpreter instance with its own word index and -// execution context. Create one with [New] or [NewBlank]. -type Engine struct { - ps *env.ProgramState -} - -// New creates an Engine pre-loaded with all base Rye builtins -// (arithmetic, strings, collections, control flow, …) but WITHOUT OS-level -// I/O (no file access, no shell commands, no os.Exit, no os.Args). -// This keeps the embedded sandbox safe by default. -// If you need file/shell access in the embedded engine, call -// baseio.Register(engine.ProgramState()) after New(). -// Register additional Go functions with [Engine.RegisterBuiltin]. -func New() *Engine { - block, idxs := loader.LoadStringNoPEG("", false) - ps := env.NewProgramStateOLD(block.(env.Block).Series, idxs) - evaldo.RegisterBaseBuiltins(ps) - return &Engine{ps: ps} -} - -// NewBlank creates an Engine with NO pre-registered builtins. -// Useful when you want complete control over the available vocabulary. -func NewBlank() *Engine { - block, idxs := loader.LoadStringNoPEG("", false) - ps := env.NewProgramStateOLD(block.(env.Block).Series, idxs) - return &Engine{ps: ps} -} - -// ProgramState returns the underlying *env.ProgramState for advanced -// integration (e.g. reading back Rye values, inspecting the word index, -// registering context-aware builtins manually). -func (e *Engine) ProgramState() *env.ProgramState { - return e.ps -} - -// --------------------------------------------------------------------------- -// Builtin registration -// --------------------------------------------------------------------------- - -// RegisterBuiltin registers a Go function as a Rye builtin word. -// -// - name – the Rye word (e.g. "greet", "db-query") -// - argCount – number of arguments the function accepts (0–5) -// - fn – the Go implementation (signature: BuiltinFn) -func (e *Engine) RegisterBuiltin(name string, argCount int, fn BuiltinFn) { - idx := e.ps.Idx.IndexWord(name) - b := env.NewBuiltin(fn, argCount, false, false, "") - e.ps.Ctx.Set(idx, *b) -} - -// RegisterBuiltinDoc is like [Engine.RegisterBuiltin] but also attaches a -// documentation string visible via the Rye `doc` word. -func (e *Engine) RegisterBuiltinDoc(name string, argCount int, doc string, fn BuiltinFn) { - idx := e.ps.Idx.IndexWord(name) - b := env.NewBuiltin(fn, argCount, false, false, doc) - e.ps.Ctx.Set(idx, *b) -} - -// --------------------------------------------------------------------------- -// Setting and getting Rye words from Go -// --------------------------------------------------------------------------- - -// SetWord injects a Rye word as a constant into the current context. -// The word cannot be modified by Rye scripts (it is not a variable). -// Use [Engine.SetVar] when you need the script to be able to modify the value. -// -// Example: -// -// engine.SetWord("port", *env.NewInteger(8080)) -// engine.Eval(`print "listening on port" + string port`) -func (e *Engine) SetWord(name string, val env.Object) { - idx := e.ps.Idx.IndexWord(name) - e.ps.Ctx.Set(idx, val) -} - -// SetVar injects a Rye word as a mutable variable into the current context. -// Unlike [Engine.SetWord], the Rye script can modify this value using the -// modword operator (word::). -// -// Example: -// -// engine.SetVar("score", *env.NewInteger(0)) -// engine.Eval(`score:: score + 10`) // score is now 10 -// val, _ := engine.GetWord("score") -func (e *Engine) SetVar(name string, val env.Object) { - idx := e.ps.Idx.IndexWord(name) - e.ps.Ctx.SetVar(idx, val) -} - -// GetWord retrieves the value of a Rye word from the current context. -// Returns (nil, false) if the word has not been set. -func (e *Engine) GetWord(name string) (env.Object, bool) { - idx, found := e.ps.Idx.GetIndex(name) - if !found { - return nil, false - } - obj, exists := e.ps.Ctx.Get(idx) - if !exists { - return nil, false - } - return obj, true -} - -// --------------------------------------------------------------------------- -// Evaluation -// --------------------------------------------------------------------------- - -// Eval parses and evaluates Rye source code. -// Returns the result serialised as a human-readable string, or an error if -// parsing or evaluation fails. -func (e *Engine) Eval(code string) (string, error) { - obj, err := e.EvalGetObject(code) - if err != nil { - return "", err - } - if obj == nil { - return "", nil - } - return obj.Print(*e.ps.Idx), nil -} - -// EvalGetObject parses and evaluates Rye source code and returns the raw -// env.Object result. Callers can type-assert to env.Integer, env.String, -// env.Block, etc. -func (e *Engine) EvalGetObject(code string) (env.Object, error) { - block := loader.LoadString(code, false, e.ps) - if errObj, ok := block.(env.Error); ok { - return nil, fmt.Errorf("parse error: %s", errObj.Message) - } - // Update the series on the existing program state, preserving ctx & idx. - b := block.(env.Block) - e.ps.SetBlock(&b) - e.ps.ErrorFlag = false - e.ps.ReturnFlag = false - e.ps.FailureFlag = false - evaldo.Eval(e.ps) - if e.ps.ErrorFlag { - return nil, fmt.Errorf("eval error: %s", e.ps.Res.Print(*e.ps.Idx)) - } - return e.ps.Res, nil -} - -// EvalBytes is a convenience wrapper that evaluates a []byte source. -// Useful when the script is read from a file: -// -// src, _ := os.ReadFile("config.rye") -// result, err := engine.EvalBytes(src) -func (e *Engine) EvalBytes(src []byte) (string, error) { - return e.Eval(string(src)) -} - -// --------------------------------------------------------------------------- -// Typed result helpers -// --------------------------------------------------------------------------- - -// EvalString evaluates code and returns the result as a Go string. -// Returns an error if the result is not a Rye String. -func (e *Engine) EvalString(code string) (string, error) { - obj, err := e.EvalGetObject(code) - if err != nil { - return "", err - } - s, ok := obj.(env.String) - if !ok { - return "", errors.New("result is not a string: " + obj.Print(*e.ps.Idx)) - } - return s.Value, nil -} - -// EvalInteger evaluates code and returns the result as a Go int64. -// Returns an error if the result is not a Rye Integer. -func (e *Engine) EvalInteger(code string) (int64, error) { - obj, err := e.EvalGetObject(code) - if err != nil { - return 0, err - } - i, ok := obj.(env.Integer) - if !ok { - return 0, errors.New("result is not an integer: " + obj.Print(*e.ps.Idx)) - } - return i.Value, nil -} - -// EvalDecimal evaluates code and returns the result as a Go float64. -// Returns an error if the result is not a Rye Decimal. -func (e *Engine) EvalDecimal(code string) (float64, error) { - obj, err := e.EvalGetObject(code) - if err != nil { - return 0, err - } - d, ok := obj.(env.Decimal) - if !ok { - return 0, errors.New("result is not a decimal: " + obj.Print(*e.ps.Idx)) - } - return d.Value, nil -} - -// EvalBool evaluates code and returns the result as a Go bool. -// Returns an error if the result is not a Rye Integer with value 0 or 1 -// (Rye's boolean representation). -func (e *Engine) EvalBool(code string) (bool, error) { - obj, err := e.EvalGetObject(code) - if err != nil { - return false, err - } - switch v := obj.(type) { - case env.Integer: - return v.Value != 0, nil - default: - return false, errors.New("result is not a boolean (integer): " + obj.Print(*e.ps.Idx)) - } -} - -// --------------------------------------------------------------------------- -// Lifecycle -// --------------------------------------------------------------------------- - -// Reset re-initialises the engine with a fresh context and re-registers all -// base Rye builtins (no OS I/O, matching the behaviour of [New]). -// Custom builtins registered with RegisterBuiltin are -// removed - call RegisterBuiltin again to re-add them, or use [New] to -// create a fresh engine. -func (e *Engine) Reset() { - block, idxs := loader.LoadStringNoPEG("", false) - e.ps = env.NewProgramStateOLD(block.(env.Block).Series, idxs) - evaldo.RegisterBaseBuiltins(e.ps) -} diff --git a/embed/vendor/golang.org/x/crypto/LICENSE b/embed/vendor/golang.org/x/crypto/LICENSE deleted file mode 100644 index 2a7cf70d..00000000 --- a/embed/vendor/golang.org/x/crypto/LICENSE +++ /dev/null @@ -1,27 +0,0 @@ -Copyright 2009 The Go Authors. - -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions are -met: - - * Redistributions of source code must retain the above copyright -notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above -copyright notice, this list of conditions and the following disclaimer -in the documentation and/or other materials provided with the -distribution. - * Neither the name of Google LLC nor the names of its -contributors may be used to endorse or promote products derived from -this software without specific prior written permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/embed/vendor/golang.org/x/crypto/PATENTS b/embed/vendor/golang.org/x/crypto/PATENTS deleted file mode 100644 index 73309904..00000000 --- a/embed/vendor/golang.org/x/crypto/PATENTS +++ /dev/null @@ -1,22 +0,0 @@ -Additional IP Rights Grant (Patents) - -"This implementation" means the copyrightable works distributed by -Google as part of the Go project. - -Google hereby grants to You a perpetual, worldwide, non-exclusive, -no-charge, royalty-free, irrevocable (except as stated in this section) -patent license to make, have made, use, offer to sell, sell, import, -transfer and otherwise run, modify and propagate the contents of this -implementation of Go, where such license applies only to those patent -claims, both currently owned or controlled by Google and acquired in -the future, licensable by Google that are necessarily infringed by this -implementation of Go. This grant does not include claims that would be -infringed only as a consequence of further modification of this -implementation. If you or your agent or exclusive licensee institute or -order or agree to the institution of patent litigation against any -entity (including a cross-claim or counterclaim in a lawsuit) alleging -that this implementation of Go or any code incorporated within this -implementation of Go constitutes direct or contributory patent -infringement, or inducement of patent infringement, then any patent -rights granted to you under this License for this implementation of Go -shall terminate as of the date such litigation is filed. diff --git a/embed/vendor/golang.org/x/crypto/pbkdf2/pbkdf2.go b/embed/vendor/golang.org/x/crypto/pbkdf2/pbkdf2.go deleted file mode 100644 index b3321220..00000000 --- a/embed/vendor/golang.org/x/crypto/pbkdf2/pbkdf2.go +++ /dev/null @@ -1,30 +0,0 @@ -// Copyright 2012 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package pbkdf2 implements the key derivation function PBKDF2 as defined in -// RFC 8018 (PKCS #5 v2.1). -// -// This package is a wrapper for the PBKDF2 implementation in the -// [crypto/pbkdf2] package. It is [frozen] and is not accepting new features. -// -// [frozen]: https://go.dev/wiki/Frozen -package pbkdf2 - -import ( - "crypto/pbkdf2" - "hash" -) - -// Key derives a key from the password, salt and iteration count, returning a -// []byte of length keylen that can be used as cryptographic key. The key is -// derived based on the method described as PBKDF2 with the HMAC variant using -// the supplied hash function. -func Key(password, salt []byte, iter, keyLen int, h func() hash.Hash) []byte { - out, err := pbkdf2.Key(h, string(password), salt, iter, keyLen) - if err != nil { - // FIPS 140 enforcement, or an invalid key length. - panic(err) - } - return out -} diff --git a/embed/vendor/golang.org/x/text/LICENSE b/embed/vendor/golang.org/x/text/LICENSE deleted file mode 100644 index 2a7cf70d..00000000 --- a/embed/vendor/golang.org/x/text/LICENSE +++ /dev/null @@ -1,27 +0,0 @@ -Copyright 2009 The Go Authors. - -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions are -met: - - * Redistributions of source code must retain the above copyright -notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above -copyright notice, this list of conditions and the following disclaimer -in the documentation and/or other materials provided with the -distribution. - * Neither the name of Google LLC nor the names of its -contributors may be used to endorse or promote products derived from -this software without specific prior written permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/embed/vendor/golang.org/x/text/PATENTS b/embed/vendor/golang.org/x/text/PATENTS deleted file mode 100644 index 73309904..00000000 --- a/embed/vendor/golang.org/x/text/PATENTS +++ /dev/null @@ -1,22 +0,0 @@ -Additional IP Rights Grant (Patents) - -"This implementation" means the copyrightable works distributed by -Google as part of the Go project. - -Google hereby grants to You a perpetual, worldwide, non-exclusive, -no-charge, royalty-free, irrevocable (except as stated in this section) -patent license to make, have made, use, offer to sell, sell, import, -transfer and otherwise run, modify and propagate the contents of this -implementation of Go, where such license applies only to those patent -claims, both currently owned or controlled by Google and acquired in -the future, licensable by Google that are necessarily infringed by this -implementation of Go. This grant does not include claims that would be -infringed only as a consequence of further modification of this -implementation. If you or your agent or exclusive licensee institute or -order or agree to the institution of patent litigation against any -entity (including a cross-claim or counterclaim in a lawsuit) alleging -that this implementation of Go or any code incorporated within this -implementation of Go constitutes direct or contributory patent -infringement, or inducement of patent infringement, then any patent -rights granted to you under this License for this implementation of Go -shall terminate as of the date such litigation is filed. diff --git a/embed/vendor/golang.org/x/text/cases/cases.go b/embed/vendor/golang.org/x/text/cases/cases.go deleted file mode 100644 index 752cdf03..00000000 --- a/embed/vendor/golang.org/x/text/cases/cases.go +++ /dev/null @@ -1,162 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_trieval.go - -// Package cases provides general and language-specific case mappers. -package cases // import "golang.org/x/text/cases" - -import ( - "golang.org/x/text/language" - "golang.org/x/text/transform" -) - -// References: -// - Unicode Reference Manual Chapter 3.13, 4.2, and 5.18. -// - https://www.unicode.org/reports/tr29/ -// - https://www.unicode.org/Public/6.3.0/ucd/CaseFolding.txt -// - https://www.unicode.org/Public/6.3.0/ucd/SpecialCasing.txt -// - https://www.unicode.org/Public/6.3.0/ucd/DerivedCoreProperties.txt -// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakProperty.txt -// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakTest.txt -// - http://userguide.icu-project.org/transforms/casemappings - -// TODO: -// - Case folding -// - Wide and Narrow? -// - Segmenter option for title casing. -// - ASCII fast paths -// - Encode Soft-Dotted property within trie somehow. - -// A Caser transforms given input to a certain case. It implements -// transform.Transformer. -// -// A Caser may be stateful and should therefore not be shared between -// goroutines. -type Caser struct { - t transform.SpanningTransformer -} - -// Bytes returns a new byte slice with the result of converting b to the case -// form implemented by c. -func (c Caser) Bytes(b []byte) []byte { - b, _, _ = transform.Bytes(c.t, b) - return b -} - -// String returns a string with the result of transforming s to the case form -// implemented by c. -func (c Caser) String(s string) string { - s, _, _ = transform.String(c.t, s) - return s -} - -// Reset resets the Caser to be reused for new input after a previous call to -// Transform. -func (c Caser) Reset() { c.t.Reset() } - -// Transform implements the transform.Transformer interface and transforms the -// given input to the case form implemented by c. -func (c Caser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - return c.t.Transform(dst, src, atEOF) -} - -// Span implements the transform.SpanningTransformer interface. -func (c Caser) Span(src []byte, atEOF bool) (n int, err error) { - return c.t.Span(src, atEOF) -} - -// Upper returns a Caser for language-specific uppercasing. -func Upper(t language.Tag, opts ...Option) Caser { - return Caser{makeUpper(t, getOpts(opts...))} -} - -// Lower returns a Caser for language-specific lowercasing. -func Lower(t language.Tag, opts ...Option) Caser { - return Caser{makeLower(t, getOpts(opts...))} -} - -// Title returns a Caser for language-specific title casing. It uses an -// approximation of the default Unicode Word Break algorithm. -func Title(t language.Tag, opts ...Option) Caser { - return Caser{makeTitle(t, getOpts(opts...))} -} - -// Fold returns a Caser that implements Unicode case folding. The returned Caser -// is stateless and safe to use concurrently by multiple goroutines. -// -// Case folding does not normalize the input and may not preserve a normal form. -// Use the collate or search package for more convenient and linguistically -// sound comparisons. Use golang.org/x/text/secure/precis for string comparisons -// where security aspects are a concern. -func Fold(opts ...Option) Caser { - return Caser{makeFold(getOpts(opts...))} -} - -// An Option is used to modify the behavior of a Caser. -type Option func(o options) options - -// TODO: consider these options to take a boolean as well, like FinalSigma. -// The advantage of using this approach is that other providers of a lower-case -// algorithm could set different defaults by prefixing a user-provided slice -// of options with their own. This is handy, for instance, for the precis -// package which would override the default to not handle the Greek final sigma. - -var ( - // NoLower disables the lowercasing of non-leading letters for a title - // caser. - NoLower Option = noLower - - // Compact omits mappings in case folding for characters that would grow the - // input. (Unimplemented.) - Compact Option = compact -) - -// TODO: option to preserve a normal form, if applicable? - -type options struct { - noLower bool - simple bool - - // TODO: segmenter, max ignorable, alternative versions, etc. - - ignoreFinalSigma bool -} - -func getOpts(o ...Option) (res options) { - for _, f := range o { - res = f(res) - } - return -} - -func noLower(o options) options { - o.noLower = true - return o -} - -func compact(o options) options { - o.simple = true - return o -} - -// HandleFinalSigma specifies whether the special handling of Greek final sigma -// should be enabled. Unicode prescribes handling the Greek final sigma for all -// locales, but standards like IDNA and PRECIS override this default. -func HandleFinalSigma(enable bool) Option { - if enable { - return handleFinalSigma - } - return ignoreFinalSigma -} - -func ignoreFinalSigma(o options) options { - o.ignoreFinalSigma = true - return o -} - -func handleFinalSigma(o options) options { - o.ignoreFinalSigma = false - return o -} diff --git a/embed/vendor/golang.org/x/text/cases/context.go b/embed/vendor/golang.org/x/text/cases/context.go deleted file mode 100644 index e9aa9e19..00000000 --- a/embed/vendor/golang.org/x/text/cases/context.go +++ /dev/null @@ -1,376 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -import "golang.org/x/text/transform" - -// A context is used for iterating over source bytes, fetching case info and -// writing to a destination buffer. -// -// Casing operations may need more than one rune of context to decide how a rune -// should be cased. Casing implementations should call checkpoint on context -// whenever it is known to be safe to return the runes processed so far. -// -// It is recommended for implementations to not allow for more than 30 case -// ignorables as lookahead (analogous to the limit in norm) and to use state if -// unbounded lookahead is needed for cased runes. -type context struct { - dst, src []byte - atEOF bool - - pDst int // pDst points past the last written rune in dst. - pSrc int // pSrc points to the start of the currently scanned rune. - - // checkpoints safe to return in Transform, where nDst <= pDst and nSrc <= pSrc. - nDst, nSrc int - err error - - sz int // size of current rune - info info // case information of currently scanned rune - - // State preserved across calls to Transform. - isMidWord bool // false if next cased letter needs to be title-cased. -} - -func (c *context) Reset() { - c.isMidWord = false -} - -// ret returns the return values for the Transform method. It checks whether -// there were insufficient bytes in src to complete and introduces an error -// accordingly, if necessary. -func (c *context) ret() (nDst, nSrc int, err error) { - if c.err != nil || c.nSrc == len(c.src) { - return c.nDst, c.nSrc, c.err - } - // This point is only reached by mappers if there was no short destination - // buffer. This means that the source buffer was exhausted and that c.sz was - // set to 0 by next. - if c.atEOF && c.pSrc == len(c.src) { - return c.pDst, c.pSrc, nil - } - return c.nDst, c.nSrc, transform.ErrShortSrc -} - -// retSpan returns the return values for the Span method. It checks whether -// there were insufficient bytes in src to complete and introduces an error -// accordingly, if necessary. -func (c *context) retSpan() (n int, err error) { - _, nSrc, err := c.ret() - return nSrc, err -} - -// checkpoint sets the return value buffer points for Transform to the current -// positions. -func (c *context) checkpoint() { - if c.err == nil { - c.nDst, c.nSrc = c.pDst, c.pSrc+c.sz - } -} - -// unreadRune causes the last rune read by next to be reread on the next -// invocation of next. Only one unreadRune may be called after a call to next. -func (c *context) unreadRune() { - c.sz = 0 -} - -func (c *context) next() bool { - c.pSrc += c.sz - if c.pSrc == len(c.src) || c.err != nil { - c.info, c.sz = 0, 0 - return false - } - v, sz := trie.lookup(c.src[c.pSrc:]) - c.info, c.sz = info(v), sz - if c.sz == 0 { - if c.atEOF { - // A zero size means we have an incomplete rune. If we are atEOF, - // this means it is an illegal rune, which we will consume one - // byte at a time. - c.sz = 1 - } else { - c.err = transform.ErrShortSrc - return false - } - } - return true -} - -// writeBytes adds bytes to dst. -func (c *context) writeBytes(b []byte) bool { - if len(c.dst)-c.pDst < len(b) { - c.err = transform.ErrShortDst - return false - } - // This loop is faster than using copy. - for _, ch := range b { - c.dst[c.pDst] = ch - c.pDst++ - } - return true -} - -// writeString writes the given string to dst. -func (c *context) writeString(s string) bool { - if len(c.dst)-c.pDst < len(s) { - c.err = transform.ErrShortDst - return false - } - // This loop is faster than using copy. - for i := 0; i < len(s); i++ { - c.dst[c.pDst] = s[i] - c.pDst++ - } - return true -} - -// copy writes the current rune to dst. -func (c *context) copy() bool { - return c.writeBytes(c.src[c.pSrc : c.pSrc+c.sz]) -} - -// copyXOR copies the current rune to dst and modifies it by applying the XOR -// pattern of the case info. It is the responsibility of the caller to ensure -// that this is a rune with a XOR pattern defined. -func (c *context) copyXOR() bool { - if !c.copy() { - return false - } - if c.info&xorIndexBit == 0 { - // Fast path for 6-bit XOR pattern, which covers most cases. - c.dst[c.pDst-1] ^= byte(c.info >> xorShift) - } else { - // Interpret XOR bits as an index. - // TODO: test performance for unrolling this loop. Verify that we have - // at least two bytes and at most three. - idx := c.info >> xorShift - for p := c.pDst - 1; ; p-- { - c.dst[p] ^= xorData[idx] - idx-- - if xorData[idx] == 0 { - break - } - } - } - return true -} - -// hasPrefix returns true if src[pSrc:] starts with the given string. -func (c *context) hasPrefix(s string) bool { - b := c.src[c.pSrc:] - if len(b) < len(s) { - return false - } - for i, c := range b[:len(s)] { - if c != s[i] { - return false - } - } - return true -} - -// caseType returns an info with only the case bits, normalized to either -// cLower, cUpper, cTitle or cUncased. -func (c *context) caseType() info { - cm := c.info & 0x7 - if cm < 4 { - return cm - } - if cm >= cXORCase { - // xor the last bit of the rune with the case type bits. - b := c.src[c.pSrc+c.sz-1] - return info(b&1) ^ cm&0x3 - } - if cm == cIgnorableCased { - return cLower - } - return cUncased -} - -// lower writes the lowercase version of the current rune to dst. -func lower(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cLower { - return c.copy() - } - if c.info&exceptionBit == 0 { - return c.copyXOR() - } - e := exceptions[c.info>>exceptionShift:] - offset := 2 + e[0]&lengthMask // size of header + fold string - if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { - return c.writeString(e[offset : offset+nLower]) - } - return c.copy() -} - -func isLower(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cLower { - return true - } - if c.info&exceptionBit == 0 { - c.err = transform.ErrEndOfSpan - return false - } - e := exceptions[c.info>>exceptionShift:] - if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { - c.err = transform.ErrEndOfSpan - return false - } - return true -} - -// upper writes the uppercase version of the current rune to dst. -func upper(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cUpper { - return c.copy() - } - if c.info&exceptionBit == 0 { - return c.copyXOR() - } - e := exceptions[c.info>>exceptionShift:] - offset := 2 + e[0]&lengthMask // size of header + fold string - // Get length of first special case mapping. - n := (e[1] >> lengthBits) & lengthMask - if ct == cTitle { - // The first special case mapping is for lower. Set n to the second. - if n == noChange { - n = 0 - } - n, e = e[1]&lengthMask, e[n:] - } - if n != noChange { - return c.writeString(e[offset : offset+n]) - } - return c.copy() -} - -// isUpper writes the isUppercase version of the current rune to dst. -func isUpper(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cUpper { - return true - } - if c.info&exceptionBit == 0 { - c.err = transform.ErrEndOfSpan - return false - } - e := exceptions[c.info>>exceptionShift:] - // Get length of first special case mapping. - n := (e[1] >> lengthBits) & lengthMask - if ct == cTitle { - n = e[1] & lengthMask - } - if n != noChange { - c.err = transform.ErrEndOfSpan - return false - } - return true -} - -// title writes the title case version of the current rune to dst. -func title(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cTitle { - return c.copy() - } - if c.info&exceptionBit == 0 { - if ct == cLower { - return c.copyXOR() - } - return c.copy() - } - // Get the exception data. - e := exceptions[c.info>>exceptionShift:] - offset := 2 + e[0]&lengthMask // size of header + fold string - - nFirst := (e[1] >> lengthBits) & lengthMask - if nTitle := e[1] & lengthMask; nTitle != noChange { - if nFirst != noChange { - e = e[nFirst:] - } - return c.writeString(e[offset : offset+nTitle]) - } - if ct == cLower && nFirst != noChange { - // Use the uppercase version instead. - return c.writeString(e[offset : offset+nFirst]) - } - // Already in correct case. - return c.copy() -} - -// isTitle reports whether the current rune is in title case. -func isTitle(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cTitle { - return true - } - if c.info&exceptionBit == 0 { - if ct == cLower { - c.err = transform.ErrEndOfSpan - return false - } - return true - } - // Get the exception data. - e := exceptions[c.info>>exceptionShift:] - if nTitle := e[1] & lengthMask; nTitle != noChange { - c.err = transform.ErrEndOfSpan - return false - } - nFirst := (e[1] >> lengthBits) & lengthMask - if ct == cLower && nFirst != noChange { - c.err = transform.ErrEndOfSpan - return false - } - return true -} - -// foldFull writes the foldFull version of the current rune to dst. -func foldFull(c *context) bool { - if c.info&hasMappingMask == 0 { - return c.copy() - } - ct := c.caseType() - if c.info&exceptionBit == 0 { - if ct != cLower || c.info&inverseFoldBit != 0 { - return c.copyXOR() - } - return c.copy() - } - e := exceptions[c.info>>exceptionShift:] - n := e[0] & lengthMask - if n == 0 { - if ct == cLower { - return c.copy() - } - n = (e[1] >> lengthBits) & lengthMask - } - return c.writeString(e[2 : 2+n]) -} - -// isFoldFull reports whether the current run is mapped to foldFull -func isFoldFull(c *context) bool { - if c.info&hasMappingMask == 0 { - return true - } - ct := c.caseType() - if c.info&exceptionBit == 0 { - if ct != cLower || c.info&inverseFoldBit != 0 { - c.err = transform.ErrEndOfSpan - return false - } - return true - } - e := exceptions[c.info>>exceptionShift:] - n := e[0] & lengthMask - if n == 0 && ct == cLower { - return true - } - c.err = transform.ErrEndOfSpan - return false -} diff --git a/embed/vendor/golang.org/x/text/cases/fold.go b/embed/vendor/golang.org/x/text/cases/fold.go deleted file mode 100644 index 85cc434f..00000000 --- a/embed/vendor/golang.org/x/text/cases/fold.go +++ /dev/null @@ -1,34 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -import "golang.org/x/text/transform" - -type caseFolder struct{ transform.NopResetter } - -// caseFolder implements the Transformer interface for doing case folding. -func (t *caseFolder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() { - foldFull(&c) - c.checkpoint() - } - return c.ret() -} - -func (t *caseFolder) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isFoldFull(&c) { - c.checkpoint() - } - return c.retSpan() -} - -func makeFold(o options) transform.SpanningTransformer { - // TODO: Special case folding, through option Language, Special/Turkic, or - // both. - // TODO: Implement Compact options. - return &caseFolder{} -} diff --git a/embed/vendor/golang.org/x/text/cases/icu.go b/embed/vendor/golang.org/x/text/cases/icu.go deleted file mode 100644 index db7c237c..00000000 --- a/embed/vendor/golang.org/x/text/cases/icu.go +++ /dev/null @@ -1,61 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build icu - -package cases - -// Ideally these functions would be defined in a test file, but go test doesn't -// allow CGO in tests. The build tag should ensure either way that these -// functions will not end up in the package. - -// TODO: Ensure that the correct ICU version is set. - -/* -#cgo LDFLAGS: -licui18n.57 -licuuc.57 -#include -#include -#include -#include -#include -*/ -import "C" - -import "unsafe" - -func doICU(tag, caser, input string) string { - err := C.UErrorCode(0) - loc := C.CString(tag) - cm := C.ucasemap_open(loc, C.uint32_t(0), &err) - - buf := make([]byte, len(input)*4) - dst := (*C.char)(unsafe.Pointer(&buf[0])) - src := C.CString(input) - - cn := C.int32_t(0) - - switch caser { - case "fold": - cn = C.ucasemap_utf8FoldCase(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - case "lower": - cn = C.ucasemap_utf8ToLower(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - case "upper": - cn = C.ucasemap_utf8ToUpper(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - case "title": - cn = C.ucasemap_utf8ToTitle(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - } - return string(buf[:cn]) -} diff --git a/embed/vendor/golang.org/x/text/cases/info.go b/embed/vendor/golang.org/x/text/cases/info.go deleted file mode 100644 index 87a7c3e9..00000000 --- a/embed/vendor/golang.org/x/text/cases/info.go +++ /dev/null @@ -1,82 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -func (c info) cccVal() info { - if c&exceptionBit != 0 { - return info(exceptions[c>>exceptionShift]) & cccMask - } - return c & cccMask -} - -func (c info) cccType() info { - ccc := c.cccVal() - if ccc <= cccZero { - return cccZero - } - return ccc -} - -// TODO: Implement full Unicode breaking algorithm: -// 1) Implement breaking in separate package. -// 2) Use the breaker here. -// 3) Compare table size and performance of using the more generic breaker. -// -// Note that we can extend the current algorithm to be much more accurate. This -// only makes sense, though, if the performance and/or space penalty of using -// the generic breaker is big. Extra data will only be needed for non-cased -// runes, which means there are sufficient bits left in the caseType. -// ICU prohibits breaking in such cases as well. - -// For the purpose of title casing we use an approximation of the Unicode Word -// Breaking algorithm defined in Annex #29: -// https://www.unicode.org/reports/tr29/#Default_Grapheme_Cluster_Table. -// -// For our approximation, we group the Word Break types into the following -// categories, with associated rules: -// -// 1) Letter: -// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend, Format_FE, ZWJ. -// Rule: Never break between consecutive runes of this category. -// -// 2) Mid: -// MidLetter, MidNumLet, Single_Quote. -// (Cf. case-ignorable: MidLetter, MidNumLet, Single_Quote or cat is Mn, -// Me, Cf, Lm or Sk). -// Rule: Don't break between Letter and Mid, but break between two Mids. -// -// 3) Break: -// Any other category: NewLine, MidNum, CR, LF, Double_Quote, Katakana, and -// Other. -// These categories should always result in a break between two cased letters. -// Rule: Always break. -// -// Note 1: the Katakana and MidNum categories can, in esoteric cases, result in -// preventing a break between two cased letters. For now we will ignore this -// (e.g. [ALetter] [ExtendNumLet] [Katakana] [ExtendNumLet] [ALetter] and -// [ALetter] [Numeric] [MidNum] [Numeric] [ALetter].) -// -// Note 2: the rule for Mid is very approximate, but works in most cases. To -// improve, we could store the categories in the trie value and use a FA to -// manage breaks. See TODO comment above. -// -// Note 3: according to the spec, it is possible for the Extend category to -// introduce breaks between other categories grouped in Letter. However, this -// is undesirable for our purposes. ICU prevents breaks in such cases as well. - -// isBreak returns whether this rune should introduce a break. -func (c info) isBreak() bool { - return c.cccVal() == cccBreak -} - -// isLetter returns whether the rune is of break type ALetter, Hebrew_Letter, -// Numeric, ExtendNumLet, or Extend. -func (c info) isLetter() bool { - ccc := c.cccVal() - if ccc == cccZero { - return !c.isCaseIgnorable() - } - return ccc != cccBreak -} diff --git a/embed/vendor/golang.org/x/text/cases/map.go b/embed/vendor/golang.org/x/text/cases/map.go deleted file mode 100644 index 0f7c6a14..00000000 --- a/embed/vendor/golang.org/x/text/cases/map.go +++ /dev/null @@ -1,816 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -// This file contains the definitions of case mappings for all supported -// languages. The rules for the language-specific tailorings were taken and -// modified from the CLDR transform definitions in common/transforms. - -import ( - "strings" - "unicode" - "unicode/utf8" - - "golang.org/x/text/internal" - "golang.org/x/text/language" - "golang.org/x/text/transform" - "golang.org/x/text/unicode/norm" -) - -// A mapFunc takes a context set to the current rune and writes the mapped -// version to the same context. It may advance the context to the next rune. It -// returns whether a checkpoint is possible: whether the pDst bytes written to -// dst so far won't need changing as we see more source bytes. -type mapFunc func(*context) bool - -// A spanFunc takes a context set to the current rune and returns whether this -// rune would be altered when written to the output. It may advance the context -// to the next rune. It returns whether a checkpoint is possible. -type spanFunc func(*context) bool - -// maxIgnorable defines the maximum number of ignorables to consider for -// lookahead operations. -const maxIgnorable = 30 - -// supported lists the language tags for which we have tailorings. -const supported = "und af az el lt nl tr" - -func init() { - tags := []language.Tag{} - for _, s := range strings.Split(supported, " ") { - tags = append(tags, language.MustParse(s)) - } - matcher = internal.NewInheritanceMatcher(tags) - Supported = language.NewCoverage(tags) -} - -var ( - matcher *internal.InheritanceMatcher - - Supported language.Coverage - - // We keep the following lists separate, instead of having a single per- - // language struct, to give the compiler a chance to remove unused code. - - // Some uppercase mappers are stateless, so we can precompute the - // Transformers and save a bit on runtime allocations. - upperFunc = []struct { - upper mapFunc - span spanFunc - }{ - {nil, nil}, // und - {nil, nil}, // af - {aztrUpper(upper), isUpper}, // az - {elUpper, noSpan}, // el - {ltUpper(upper), noSpan}, // lt - {nil, nil}, // nl - {aztrUpper(upper), isUpper}, // tr - } - - undUpper transform.SpanningTransformer = &undUpperCaser{} - undLower transform.SpanningTransformer = &undLowerCaser{} - undLowerIgnoreSigma transform.SpanningTransformer = &undLowerIgnoreSigmaCaser{} - - lowerFunc = []mapFunc{ - nil, // und - nil, // af - aztrLower, // az - nil, // el - ltLower, // lt - nil, // nl - aztrLower, // tr - } - - titleInfos = []struct { - title mapFunc - lower mapFunc - titleSpan spanFunc - rewrite func(*context) - }{ - {title, lower, isTitle, nil}, // und - {title, lower, isTitle, afnlRewrite}, // af - {aztrUpper(title), aztrLower, isTitle, nil}, // az - {title, lower, isTitle, nil}, // el - {ltUpper(title), ltLower, noSpan, nil}, // lt - {nlTitle, lower, nlTitleSpan, afnlRewrite}, // nl - {aztrUpper(title), aztrLower, isTitle, nil}, // tr - } -) - -func makeUpper(t language.Tag, o options) transform.SpanningTransformer { - _, i, _ := matcher.Match(t) - f := upperFunc[i].upper - if f == nil { - return undUpper - } - return &simpleCaser{f: f, span: upperFunc[i].span} -} - -func makeLower(t language.Tag, o options) transform.SpanningTransformer { - _, i, _ := matcher.Match(t) - f := lowerFunc[i] - if f == nil { - if o.ignoreFinalSigma { - return undLowerIgnoreSigma - } - return undLower - } - if o.ignoreFinalSigma { - return &simpleCaser{f: f, span: isLower} - } - return &lowerCaser{ - first: f, - midWord: finalSigma(f), - } -} - -func makeTitle(t language.Tag, o options) transform.SpanningTransformer { - _, i, _ := matcher.Match(t) - x := &titleInfos[i] - lower := x.lower - if o.noLower { - lower = (*context).copy - } else if !o.ignoreFinalSigma { - lower = finalSigma(lower) - } - return &titleCaser{ - title: x.title, - lower: lower, - titleSpan: x.titleSpan, - rewrite: x.rewrite, - } -} - -func noSpan(c *context) bool { - c.err = transform.ErrEndOfSpan - return false -} - -// TODO: consider a similar special case for the fast majority lower case. This -// is a bit more involved so will require some more precise benchmarking to -// justify it. - -type undUpperCaser struct{ transform.NopResetter } - -// undUpperCaser implements the Transformer interface for doing an upper case -// mapping for the root locale (und). It eliminates the need for an allocation -// as it prevents escaping by not using function pointers. -func (t undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() { - upper(&c) - c.checkpoint() - } - return c.ret() -} - -func (t undUpperCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isUpper(&c) { - c.checkpoint() - } - return c.retSpan() -} - -// undLowerIgnoreSigmaCaser implements the Transformer interface for doing -// a lower case mapping for the root locale (und) ignoring final sigma -// handling. This casing algorithm is used in some performance-critical packages -// like secure/precis and x/net/http/idna, which warrants its special-casing. -type undLowerIgnoreSigmaCaser struct{ transform.NopResetter } - -func (t undLowerIgnoreSigmaCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() && lower(&c) { - c.checkpoint() - } - return c.ret() - -} - -// Span implements a generic lower-casing. This is possible as isLower works -// for all lowercasing variants. All lowercase variants only vary in how they -// transform a non-lowercase letter. They will never change an already lowercase -// letter. In addition, there is no state. -func (t undLowerIgnoreSigmaCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isLower(&c) { - c.checkpoint() - } - return c.retSpan() -} - -type simpleCaser struct { - context - f mapFunc - span spanFunc -} - -// simpleCaser implements the Transformer interface for doing a case operation -// on a rune-by-rune basis. -func (t *simpleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() && t.f(&c) { - c.checkpoint() - } - return c.ret() -} - -func (t *simpleCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && t.span(&c) { - c.checkpoint() - } - return c.retSpan() -} - -// undLowerCaser implements the Transformer interface for doing a lower case -// mapping for the root locale (und) ignoring final sigma handling. This casing -// algorithm is used in some performance-critical packages like secure/precis -// and x/net/http/idna, which warrants its special-casing. -type undLowerCaser struct{ transform.NopResetter } - -func (t undLowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - - for isInterWord := true; c.next(); { - if isInterWord { - if c.info.isCased() { - if !lower(&c) { - break - } - isInterWord = false - } else if !c.copy() { - break - } - } else { - if c.info.isNotCasedAndNotCaseIgnorable() { - if !c.copy() { - break - } - isInterWord = true - } else if !c.hasPrefix("Σ") { - if !lower(&c) { - break - } - } else if !finalSigmaBody(&c) { - break - } - } - c.checkpoint() - } - return c.ret() -} - -func (t undLowerCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isLower(&c) { - c.checkpoint() - } - return c.retSpan() -} - -// lowerCaser implements the Transformer interface. The default Unicode lower -// casing requires different treatment for the first and subsequent characters -// of a word, most notably to handle the Greek final Sigma. -type lowerCaser struct { - undLowerIgnoreSigmaCaser - - context - - first, midWord mapFunc -} - -func (t *lowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - t.context = context{dst: dst, src: src, atEOF: atEOF} - c := &t.context - - for isInterWord := true; c.next(); { - if isInterWord { - if c.info.isCased() { - if !t.first(c) { - break - } - isInterWord = false - } else if !c.copy() { - break - } - } else { - if c.info.isNotCasedAndNotCaseIgnorable() { - if !c.copy() { - break - } - isInterWord = true - } else if !t.midWord(c) { - break - } - } - c.checkpoint() - } - return c.ret() -} - -// titleCaser implements the Transformer interface. Title casing algorithms -// distinguish between the first letter of a word and subsequent letters of the -// same word. It uses state to avoid requiring a potentially infinite lookahead. -type titleCaser struct { - context - - // rune mappings used by the actual casing algorithms. - title mapFunc - lower mapFunc - titleSpan spanFunc - - rewrite func(*context) -} - -// Transform implements the standard Unicode title case algorithm as defined in -// Chapter 3 of The Unicode Standard: -// toTitlecase(X): Find the word boundaries in X according to Unicode Standard -// Annex #29, "Unicode Text Segmentation." For each word boundary, find the -// first cased character F following the word boundary. If F exists, map F to -// Titlecase_Mapping(F); then map all characters C between F and the following -// word boundary to Lowercase_Mapping(C). -func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - t.context = context{dst: dst, src: src, atEOF: atEOF, isMidWord: t.isMidWord} - c := &t.context - - if !c.next() { - return c.ret() - } - - for { - p := c.info - if t.rewrite != nil { - t.rewrite(c) - } - - wasMid := p.isMid() - // Break out of this loop on failure to ensure we do not modify the - // state incorrectly. - if p.isCased() { - if !c.isMidWord { - if !t.title(c) { - break - } - c.isMidWord = true - } else if !t.lower(c) { - break - } - } else if !c.copy() { - break - } else if p.isBreak() { - c.isMidWord = false - } - - // As we save the state of the transformer, it is safe to call - // checkpoint after any successful write. - if !(c.isMidWord && wasMid) { - c.checkpoint() - } - - if !c.next() { - break - } - if wasMid && c.info.isMid() { - c.isMidWord = false - } - } - return c.ret() -} - -func (t *titleCaser) Span(src []byte, atEOF bool) (n int, err error) { - t.context = context{src: src, atEOF: atEOF, isMidWord: t.isMidWord} - c := &t.context - - if !c.next() { - return c.retSpan() - } - - for { - p := c.info - if t.rewrite != nil { - t.rewrite(c) - } - - wasMid := p.isMid() - // Break out of this loop on failure to ensure we do not modify the - // state incorrectly. - if p.isCased() { - if !c.isMidWord { - if !t.titleSpan(c) { - break - } - c.isMidWord = true - } else if !isLower(c) { - break - } - } else if p.isBreak() { - c.isMidWord = false - } - // As we save the state of the transformer, it is safe to call - // checkpoint after any successful write. - if !(c.isMidWord && wasMid) { - c.checkpoint() - } - - if !c.next() { - break - } - if wasMid && c.info.isMid() { - c.isMidWord = false - } - } - return c.retSpan() -} - -// finalSigma adds Greek final Sigma handing to another casing function. It -// determines whether a lowercased sigma should be σ or ς, by looking ahead for -// case-ignorables and a cased letters. -func finalSigma(f mapFunc) mapFunc { - return func(c *context) bool { - if !c.hasPrefix("Σ") { - return f(c) - } - return finalSigmaBody(c) - } -} - -func finalSigmaBody(c *context) bool { - // Current rune must be ∑. - - // ::NFD(); - // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA - // Σ } [:case-ignorable:]* [:cased:] → σ; - // [:cased:] [:case-ignorable:]* { Σ → ς; - // ::Any-Lower; - // ::NFC(); - - p := c.pDst - c.writeString("ς") - - // TODO: we should do this here, but right now this will never have an - // effect as this is called when the prefix is Sigma, whereas Dutch and - // Afrikaans only test for an apostrophe. - // - // if t.rewrite != nil { - // t.rewrite(c) - // } - - // We need to do one more iteration after maxIgnorable, as a cased - // letter is not an ignorable and may modify the result. - wasMid := false - for i := 0; i < maxIgnorable+1; i++ { - if !c.next() { - return false - } - if !c.info.isCaseIgnorable() { - // All Midword runes are also case ignorable, so we are - // guaranteed to have a letter or word break here. As we are - // unreading the run, there is no need to unset c.isMidWord; - // the title caser will handle this. - if c.info.isCased() { - // p+1 is guaranteed to be in bounds: if writing ς was - // successful, p+1 will contain the second byte of ς. If not, - // this function will have returned after c.next returned false. - c.dst[p+1]++ // ς → σ - } - c.unreadRune() - return true - } - // A case ignorable may also introduce a word break, so we may need - // to continue searching even after detecting a break. - isMid := c.info.isMid() - if (wasMid && isMid) || c.info.isBreak() { - c.isMidWord = false - } - wasMid = isMid - c.copy() - } - return true -} - -// finalSigmaSpan would be the same as isLower. - -// elUpper implements Greek upper casing, which entails removing a predefined -// set of non-blocked modifiers. Note that these accents should not be removed -// for title casing! -// Example: "Οδός" -> "ΟΔΟΣ". -func elUpper(c *context) bool { - // From CLDR: - // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Above:]]*? { [\u0313\u0314\u0301\u0300\u0306\u0342\u0308\u0304] → ; - // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Iota_Subscript:]]*? { \u0345 → ; - - r, _ := utf8.DecodeRune(c.src[c.pSrc:]) - oldPDst := c.pDst - if !upper(c) { - return false - } - if !unicode.Is(unicode.Greek, r) { - return true - } - i := 0 - // Take the properties of the uppercased rune that is already written to the - // destination. This saves us the trouble of having to uppercase the - // decomposed rune again. - if b := norm.NFD.Properties(c.dst[oldPDst:]).Decomposition(); b != nil { - // Restore the destination position and process the decomposed rune. - r, sz := utf8.DecodeRune(b) - if r <= 0xFF { // See A.6.1 - return true - } - c.pDst = oldPDst - // Insert the first rune and ignore the modifiers. See A.6.2. - c.writeBytes(b[:sz]) - i = len(b[sz:]) / 2 // Greek modifiers are always of length 2. - } - - for ; i < maxIgnorable && c.next(); i++ { - switch r, _ := utf8.DecodeRune(c.src[c.pSrc:]); r { - // Above and Iota Subscript - case 0x0300, // U+0300 COMBINING GRAVE ACCENT - 0x0301, // U+0301 COMBINING ACUTE ACCENT - 0x0304, // U+0304 COMBINING MACRON - 0x0306, // U+0306 COMBINING BREVE - 0x0308, // U+0308 COMBINING DIAERESIS - 0x0313, // U+0313 COMBINING COMMA ABOVE - 0x0314, // U+0314 COMBINING REVERSED COMMA ABOVE - 0x0342, // U+0342 COMBINING GREEK PERISPOMENI - 0x0345: // U+0345 COMBINING GREEK YPOGEGRAMMENI - // No-op. Gobble the modifier. - - default: - switch v, _ := trie.lookup(c.src[c.pSrc:]); info(v).cccType() { - case cccZero: - c.unreadRune() - return true - - // We don't need to test for IotaSubscript as the only rune that - // qualifies (U+0345) was already excluded in the switch statement - // above. See A.4. - - case cccAbove: - return c.copy() - default: - // Some other modifier. We're still allowed to gobble Greek - // modifiers after this. - c.copy() - } - } - } - return i == maxIgnorable -} - -// TODO: implement elUpperSpan (low-priority: complex and infrequent). - -func ltLower(c *context) bool { - // From CLDR: - // # Introduce an explicit dot above when lowercasing capital I's and J's - // # whenever there are more accents above. - // # (of the accents used in Lithuanian: grave, acute, tilde above, and ogonek) - // # 0049; 0069 0307; 0049; 0049; lt More_Above; # LATIN CAPITAL LETTER I - // # 004A; 006A 0307; 004A; 004A; lt More_Above; # LATIN CAPITAL LETTER J - // # 012E; 012F 0307; 012E; 012E; lt More_Above; # LATIN CAPITAL LETTER I WITH OGONEK - // # 00CC; 0069 0307 0300; 00CC; 00CC; lt; # LATIN CAPITAL LETTER I WITH GRAVE - // # 00CD; 0069 0307 0301; 00CD; 00CD; lt; # LATIN CAPITAL LETTER I WITH ACUTE - // # 0128; 0069 0307 0303; 0128; 0128; lt; # LATIN CAPITAL LETTER I WITH TILDE - // ::NFD(); - // I } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0307; - // J } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → j \u0307; - // I \u0328 (Į) } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0328 \u0307; - // I \u0300 (Ì) → i \u0307 \u0300; - // I \u0301 (Í) → i \u0307 \u0301; - // I \u0303 (Ĩ) → i \u0307 \u0303; - // ::Any-Lower(); - // ::NFC(); - - i := 0 - if r := c.src[c.pSrc]; r < utf8.RuneSelf { - lower(c) - if r != 'I' && r != 'J' { - return true - } - } else { - p := norm.NFD.Properties(c.src[c.pSrc:]) - if d := p.Decomposition(); len(d) >= 3 && (d[0] == 'I' || d[0] == 'J') { - // UTF-8 optimization: the decomposition will only have an above - // modifier if the last rune of the decomposition is in [U+300-U+311]. - // In all other cases, a decomposition starting with I is always - // an I followed by modifiers that are not cased themselves. See A.2. - if d[1] == 0xCC && d[2] <= 0x91 { // A.2.4. - if !c.writeBytes(d[:1]) { - return false - } - c.dst[c.pDst-1] += 'a' - 'A' // lower - - // Assumption: modifier never changes on lowercase. See A.1. - // Assumption: all modifiers added have CCC = Above. See A.2.3. - return c.writeString("\u0307") && c.writeBytes(d[1:]) - } - // In all other cases the additional modifiers will have a CCC - // that is less than 230 (Above). We will insert the U+0307, if - // needed, after these modifiers so that a string in FCD form - // will remain so. See A.2.2. - lower(c) - i = 1 - } else { - return lower(c) - } - } - - for ; i < maxIgnorable && c.next(); i++ { - switch c.info.cccType() { - case cccZero: - c.unreadRune() - return true - case cccAbove: - return c.writeString("\u0307") && c.copy() // See A.1. - default: - c.copy() // See A.1. - } - } - return i == maxIgnorable -} - -// ltLowerSpan would be the same as isLower. - -func ltUpper(f mapFunc) mapFunc { - return func(c *context) bool { - // Unicode: - // 0307; 0307; ; ; lt After_Soft_Dotted; # COMBINING DOT ABOVE - // - // From CLDR: - // # Remove \u0307 following soft-dotteds (i, j, and the like), with possible - // # intervening non-230 marks. - // ::NFD(); - // [:Soft_Dotted:] [^[:ccc=Not_Reordered:][:ccc=Above:]]* { \u0307 → ; - // ::Any-Upper(); - // ::NFC(); - - // TODO: See A.5. A soft-dotted rune never has an exception. This would - // allow us to overload the exception bit and encode this property in - // info. Need to measure performance impact of this. - r, _ := utf8.DecodeRune(c.src[c.pSrc:]) - oldPDst := c.pDst - if !f(c) { - return false - } - if !unicode.Is(unicode.Soft_Dotted, r) { - return true - } - - // We don't need to do an NFD normalization, as a soft-dotted rune never - // contains U+0307. See A.3. - - i := 0 - for ; i < maxIgnorable && c.next(); i++ { - switch c.info.cccType() { - case cccZero: - c.unreadRune() - return true - case cccAbove: - if c.hasPrefix("\u0307") { - // We don't do a full NFC, but rather combine runes for - // some of the common cases. (Returning NFC or - // preserving normal form is neither a requirement nor - // a possibility anyway). - if !c.next() { - return false - } - if c.dst[oldPDst] == 'I' && c.pDst == oldPDst+1 && c.src[c.pSrc] == 0xcc { - s := "" - switch c.src[c.pSrc+1] { - case 0x80: // U+0300 COMBINING GRAVE ACCENT - s = "\u00cc" // U+00CC LATIN CAPITAL LETTER I WITH GRAVE - case 0x81: // U+0301 COMBINING ACUTE ACCENT - s = "\u00cd" // U+00CD LATIN CAPITAL LETTER I WITH ACUTE - case 0x83: // U+0303 COMBINING TILDE - s = "\u0128" // U+0128 LATIN CAPITAL LETTER I WITH TILDE - case 0x88: // U+0308 COMBINING DIAERESIS - s = "\u00cf" // U+00CF LATIN CAPITAL LETTER I WITH DIAERESIS - default: - } - if s != "" { - c.pDst = oldPDst - return c.writeString(s) - } - } - } - return c.copy() - default: - c.copy() - } - } - return i == maxIgnorable - } -} - -// TODO: implement ltUpperSpan (low priority: complex and infrequent). - -func aztrUpper(f mapFunc) mapFunc { - return func(c *context) bool { - // i→İ; - if c.src[c.pSrc] == 'i' { - return c.writeString("İ") - } - return f(c) - } -} - -func aztrLower(c *context) (done bool) { - // From CLDR: - // # I and i-dotless; I-dot and i are case pairs in Turkish and Azeri - // # 0130; 0069; 0130; 0130; tr; # LATIN CAPITAL LETTER I WITH DOT ABOVE - // İ→i; - // # When lowercasing, remove dot_above in the sequence I + dot_above, which will turn into i. - // # This matches the behavior of the canonically equivalent I-dot_above - // # 0307; ; 0307; 0307; tr After_I; # COMBINING DOT ABOVE - // # When lowercasing, unless an I is before a dot_above, it turns into a dotless i. - // # 0049; 0131; 0049; 0049; tr Not_Before_Dot; # LATIN CAPITAL LETTER I - // I([^[:ccc=Not_Reordered:][:ccc=Above:]]*)\u0307 → i$1 ; - // I→ı ; - // ::Any-Lower(); - if c.hasPrefix("\u0130") { // İ - return c.writeString("i") - } - if c.src[c.pSrc] != 'I' { - return lower(c) - } - - // We ignore the lower-case I for now, but insert it later when we know - // which form we need. - start := c.pSrc + c.sz - - i := 0 -Loop: - // We check for up to n ignorables before \u0307. As \u0307 is an - // ignorable as well, n is maxIgnorable-1. - for ; i < maxIgnorable && c.next(); i++ { - switch c.info.cccType() { - case cccAbove: - if c.hasPrefix("\u0307") { - return c.writeString("i") && c.writeBytes(c.src[start:c.pSrc]) // ignore U+0307 - } - done = true - break Loop - case cccZero: - c.unreadRune() - done = true - break Loop - default: - // We'll write this rune after we know which starter to use. - } - } - if i == maxIgnorable { - done = true - } - return c.writeString("ı") && c.writeBytes(c.src[start:c.pSrc+c.sz]) && done -} - -// aztrLowerSpan would be the same as isLower. - -func nlTitle(c *context) bool { - // From CLDR: - // # Special titlecasing for Dutch initial "ij". - // ::Any-Title(); - // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) - // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; - if c.src[c.pSrc] != 'I' && c.src[c.pSrc] != 'i' { - return title(c) - } - - if !c.writeString("I") || !c.next() { - return false - } - if c.src[c.pSrc] == 'j' || c.src[c.pSrc] == 'J' { - return c.writeString("J") - } - c.unreadRune() - return true -} - -func nlTitleSpan(c *context) bool { - // From CLDR: - // # Special titlecasing for Dutch initial "ij". - // ::Any-Title(); - // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) - // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; - if c.src[c.pSrc] != 'I' { - return isTitle(c) - } - if !c.next() || c.src[c.pSrc] == 'j' { - return false - } - if c.src[c.pSrc] != 'J' { - c.unreadRune() - } - return true -} - -// Not part of CLDR, but see https://unicode.org/cldr/trac/ticket/7078. -func afnlRewrite(c *context) { - if c.hasPrefix("'") || c.hasPrefix("’") { - c.isMidWord = true - } -} diff --git a/embed/vendor/golang.org/x/text/cases/tables15.0.0.go b/embed/vendor/golang.org/x/text/cases/tables15.0.0.go deleted file mode 100644 index 6aa11161..00000000 --- a/embed/vendor/golang.org/x/text/cases/tables15.0.0.go +++ /dev/null @@ -1,2527 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -//go:build !go1.27 - -package cases - -// UnicodeVersion is the Unicode version from which the tables in this package are derived. -const UnicodeVersion = "15.0.0" - -var xorData string = "" + // Size: 213 bytes - "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + - "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + - "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + - "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + - "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + - "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + - "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + - "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + - "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x03'" + - "\x00\x03)\x00\x03+\x00\x03/\x00\x03\x19\x00\x03\x1b\x00\x03\x1f\x00\x01" + - "\x1e\x00\x01\x22" - -var exceptions string = "" + // Size: 2450 bytes - "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + - "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + - "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + - "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + - "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + - "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + - "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + - "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + - "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + - "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + - "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + - "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + - "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + - "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + - "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + - "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + - "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + - "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + - "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + - "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + - "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + - "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + - "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + - "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + - "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + - "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + - "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + - "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + - "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + - "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + - "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + - "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + - "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + - "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + - "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + - "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + - "խ" - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// caseTrie. Total size: 13398 bytes (13.08 KiB). Checksum: 544af6e6b1b70931. -type caseTrie struct{} - -func newCaseTrie(i int) *caseTrie { - return &caseTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 22: - return uint16(caseValues[n<<6+uint32(b)]) - default: - n -= 22 - return uint16(sparse.lookup(n, b)) - } -} - -// caseValues: 24 blocks, 1536 entries, 3072 bytes -// The third block is the zero block. -var caseValues = [1536]uint16{ - // Block 0x0, offset 0x0 - 0x27: 0x0054, - 0x2e: 0x0054, - 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, - 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, - // Block 0x1, offset 0x40 - 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, - 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, - 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, - 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, - 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, - 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, - 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, - 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, - 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, - 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, - 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, - 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, - 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, - 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, - 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, - 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, - 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, - 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, - 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, - 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, - // Block 0x4, offset 0x100 - 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, - 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, - 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, - 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, - 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, - 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, - 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, - 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, - 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, - 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, - 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, - // Block 0x5, offset 0x140 - 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, - 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, - 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, - 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, - 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, - 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, - 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, - 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, - 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, - 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, - 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, - // Block 0x6, offset 0x180 - 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, - 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, - 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, - 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, - 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, - 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, - 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, - 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, - 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, - 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, - 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, - 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, - 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, - 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, - 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, - 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, - 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, - 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, - 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, - 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, - 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, - // Block 0x8, offset 0x200 - 0x204: 0x0004, 0x205: 0x0004, - 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, - 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, - 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, - 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, - 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, - 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, - 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, - 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, - 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, - 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, - // Block 0x9, offset 0x240 - 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, - 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, - 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, - 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, - 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, - 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, - 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, - 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, - 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, - 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, - 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, - // Block 0xa, offset 0x280 - 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, - 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, 0x28a: 0x0010, - 0x291: 0x0034, - 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, - 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, - 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, - 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, - 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, - 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, - 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, - 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x0010, 0x2c1: 0x0010, 0x2c2: 0x0010, 0x2c3: 0x0010, 0x2c4: 0x0010, 0x2c5: 0x0010, - 0x2c6: 0x0010, 0x2c7: 0x0010, 0x2c8: 0x0010, 0x2c9: 0x0014, 0x2ca: 0x0024, 0x2cb: 0x0024, - 0x2cc: 0x0024, 0x2cd: 0x0024, 0x2ce: 0x0024, 0x2cf: 0x0034, 0x2d0: 0x0034, 0x2d1: 0x0034, - 0x2d2: 0x0034, 0x2d3: 0x0034, 0x2d4: 0x0024, 0x2d5: 0x0024, 0x2d6: 0x0024, 0x2d7: 0x0024, - 0x2d8: 0x0024, 0x2d9: 0x0024, 0x2da: 0x0024, 0x2db: 0x0024, 0x2dc: 0x0024, 0x2dd: 0x0024, - 0x2de: 0x0024, 0x2df: 0x0024, 0x2e0: 0x0024, 0x2e1: 0x0024, 0x2e2: 0x0014, 0x2e3: 0x0034, - 0x2e4: 0x0024, 0x2e5: 0x0024, 0x2e6: 0x0034, 0x2e7: 0x0024, 0x2e8: 0x0024, 0x2e9: 0x0034, - 0x2ea: 0x0024, 0x2eb: 0x0024, 0x2ec: 0x0024, 0x2ed: 0x0034, 0x2ee: 0x0034, 0x2ef: 0x0034, - 0x2f0: 0x0034, 0x2f1: 0x0034, 0x2f2: 0x0034, 0x2f3: 0x0024, 0x2f4: 0x0024, 0x2f5: 0x0024, - 0x2f6: 0x0034, 0x2f7: 0x0024, 0x2f8: 0x0024, 0x2f9: 0x0034, 0x2fa: 0x0034, 0x2fb: 0x0024, - 0x2fc: 0x0024, 0x2fd: 0x0024, 0x2fe: 0x0024, 0x2ff: 0x0024, - // Block 0xc, offset 0x300 - 0x300: 0x7053, 0x301: 0x7053, 0x302: 0x7053, 0x303: 0x7053, 0x304: 0x7053, 0x305: 0x7053, - 0x307: 0x7053, - 0x30d: 0x7053, 0x310: 0x1aea, 0x311: 0x1b6a, - 0x312: 0x1bea, 0x313: 0x1c6a, 0x314: 0x1cea, 0x315: 0x1d6a, 0x316: 0x1dea, 0x317: 0x1e6a, - 0x318: 0x1eea, 0x319: 0x1f6a, 0x31a: 0x1fea, 0x31b: 0x206a, 0x31c: 0x20ea, 0x31d: 0x216a, - 0x31e: 0x21ea, 0x31f: 0x226a, 0x320: 0x22ea, 0x321: 0x236a, 0x322: 0x23ea, 0x323: 0x246a, - 0x324: 0x24ea, 0x325: 0x256a, 0x326: 0x25ea, 0x327: 0x266a, 0x328: 0x26ea, 0x329: 0x276a, - 0x32a: 0x27ea, 0x32b: 0x286a, 0x32c: 0x28ea, 0x32d: 0x296a, 0x32e: 0x29ea, 0x32f: 0x2a6a, - 0x330: 0x2aea, 0x331: 0x2b6a, 0x332: 0x2bea, 0x333: 0x2c6a, 0x334: 0x2cea, 0x335: 0x2d6a, - 0x336: 0x2dea, 0x337: 0x2e6a, 0x338: 0x2eea, 0x339: 0x2f6a, 0x33a: 0x2fea, - 0x33c: 0x0015, 0x33d: 0x306a, 0x33e: 0x30ea, 0x33f: 0x316a, - // Block 0xd, offset 0x340 - 0x340: 0x0812, 0x341: 0x0812, 0x342: 0x0812, 0x343: 0x0812, 0x344: 0x0812, 0x345: 0x0812, - 0x348: 0x0813, 0x349: 0x0813, 0x34a: 0x0813, 0x34b: 0x0813, - 0x34c: 0x0813, 0x34d: 0x0813, 0x350: 0x3b1a, 0x351: 0x0812, - 0x352: 0x3bfa, 0x353: 0x0812, 0x354: 0x3d3a, 0x355: 0x0812, 0x356: 0x3e7a, 0x357: 0x0812, - 0x359: 0x0813, 0x35b: 0x0813, 0x35d: 0x0813, - 0x35f: 0x0813, 0x360: 0x0812, 0x361: 0x0812, 0x362: 0x0812, 0x363: 0x0812, - 0x364: 0x0812, 0x365: 0x0812, 0x366: 0x0812, 0x367: 0x0812, 0x368: 0x0813, 0x369: 0x0813, - 0x36a: 0x0813, 0x36b: 0x0813, 0x36c: 0x0813, 0x36d: 0x0813, 0x36e: 0x0813, 0x36f: 0x0813, - 0x370: 0x9252, 0x371: 0x9252, 0x372: 0x9552, 0x373: 0x9552, 0x374: 0x9852, 0x375: 0x9852, - 0x376: 0x9b52, 0x377: 0x9b52, 0x378: 0x9e52, 0x379: 0x9e52, 0x37a: 0xa152, 0x37b: 0xa152, - 0x37c: 0x4d52, 0x37d: 0x4d52, - // Block 0xe, offset 0x380 - 0x380: 0x3fba, 0x381: 0x40aa, 0x382: 0x419a, 0x383: 0x428a, 0x384: 0x437a, 0x385: 0x446a, - 0x386: 0x455a, 0x387: 0x464a, 0x388: 0x4739, 0x389: 0x4829, 0x38a: 0x4919, 0x38b: 0x4a09, - 0x38c: 0x4af9, 0x38d: 0x4be9, 0x38e: 0x4cd9, 0x38f: 0x4dc9, 0x390: 0x4eba, 0x391: 0x4faa, - 0x392: 0x509a, 0x393: 0x518a, 0x394: 0x527a, 0x395: 0x536a, 0x396: 0x545a, 0x397: 0x554a, - 0x398: 0x5639, 0x399: 0x5729, 0x39a: 0x5819, 0x39b: 0x5909, 0x39c: 0x59f9, 0x39d: 0x5ae9, - 0x39e: 0x5bd9, 0x39f: 0x5cc9, 0x3a0: 0x5dba, 0x3a1: 0x5eaa, 0x3a2: 0x5f9a, 0x3a3: 0x608a, - 0x3a4: 0x617a, 0x3a5: 0x626a, 0x3a6: 0x635a, 0x3a7: 0x644a, 0x3a8: 0x6539, 0x3a9: 0x6629, - 0x3aa: 0x6719, 0x3ab: 0x6809, 0x3ac: 0x68f9, 0x3ad: 0x69e9, 0x3ae: 0x6ad9, 0x3af: 0x6bc9, - 0x3b0: 0x0812, 0x3b1: 0x0812, 0x3b2: 0x6cba, 0x3b3: 0x6dca, 0x3b4: 0x6e9a, - 0x3b6: 0x6f7a, 0x3b7: 0x705a, 0x3b8: 0x0813, 0x3b9: 0x0813, 0x3ba: 0x9253, 0x3bb: 0x9253, - 0x3bc: 0x7199, 0x3bd: 0x0004, 0x3be: 0x726a, 0x3bf: 0x0004, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x0004, 0x3c1: 0x0004, 0x3c2: 0x72ea, 0x3c3: 0x73fa, 0x3c4: 0x74ca, - 0x3c6: 0x75aa, 0x3c7: 0x768a, 0x3c8: 0x9553, 0x3c9: 0x9553, 0x3ca: 0x9853, 0x3cb: 0x9853, - 0x3cc: 0x77c9, 0x3cd: 0x0004, 0x3ce: 0x0004, 0x3cf: 0x0004, 0x3d0: 0x0812, 0x3d1: 0x0812, - 0x3d2: 0x789a, 0x3d3: 0x79da, 0x3d6: 0x7b1a, 0x3d7: 0x7bfa, - 0x3d8: 0x0813, 0x3d9: 0x0813, 0x3da: 0x9b53, 0x3db: 0x9b53, 0x3dd: 0x0004, - 0x3de: 0x0004, 0x3df: 0x0004, 0x3e0: 0x0812, 0x3e1: 0x0812, 0x3e2: 0x7d3a, 0x3e3: 0x7e7a, - 0x3e4: 0x7fba, 0x3e5: 0x0912, 0x3e6: 0x809a, 0x3e7: 0x817a, 0x3e8: 0x0813, 0x3e9: 0x0813, - 0x3ea: 0xa153, 0x3eb: 0xa153, 0x3ec: 0x0913, 0x3ed: 0x0004, 0x3ee: 0x0004, 0x3ef: 0x0004, - 0x3f2: 0x82ba, 0x3f3: 0x83ca, 0x3f4: 0x849a, - 0x3f6: 0x857a, 0x3f7: 0x865a, 0x3f8: 0x9e53, 0x3f9: 0x9e53, 0x3fa: 0x4d53, 0x3fb: 0x4d53, - 0x3fc: 0x8799, 0x3fd: 0x0004, 0x3fe: 0x0004, - // Block 0x10, offset 0x400 - 0x402: 0x0013, - 0x407: 0x0013, 0x40a: 0x0012, 0x40b: 0x0013, - 0x40c: 0x0013, 0x40d: 0x0013, 0x40e: 0x0012, 0x40f: 0x0012, 0x410: 0x0013, 0x411: 0x0013, - 0x412: 0x0013, 0x413: 0x0012, 0x415: 0x0013, - 0x419: 0x0013, 0x41a: 0x0013, 0x41b: 0x0013, 0x41c: 0x0013, 0x41d: 0x0013, - 0x424: 0x0013, 0x426: 0x886b, 0x428: 0x0013, - 0x42a: 0x88cb, 0x42b: 0x890b, 0x42c: 0x0013, 0x42d: 0x0013, 0x42f: 0x0012, - 0x430: 0x0013, 0x431: 0x0013, 0x432: 0xa453, 0x433: 0x0013, 0x434: 0x0012, 0x435: 0x0010, - 0x436: 0x0010, 0x437: 0x0010, 0x438: 0x0010, 0x439: 0x0012, - 0x43c: 0x0012, 0x43d: 0x0012, 0x43e: 0x0013, 0x43f: 0x0013, - // Block 0x11, offset 0x440 - 0x440: 0x1a13, 0x441: 0x1a13, 0x442: 0x1e13, 0x443: 0x1e13, 0x444: 0x1a13, 0x445: 0x1a13, - 0x446: 0x2613, 0x447: 0x2613, 0x448: 0x2a13, 0x449: 0x2a13, 0x44a: 0x2e13, 0x44b: 0x2e13, - 0x44c: 0x2a13, 0x44d: 0x2a13, 0x44e: 0x2613, 0x44f: 0x2613, 0x450: 0xa752, 0x451: 0xa752, - 0x452: 0xaa52, 0x453: 0xaa52, 0x454: 0xad52, 0x455: 0xad52, 0x456: 0xaa52, 0x457: 0xaa52, - 0x458: 0xa752, 0x459: 0xa752, 0x45a: 0x1a12, 0x45b: 0x1a12, 0x45c: 0x1e12, 0x45d: 0x1e12, - 0x45e: 0x1a12, 0x45f: 0x1a12, 0x460: 0x2612, 0x461: 0x2612, 0x462: 0x2a12, 0x463: 0x2a12, - 0x464: 0x2e12, 0x465: 0x2e12, 0x466: 0x2a12, 0x467: 0x2a12, 0x468: 0x2612, 0x469: 0x2612, - // Block 0x12, offset 0x480 - 0x480: 0x6552, 0x481: 0x6552, 0x482: 0x6552, 0x483: 0x6552, 0x484: 0x6552, 0x485: 0x6552, - 0x486: 0x6552, 0x487: 0x6552, 0x488: 0x6552, 0x489: 0x6552, 0x48a: 0x6552, 0x48b: 0x6552, - 0x48c: 0x6552, 0x48d: 0x6552, 0x48e: 0x6552, 0x48f: 0x6552, 0x490: 0xb052, 0x491: 0xb052, - 0x492: 0xb052, 0x493: 0xb052, 0x494: 0xb052, 0x495: 0xb052, 0x496: 0xb052, 0x497: 0xb052, - 0x498: 0xb052, 0x499: 0xb052, 0x49a: 0xb052, 0x49b: 0xb052, 0x49c: 0xb052, 0x49d: 0xb052, - 0x49e: 0xb052, 0x49f: 0xb052, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x896b, 0x4a3: 0x8b53, - 0x4a4: 0x89cb, 0x4a5: 0x8a2a, 0x4a6: 0x8a8a, 0x4a7: 0x0f13, 0x4a8: 0x0f12, 0x4a9: 0x0313, - 0x4aa: 0x0312, 0x4ab: 0x0713, 0x4ac: 0x0712, 0x4ad: 0x8aeb, 0x4ae: 0x8b4b, 0x4af: 0x8bab, - 0x4b0: 0x8c0b, 0x4b1: 0x0012, 0x4b2: 0x0113, 0x4b3: 0x0112, 0x4b4: 0x0012, 0x4b5: 0x0313, - 0x4b6: 0x0312, 0x4b7: 0x0012, 0x4b8: 0x0012, 0x4b9: 0x0012, 0x4ba: 0x0012, 0x4bb: 0x0012, - 0x4bc: 0x0015, 0x4bd: 0x0015, 0x4be: 0x8c6b, 0x4bf: 0x8ccb, - // Block 0x13, offset 0x4c0 - 0x4c0: 0x0113, 0x4c1: 0x0112, 0x4c2: 0x0113, 0x4c3: 0x0112, 0x4c4: 0x0113, 0x4c5: 0x0112, - 0x4c6: 0x0113, 0x4c7: 0x0112, 0x4c8: 0x0014, 0x4c9: 0x0014, 0x4ca: 0x0014, 0x4cb: 0x0713, - 0x4cc: 0x0712, 0x4cd: 0x8d2b, 0x4ce: 0x0012, 0x4cf: 0x0010, 0x4d0: 0x0113, 0x4d1: 0x0112, - 0x4d2: 0x0113, 0x4d3: 0x0112, 0x4d4: 0x6552, 0x4d5: 0x0012, 0x4d6: 0x0113, 0x4d7: 0x0112, - 0x4d8: 0x0113, 0x4d9: 0x0112, 0x4da: 0x0113, 0x4db: 0x0112, 0x4dc: 0x0113, 0x4dd: 0x0112, - 0x4de: 0x0113, 0x4df: 0x0112, 0x4e0: 0x0113, 0x4e1: 0x0112, 0x4e2: 0x0113, 0x4e3: 0x0112, - 0x4e4: 0x0113, 0x4e5: 0x0112, 0x4e6: 0x0113, 0x4e7: 0x0112, 0x4e8: 0x0113, 0x4e9: 0x0112, - 0x4ea: 0x8d8b, 0x4eb: 0x8deb, 0x4ec: 0x8e4b, 0x4ed: 0x8eab, 0x4ee: 0x8f0b, 0x4ef: 0x0012, - 0x4f0: 0x8f6b, 0x4f1: 0x8fcb, 0x4f2: 0x902b, 0x4f3: 0xb353, 0x4f4: 0x0113, 0x4f5: 0x0112, - 0x4f6: 0x0113, 0x4f7: 0x0112, 0x4f8: 0x0113, 0x4f9: 0x0112, 0x4fa: 0x0113, 0x4fb: 0x0112, - 0x4fc: 0x0113, 0x4fd: 0x0112, 0x4fe: 0x0113, 0x4ff: 0x0112, - // Block 0x14, offset 0x500 - 0x500: 0x90ea, 0x501: 0x916a, 0x502: 0x91ea, 0x503: 0x926a, 0x504: 0x931a, 0x505: 0x93ca, - 0x506: 0x944a, - 0x513: 0x94ca, 0x514: 0x95aa, 0x515: 0x968a, 0x516: 0x976a, 0x517: 0x984a, - 0x51d: 0x0010, - 0x51e: 0x0034, 0x51f: 0x0010, 0x520: 0x0010, 0x521: 0x0010, 0x522: 0x0010, 0x523: 0x0010, - 0x524: 0x0010, 0x525: 0x0010, 0x526: 0x0010, 0x527: 0x0010, 0x528: 0x0010, - 0x52a: 0x0010, 0x52b: 0x0010, 0x52c: 0x0010, 0x52d: 0x0010, 0x52e: 0x0010, 0x52f: 0x0010, - 0x530: 0x0010, 0x531: 0x0010, 0x532: 0x0010, 0x533: 0x0010, 0x534: 0x0010, 0x535: 0x0010, - 0x536: 0x0010, 0x538: 0x0010, 0x539: 0x0010, 0x53a: 0x0010, 0x53b: 0x0010, - 0x53c: 0x0010, 0x53e: 0x0010, - // Block 0x15, offset 0x540 - 0x540: 0x2713, 0x541: 0x2913, 0x542: 0x2b13, 0x543: 0x2913, 0x544: 0x2f13, 0x545: 0x2913, - 0x546: 0x2b13, 0x547: 0x2913, 0x548: 0x2713, 0x549: 0x3913, 0x54a: 0x3b13, - 0x54c: 0x3f13, 0x54d: 0x3913, 0x54e: 0x3b13, 0x54f: 0x3913, 0x550: 0x2713, 0x551: 0x2913, - 0x552: 0x2b13, 0x554: 0x2f13, 0x555: 0x2913, 0x557: 0xbc52, - 0x558: 0xbf52, 0x559: 0xc252, 0x55a: 0xbf52, 0x55b: 0xc552, 0x55c: 0xbf52, 0x55d: 0xc252, - 0x55e: 0xbf52, 0x55f: 0xbc52, 0x560: 0xc852, 0x561: 0xcb52, 0x563: 0xce52, - 0x564: 0xc852, 0x565: 0xcb52, 0x566: 0xc852, 0x567: 0x2712, 0x568: 0x2912, 0x569: 0x2b12, - 0x56a: 0x2912, 0x56b: 0x2f12, 0x56c: 0x2912, 0x56d: 0x2b12, 0x56e: 0x2912, 0x56f: 0x2712, - 0x570: 0x3912, 0x571: 0x3b12, 0x573: 0x3f12, 0x574: 0x3912, 0x575: 0x3b12, - 0x576: 0x3912, 0x577: 0x2712, 0x578: 0x2912, 0x579: 0x2b12, 0x57b: 0x2f12, - 0x57c: 0x2912, - // Block 0x16, offset 0x580 - 0x580: 0x2213, 0x581: 0x2213, 0x582: 0x2613, 0x583: 0x2613, 0x584: 0x2213, 0x585: 0x2213, - 0x586: 0x2e13, 0x587: 0x2e13, 0x588: 0x2213, 0x589: 0x2213, 0x58a: 0x2613, 0x58b: 0x2613, - 0x58c: 0x2213, 0x58d: 0x2213, 0x58e: 0x3e13, 0x58f: 0x3e13, 0x590: 0x2213, 0x591: 0x2213, - 0x592: 0x2613, 0x593: 0x2613, 0x594: 0x2213, 0x595: 0x2213, 0x596: 0x2e13, 0x597: 0x2e13, - 0x598: 0x2213, 0x599: 0x2213, 0x59a: 0x2613, 0x59b: 0x2613, 0x59c: 0x2213, 0x59d: 0x2213, - 0x59e: 0xd153, 0x59f: 0xd153, 0x5a0: 0xd453, 0x5a1: 0xd453, 0x5a2: 0x2212, 0x5a3: 0x2212, - 0x5a4: 0x2612, 0x5a5: 0x2612, 0x5a6: 0x2212, 0x5a7: 0x2212, 0x5a8: 0x2e12, 0x5a9: 0x2e12, - 0x5aa: 0x2212, 0x5ab: 0x2212, 0x5ac: 0x2612, 0x5ad: 0x2612, 0x5ae: 0x2212, 0x5af: 0x2212, - 0x5b0: 0x3e12, 0x5b1: 0x3e12, 0x5b2: 0x2212, 0x5b3: 0x2212, 0x5b4: 0x2612, 0x5b5: 0x2612, - 0x5b6: 0x2212, 0x5b7: 0x2212, 0x5b8: 0x2e12, 0x5b9: 0x2e12, 0x5ba: 0x2212, 0x5bb: 0x2212, - 0x5bc: 0x2612, 0x5bd: 0x2612, 0x5be: 0x2212, 0x5bf: 0x2212, - // Block 0x17, offset 0x5c0 - 0x5c2: 0x0010, - 0x5c7: 0x0010, 0x5c9: 0x0010, 0x5cb: 0x0010, - 0x5cd: 0x0010, 0x5ce: 0x0010, 0x5cf: 0x0010, 0x5d1: 0x0010, - 0x5d2: 0x0010, 0x5d4: 0x0010, 0x5d7: 0x0010, - 0x5d9: 0x0010, 0x5db: 0x0010, 0x5dd: 0x0010, - 0x5df: 0x0010, 0x5e1: 0x0010, 0x5e2: 0x0010, - 0x5e4: 0x0010, 0x5e7: 0x0010, 0x5e8: 0x0010, 0x5e9: 0x0010, - 0x5ea: 0x0010, 0x5ec: 0x0010, 0x5ed: 0x0010, 0x5ee: 0x0010, 0x5ef: 0x0010, - 0x5f0: 0x0010, 0x5f1: 0x0010, 0x5f2: 0x0010, 0x5f4: 0x0010, 0x5f5: 0x0010, - 0x5f6: 0x0010, 0x5f7: 0x0010, 0x5f9: 0x0010, 0x5fa: 0x0010, 0x5fb: 0x0010, - 0x5fc: 0x0010, 0x5fe: 0x0010, -} - -// caseIndex: 27 blocks, 1728 entries, 3456 bytes -// Block 0 is the zero block. -var caseIndex = [1728]uint16{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x16, 0xc3: 0x17, 0xc4: 0x18, 0xc5: 0x19, 0xc6: 0x01, 0xc7: 0x02, - 0xc8: 0x1a, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x1b, 0xcc: 0x1c, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, - 0xd0: 0x1d, 0xd1: 0x1e, 0xd2: 0x1f, 0xd3: 0x20, 0xd4: 0x21, 0xd5: 0x22, 0xd6: 0x08, 0xd7: 0x23, - 0xd8: 0x24, 0xd9: 0x25, 0xda: 0x26, 0xdb: 0x27, 0xdc: 0x28, 0xdd: 0x29, 0xde: 0x2a, 0xdf: 0x2b, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, - 0xf0: 0x16, 0xf3: 0x18, - // Block 0x4, offset 0x100 - 0x120: 0x2c, 0x121: 0x2d, 0x122: 0x2e, 0x123: 0x09, 0x124: 0x2f, 0x125: 0x30, 0x126: 0x31, 0x127: 0x32, - 0x128: 0x33, 0x129: 0x34, 0x12a: 0x35, 0x12b: 0x36, 0x12c: 0x37, 0x12d: 0x38, 0x12e: 0x39, 0x12f: 0x3a, - 0x130: 0x3b, 0x131: 0x3c, 0x132: 0x3d, 0x133: 0x3e, 0x134: 0x3f, 0x135: 0x40, 0x136: 0x41, 0x137: 0x42, - 0x138: 0x43, 0x139: 0x44, 0x13a: 0x45, 0x13b: 0x46, 0x13c: 0x47, 0x13d: 0x48, 0x13e: 0x49, 0x13f: 0x4a, - // Block 0x5, offset 0x140 - 0x140: 0x4b, 0x141: 0x4c, 0x142: 0x4d, 0x143: 0x0a, 0x144: 0x26, 0x145: 0x26, 0x146: 0x26, 0x147: 0x26, - 0x148: 0x26, 0x149: 0x4e, 0x14a: 0x4f, 0x14b: 0x50, 0x14c: 0x51, 0x14d: 0x52, 0x14e: 0x53, 0x14f: 0x54, - 0x150: 0x55, 0x151: 0x26, 0x152: 0x26, 0x153: 0x26, 0x154: 0x26, 0x155: 0x26, 0x156: 0x26, 0x157: 0x26, - 0x158: 0x26, 0x159: 0x56, 0x15a: 0x57, 0x15b: 0x58, 0x15c: 0x59, 0x15d: 0x5a, 0x15e: 0x5b, 0x15f: 0x5c, - 0x160: 0x5d, 0x161: 0x5e, 0x162: 0x5f, 0x163: 0x60, 0x164: 0x61, 0x165: 0x62, 0x167: 0x63, - 0x168: 0x64, 0x169: 0x65, 0x16a: 0x66, 0x16b: 0x67, 0x16c: 0x68, 0x16d: 0x69, 0x16e: 0x6a, 0x16f: 0x6b, - 0x170: 0x6c, 0x171: 0x6d, 0x172: 0x6e, 0x173: 0x6f, 0x174: 0x70, 0x175: 0x71, 0x176: 0x72, 0x177: 0x73, - 0x178: 0x74, 0x179: 0x74, 0x17a: 0x75, 0x17b: 0x74, 0x17c: 0x76, 0x17d: 0x0b, 0x17e: 0x0c, 0x17f: 0x0d, - // Block 0x6, offset 0x180 - 0x180: 0x77, 0x181: 0x78, 0x182: 0x79, 0x183: 0x7a, 0x184: 0x0e, 0x185: 0x7b, 0x186: 0x7c, - 0x192: 0x7d, 0x193: 0x0f, - 0x1b0: 0x7e, 0x1b1: 0x10, 0x1b2: 0x74, 0x1b3: 0x7f, 0x1b4: 0x80, 0x1b5: 0x81, 0x1b6: 0x82, 0x1b7: 0x83, - 0x1b8: 0x84, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x85, 0x1c2: 0x86, 0x1c3: 0x87, 0x1c4: 0x88, 0x1c5: 0x26, 0x1c6: 0x89, - // Block 0x8, offset 0x200 - 0x200: 0x8a, 0x201: 0x26, 0x202: 0x26, 0x203: 0x26, 0x204: 0x26, 0x205: 0x26, 0x206: 0x26, 0x207: 0x26, - 0x208: 0x26, 0x209: 0x26, 0x20a: 0x26, 0x20b: 0x26, 0x20c: 0x26, 0x20d: 0x26, 0x20e: 0x26, 0x20f: 0x26, - 0x210: 0x26, 0x211: 0x26, 0x212: 0x8b, 0x213: 0x8c, 0x214: 0x26, 0x215: 0x26, 0x216: 0x26, 0x217: 0x26, - 0x218: 0x8d, 0x219: 0x8e, 0x21a: 0x8f, 0x21b: 0x90, 0x21c: 0x91, 0x21d: 0x92, 0x21e: 0x11, 0x21f: 0x93, - 0x220: 0x94, 0x221: 0x95, 0x222: 0x26, 0x223: 0x96, 0x224: 0x97, 0x225: 0x98, 0x226: 0x99, 0x227: 0x9a, - 0x228: 0x9b, 0x229: 0x9c, 0x22a: 0x9d, 0x22b: 0x9e, 0x22c: 0x9f, 0x22d: 0xa0, 0x22e: 0xa1, 0x22f: 0xa2, - 0x230: 0x26, 0x231: 0x26, 0x232: 0x26, 0x233: 0x26, 0x234: 0x26, 0x235: 0x26, 0x236: 0x26, 0x237: 0x26, - 0x238: 0x26, 0x239: 0x26, 0x23a: 0x26, 0x23b: 0x26, 0x23c: 0x26, 0x23d: 0x26, 0x23e: 0x26, 0x23f: 0x26, - // Block 0x9, offset 0x240 - 0x240: 0x26, 0x241: 0x26, 0x242: 0x26, 0x243: 0x26, 0x244: 0x26, 0x245: 0x26, 0x246: 0x26, 0x247: 0x26, - 0x248: 0x26, 0x249: 0x26, 0x24a: 0x26, 0x24b: 0x26, 0x24c: 0x26, 0x24d: 0x26, 0x24e: 0x26, 0x24f: 0x26, - 0x250: 0x26, 0x251: 0x26, 0x252: 0x26, 0x253: 0x26, 0x254: 0x26, 0x255: 0x26, 0x256: 0x26, 0x257: 0x26, - 0x258: 0x26, 0x259: 0x26, 0x25a: 0x26, 0x25b: 0x26, 0x25c: 0x26, 0x25d: 0x26, 0x25e: 0x26, 0x25f: 0x26, - 0x260: 0x26, 0x261: 0x26, 0x262: 0x26, 0x263: 0x26, 0x264: 0x26, 0x265: 0x26, 0x266: 0x26, 0x267: 0x26, - 0x268: 0x26, 0x269: 0x26, 0x26a: 0x26, 0x26b: 0x26, 0x26c: 0x26, 0x26d: 0x26, 0x26e: 0x26, 0x26f: 0x26, - 0x270: 0x26, 0x271: 0x26, 0x272: 0x26, 0x273: 0x26, 0x274: 0x26, 0x275: 0x26, 0x276: 0x26, 0x277: 0x26, - 0x278: 0x26, 0x279: 0x26, 0x27a: 0x26, 0x27b: 0x26, 0x27c: 0x26, 0x27d: 0x26, 0x27e: 0x26, 0x27f: 0x26, - // Block 0xa, offset 0x280 - 0x280: 0x26, 0x281: 0x26, 0x282: 0x26, 0x283: 0x26, 0x284: 0x26, 0x285: 0x26, 0x286: 0x26, 0x287: 0x26, - 0x288: 0x26, 0x289: 0x26, 0x28a: 0x26, 0x28b: 0x26, 0x28c: 0x26, 0x28d: 0x26, 0x28e: 0x26, 0x28f: 0x26, - 0x290: 0x26, 0x291: 0x26, 0x292: 0x26, 0x293: 0x26, 0x294: 0x26, 0x295: 0x26, 0x296: 0x26, 0x297: 0x26, - 0x298: 0x26, 0x299: 0x26, 0x29a: 0x26, 0x29b: 0x26, 0x29c: 0x26, 0x29d: 0x26, 0x29e: 0xa3, 0x29f: 0xa4, - // Block 0xb, offset 0x2c0 - 0x2ec: 0x12, 0x2ed: 0xa5, 0x2ee: 0xa6, 0x2ef: 0xa7, - 0x2f0: 0x26, 0x2f1: 0x26, 0x2f2: 0x26, 0x2f3: 0x26, 0x2f4: 0xa8, 0x2f5: 0xa9, 0x2f6: 0xaa, 0x2f7: 0xab, - 0x2f8: 0xac, 0x2f9: 0xad, 0x2fa: 0x26, 0x2fb: 0xae, 0x2fc: 0xaf, 0x2fd: 0xb0, 0x2fe: 0xb1, 0x2ff: 0xb2, - // Block 0xc, offset 0x300 - 0x300: 0xb3, 0x301: 0xb4, 0x302: 0x26, 0x303: 0xb5, 0x305: 0xb6, 0x307: 0xb7, - 0x30a: 0xb8, 0x30b: 0xb9, 0x30c: 0xba, 0x30d: 0xbb, 0x30e: 0xbc, 0x30f: 0xbd, - 0x310: 0xbe, 0x311: 0xbf, 0x312: 0xc0, 0x313: 0xc1, 0x314: 0xc2, 0x315: 0xc3, 0x316: 0x13, - 0x318: 0x26, 0x319: 0x26, 0x31a: 0x26, 0x31b: 0x26, 0x31c: 0xc4, 0x31d: 0xc5, 0x31e: 0xc6, - 0x320: 0xc7, 0x321: 0xc8, 0x322: 0xc9, 0x323: 0xca, 0x324: 0xcb, 0x326: 0xcc, - 0x328: 0xcd, 0x329: 0xce, 0x32a: 0xcf, 0x32b: 0xd0, 0x32c: 0x60, 0x32d: 0xd1, 0x32e: 0xd2, - 0x330: 0x26, 0x331: 0xd3, 0x332: 0xd4, 0x333: 0xd5, 0x334: 0xd6, - 0x33a: 0xd7, 0x33b: 0xd8, 0x33c: 0xd9, 0x33d: 0xda, 0x33e: 0xdb, 0x33f: 0xdc, - // Block 0xd, offset 0x340 - 0x340: 0xdd, 0x341: 0xde, 0x342: 0xdf, 0x343: 0xe0, 0x344: 0xe1, 0x345: 0xe2, 0x346: 0xe3, 0x347: 0xe4, - 0x348: 0xe5, 0x349: 0xe6, 0x34a: 0xe7, 0x34b: 0xe8, 0x34c: 0xe9, 0x34d: 0xea, - 0x350: 0xeb, 0x351: 0xec, 0x352: 0xed, 0x353: 0xee, 0x356: 0xef, 0x357: 0xf0, - 0x358: 0xf1, 0x359: 0xf2, 0x35a: 0xf3, 0x35b: 0xf4, 0x35c: 0xf5, - 0x360: 0xf6, 0x362: 0xf7, 0x363: 0xf8, 0x364: 0xf9, 0x365: 0xfa, 0x366: 0xfb, 0x367: 0xfc, - 0x368: 0xfd, 0x369: 0xfe, 0x36a: 0xff, 0x36b: 0x100, - 0x370: 0x101, 0x371: 0x102, 0x372: 0x103, 0x374: 0x104, 0x375: 0x105, 0x376: 0x106, - 0x37b: 0x107, 0x37c: 0x108, 0x37d: 0x109, 0x37e: 0x10a, - // Block 0xe, offset 0x380 - 0x380: 0x26, 0x381: 0x26, 0x382: 0x26, 0x383: 0x26, 0x384: 0x26, 0x385: 0x26, 0x386: 0x26, 0x387: 0x26, - 0x388: 0x26, 0x389: 0x26, 0x38a: 0x26, 0x38b: 0x26, 0x38c: 0x26, 0x38d: 0x26, 0x38e: 0x10b, - 0x390: 0x26, 0x391: 0x10c, 0x392: 0x26, 0x393: 0x26, 0x394: 0x26, 0x395: 0x10d, - 0x3be: 0xa9, 0x3bf: 0x10e, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x26, 0x3c1: 0x26, 0x3c2: 0x26, 0x3c3: 0x26, 0x3c4: 0x26, 0x3c5: 0x26, 0x3c6: 0x26, 0x3c7: 0x26, - 0x3c8: 0x26, 0x3c9: 0x26, 0x3ca: 0x26, 0x3cb: 0x26, 0x3cc: 0x26, 0x3cd: 0x26, 0x3ce: 0x26, 0x3cf: 0x26, - 0x3d0: 0x10f, 0x3d1: 0x110, - // Block 0x10, offset 0x400 - 0x410: 0x26, 0x411: 0x26, 0x412: 0x26, 0x413: 0x26, 0x414: 0x26, 0x415: 0x26, 0x416: 0x26, 0x417: 0x26, - 0x418: 0x26, 0x419: 0x111, - // Block 0x11, offset 0x440 - 0x460: 0x26, 0x461: 0x26, 0x462: 0x26, 0x463: 0x26, 0x464: 0x26, 0x465: 0x26, 0x466: 0x26, 0x467: 0x26, - 0x468: 0x100, 0x469: 0x112, 0x46a: 0x113, 0x46b: 0x114, 0x46c: 0x115, 0x46d: 0x116, 0x46e: 0x117, - 0x479: 0x118, 0x47c: 0x26, 0x47d: 0x119, 0x47e: 0x11a, 0x47f: 0x11b, - // Block 0x12, offset 0x480 - 0x4bf: 0x11c, - // Block 0x13, offset 0x4c0 - 0x4f0: 0x26, 0x4f1: 0x11d, 0x4f2: 0x11e, - // Block 0x14, offset 0x500 - 0x53c: 0x11f, 0x53d: 0x120, - // Block 0x15, offset 0x540 - 0x545: 0x121, 0x546: 0x122, - 0x549: 0x123, - 0x550: 0x124, 0x551: 0x125, 0x552: 0x126, 0x553: 0x127, 0x554: 0x128, 0x555: 0x129, 0x556: 0x12a, 0x557: 0x12b, - 0x558: 0x12c, 0x559: 0x12d, 0x55a: 0x12e, 0x55b: 0x12f, 0x55c: 0x130, 0x55d: 0x131, 0x55e: 0x132, 0x55f: 0x133, - 0x568: 0x134, 0x569: 0x135, 0x56a: 0x136, - 0x57c: 0x137, - // Block 0x16, offset 0x580 - 0x580: 0x138, 0x581: 0x139, 0x582: 0x13a, 0x584: 0x13b, 0x585: 0x13c, - 0x58a: 0x13d, 0x58b: 0x13e, - 0x593: 0x13f, - 0x59f: 0x140, - 0x5a0: 0x26, 0x5a1: 0x26, 0x5a2: 0x26, 0x5a3: 0x141, 0x5a4: 0x14, 0x5a5: 0x142, - 0x5b8: 0x143, 0x5b9: 0x15, 0x5ba: 0x144, - // Block 0x17, offset 0x5c0 - 0x5c4: 0x145, 0x5c5: 0x146, 0x5c6: 0x147, - 0x5cf: 0x148, - 0x5ef: 0x149, - // Block 0x18, offset 0x600 - 0x610: 0x0a, 0x611: 0x0b, 0x612: 0x0c, 0x613: 0x0d, 0x614: 0x0e, 0x616: 0x0f, - 0x61a: 0x10, 0x61b: 0x11, 0x61c: 0x12, 0x61d: 0x13, 0x61e: 0x14, 0x61f: 0x15, - // Block 0x19, offset 0x640 - 0x640: 0x14a, 0x641: 0x14b, 0x644: 0x14b, 0x645: 0x14b, 0x646: 0x14b, 0x647: 0x14c, - // Block 0x1a, offset 0x680 - 0x6a0: 0x17, -} - -// sparseOffsets: 312 entries, 624 bytes -var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x34, 0x37, 0x3b, 0x3e, 0x42, 0x4c, 0x4e, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xaf, 0xb7, 0xbd, 0xcb, 0xd6, 0xe3, 0xee, 0xfa, 0x104, 0x110, 0x11b, 0x127, 0x133, 0x13b, 0x145, 0x150, 0x15b, 0x167, 0x16d, 0x178, 0x17e, 0x186, 0x189, 0x18e, 0x192, 0x196, 0x19d, 0x1a6, 0x1ae, 0x1af, 0x1b8, 0x1bf, 0x1c7, 0x1cd, 0x1d2, 0x1d6, 0x1d9, 0x1db, 0x1de, 0x1e3, 0x1e4, 0x1e6, 0x1e8, 0x1ea, 0x1f1, 0x1f6, 0x1fa, 0x203, 0x206, 0x209, 0x20f, 0x210, 0x21b, 0x21c, 0x21d, 0x222, 0x22f, 0x238, 0x23e, 0x246, 0x24f, 0x258, 0x261, 0x266, 0x269, 0x274, 0x282, 0x284, 0x28b, 0x28f, 0x29b, 0x29c, 0x2a7, 0x2af, 0x2b7, 0x2bd, 0x2be, 0x2cc, 0x2d1, 0x2d4, 0x2d9, 0x2dd, 0x2e3, 0x2e8, 0x2eb, 0x2f0, 0x2f5, 0x2f6, 0x2fc, 0x2fe, 0x2ff, 0x301, 0x303, 0x306, 0x307, 0x309, 0x30c, 0x312, 0x316, 0x318, 0x31d, 0x324, 0x334, 0x33e, 0x33f, 0x348, 0x34c, 0x351, 0x359, 0x35f, 0x365, 0x36f, 0x374, 0x37d, 0x383, 0x38c, 0x390, 0x398, 0x39a, 0x39c, 0x39f, 0x3a1, 0x3a3, 0x3a4, 0x3a5, 0x3a7, 0x3a9, 0x3af, 0x3b4, 0x3b6, 0x3bd, 0x3c0, 0x3c2, 0x3c8, 0x3cd, 0x3cf, 0x3d0, 0x3d1, 0x3d2, 0x3d4, 0x3d6, 0x3d8, 0x3db, 0x3dd, 0x3e0, 0x3e8, 0x3eb, 0x3ef, 0x3f7, 0x3f9, 0x409, 0x40a, 0x40c, 0x411, 0x417, 0x419, 0x41a, 0x41c, 0x41e, 0x420, 0x42d, 0x42e, 0x42f, 0x433, 0x435, 0x436, 0x437, 0x438, 0x439, 0x43c, 0x43f, 0x440, 0x443, 0x44a, 0x450, 0x452, 0x456, 0x45e, 0x464, 0x468, 0x46f, 0x473, 0x477, 0x480, 0x48a, 0x48c, 0x492, 0x498, 0x4a2, 0x4ac, 0x4ae, 0x4b7, 0x4bd, 0x4c3, 0x4c9, 0x4cc, 0x4d2, 0x4d5, 0x4de, 0x4df, 0x4e6, 0x4ea, 0x4eb, 0x4ee, 0x4f8, 0x4fb, 0x4fd, 0x504, 0x50c, 0x512, 0x519, 0x51a, 0x520, 0x523, 0x52b, 0x532, 0x53c, 0x544, 0x547, 0x54c, 0x550, 0x551, 0x552, 0x553, 0x554, 0x555, 0x557, 0x55a, 0x55b, 0x55e, 0x55f, 0x562, 0x564, 0x568, 0x569, 0x56b, 0x56e, 0x570, 0x573, 0x576, 0x578, 0x57d, 0x57f, 0x580, 0x585, 0x589, 0x58a, 0x58d, 0x591, 0x59c, 0x5a0, 0x5a8, 0x5ad, 0x5b1, 0x5b4, 0x5b8, 0x5bb, 0x5be, 0x5c3, 0x5c7, 0x5cb, 0x5cf, 0x5d3, 0x5d5, 0x5d7, 0x5da, 0x5de, 0x5e4, 0x5e5, 0x5e6, 0x5e9, 0x5eb, 0x5ed, 0x5f0, 0x5f5, 0x5f9, 0x5fb, 0x601, 0x60a, 0x60f, 0x610, 0x613, 0x614, 0x615, 0x616, 0x618, 0x619, 0x61a} - -// sparseValues: 1562 entries, 6248 bytes -var sparseValues = [1562]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0004, lo: 0xa8, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xaa}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0004, lo: 0xaf, hi: 0xaf}, - {value: 0x0004, lo: 0xb4, hi: 0xb4}, - {value: 0x001a, lo: 0xb5, hi: 0xb5}, - {value: 0x0054, lo: 0xb7, hi: 0xb7}, - {value: 0x0004, lo: 0xb8, hi: 0xb8}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - // Block 0x1, offset 0x9 - {value: 0x2013, lo: 0x80, hi: 0x96}, - {value: 0x2013, lo: 0x98, hi: 0x9e}, - {value: 0x009a, lo: 0x9f, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xb6}, - {value: 0x2012, lo: 0xb8, hi: 0xbe}, - {value: 0x0252, lo: 0xbf, hi: 0xbf}, - // Block 0x2, offset 0xf - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x011b, lo: 0xb0, hi: 0xb0}, - {value: 0x019a, lo: 0xb1, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb7}, - {value: 0x0012, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x0553, lo: 0xbf, hi: 0xbf}, - // Block 0x3, offset 0x18 - {value: 0x0552, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x01da, lo: 0x89, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xb7}, - {value: 0x0253, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x028a, lo: 0xbf, hi: 0xbf}, - // Block 0x4, offset 0x24 - {value: 0x0117, lo: 0x80, hi: 0x9f}, - {value: 0x2f53, lo: 0xa0, hi: 0xa0}, - {value: 0x0012, lo: 0xa1, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xb3}, - {value: 0x0012, lo: 0xb4, hi: 0xb9}, - {value: 0x090b, lo: 0xba, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x2953, lo: 0xbd, hi: 0xbd}, - {value: 0x098b, lo: 0xbe, hi: 0xbe}, - {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, - // Block 0x5, offset 0x2e - {value: 0x0015, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x97}, - {value: 0x0004, lo: 0x98, hi: 0x9d}, - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0015, lo: 0xa0, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xbf}, - // Block 0x6, offset 0x34 - {value: 0x0024, lo: 0x80, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbf}, - // Block 0x7, offset 0x37 - {value: 0x6553, lo: 0x80, hi: 0x8f}, - {value: 0x2013, lo: 0x90, hi: 0x9f}, - {value: 0x5f53, lo: 0xa0, hi: 0xaf}, - {value: 0x2012, lo: 0xb0, hi: 0xbf}, - // Block 0x8, offset 0x3b - {value: 0x5f52, lo: 0x80, hi: 0x8f}, - {value: 0x6552, lo: 0x90, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x9, offset 0x3e - {value: 0x0117, lo: 0x80, hi: 0x81}, - {value: 0x0024, lo: 0x83, hi: 0x87}, - {value: 0x0014, lo: 0x88, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xbf}, - // Block 0xa, offset 0x42 - {value: 0x0f13, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x0716, lo: 0x8b, hi: 0x8c}, - {value: 0x0316, lo: 0x8d, hi: 0x8e}, - {value: 0x0f12, lo: 0x8f, hi: 0x8f}, - {value: 0x0117, lo: 0x90, hi: 0xbf}, - // Block 0xb, offset 0x4c - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x6553, lo: 0xb1, hi: 0xbf}, - // Block 0xc, offset 0x4e - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6853, lo: 0x90, hi: 0x96}, - {value: 0x0014, lo: 0x99, hi: 0x99}, - {value: 0x0010, lo: 0x9a, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0054, lo: 0x9f, hi: 0x9f}, - {value: 0x0012, lo: 0xa0, hi: 0xa0}, - {value: 0x6552, lo: 0xa1, hi: 0xaf}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0xd, offset 0x57 - {value: 0x0034, lo: 0x81, hi: 0x82}, - {value: 0x0024, lo: 0x84, hi: 0x84}, - {value: 0x0034, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0xaa}, - {value: 0x0010, lo: 0xaf, hi: 0xb3}, - {value: 0x0054, lo: 0xb4, hi: 0xb4}, - // Block 0xe, offset 0x5e - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0024, lo: 0x90, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0014, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xf, offset 0x63 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9c}, - {value: 0x0024, lo: 0x9d, hi: 0x9e}, - {value: 0x0034, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x10, offset 0x71 - {value: 0x0010, lo: 0x80, hi: 0xbf}, - // Block 0x11, offset 0x72 - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0024, lo: 0x9f, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xaa, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x12, offset 0x80 - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0034, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0034, lo: 0xb1, hi: 0xb1}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbd}, - {value: 0x0034, lo: 0xbe, hi: 0xbe}, - {value: 0x0024, lo: 0xbf, hi: 0xbf}, - // Block 0x13, offset 0x8f - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0024, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x88}, - {value: 0x0024, lo: 0x89, hi: 0x8a}, - {value: 0x0010, lo: 0x8d, hi: 0xbf}, - // Block 0x14, offset 0x99 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x15, offset 0x9c - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xb1}, - {value: 0x0034, lo: 0xb2, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0x16, offset 0xa3 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x99}, - {value: 0x0014, lo: 0x9a, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0xa3}, - {value: 0x0014, lo: 0xa4, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xad}, - // Block 0x17, offset 0xab - {value: 0x0010, lo: 0x80, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0xa0, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x18, offset 0xaf - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0004, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x8e}, - {value: 0x0014, lo: 0x90, hi: 0x91}, - {value: 0x0024, lo: 0x98, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x9b}, - {value: 0x0024, lo: 0x9c, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x19, offset 0xb7 - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1a, offset 0xbd - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0x1b, offset 0xcb - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb6, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1c, offset 0xd6 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xb1}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - // Block 0x1d, offset 0xe3 - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x1e, offset 0xee - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x99, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x1f, offset 0xfa - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x20, offset 0x104 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x85}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xbf}, - // Block 0x21, offset 0x110 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x22, offset 0x11b - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x23, offset 0x127 - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0010, lo: 0xa8, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x24, offset 0x133 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x25, offset 0x13b - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbf}, - // Block 0x26, offset 0x145 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x88}, - {value: 0x0014, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9a}, - {value: 0x0010, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x27, offset 0x150 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x28, offset 0x15b - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x9d, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb3}, - // Block 0x29, offset 0x167 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x2a, offset 0x16d - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x94, hi: 0x97}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xba, hi: 0xbf}, - // Block 0x2b, offset 0x178 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x96}, - {value: 0x0010, lo: 0x9a, hi: 0xb1}, - {value: 0x0010, lo: 0xb3, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x2c, offset 0x17e - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x94}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9f}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - // Block 0x2d, offset 0x186 - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - // Block 0x2e, offset 0x189 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x2f, offset 0x18e - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - {value: 0x0014, lo: 0xbb, hi: 0xbc}, - // Block 0x30, offset 0x192 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x31, offset 0x196 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0034, lo: 0x98, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0034, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x32, offset 0x19d - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xac}, - {value: 0x0034, lo: 0xb1, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xba, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x33, offset 0x1a6 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0024, lo: 0x82, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x86, hi: 0x87}, - {value: 0x0010, lo: 0x88, hi: 0x8c}, - {value: 0x0014, lo: 0x8d, hi: 0x97}, - {value: 0x0014, lo: 0x99, hi: 0xbc}, - // Block 0x34, offset 0x1ae - {value: 0x0034, lo: 0x86, hi: 0x86}, - // Block 0x35, offset 0x1af - {value: 0x0010, lo: 0xab, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbe}, - // Block 0x36, offset 0x1b8 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x96, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x99}, - {value: 0x0014, lo: 0x9e, hi: 0xa0}, - {value: 0x0010, lo: 0xa2, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xad}, - {value: 0x0014, lo: 0xb1, hi: 0xb4}, - // Block 0x37, offset 0x1bf - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x6c53, lo: 0xa0, hi: 0xbf}, - // Block 0x38, offset 0x1c7 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x9a, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x39, offset 0x1cd - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x3a, offset 0x1d2 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x82, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3b, offset 0x1d6 - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3c, offset 0x1d9 - {value: 0x0010, lo: 0x80, hi: 0x9a}, - {value: 0x0024, lo: 0x9d, hi: 0x9f}, - // Block 0x3d, offset 0x1db - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x7453, lo: 0xa0, hi: 0xaf}, - {value: 0x7853, lo: 0xb0, hi: 0xbf}, - // Block 0x3e, offset 0x1de - {value: 0x7c53, lo: 0x80, hi: 0x8f}, - {value: 0x8053, lo: 0x90, hi: 0x9f}, - {value: 0x7c53, lo: 0xa0, hi: 0xaf}, - {value: 0x0813, lo: 0xb0, hi: 0xb5}, - {value: 0x0892, lo: 0xb8, hi: 0xbd}, - // Block 0x3f, offset 0x1e3 - {value: 0x0010, lo: 0x81, hi: 0xbf}, - // Block 0x40, offset 0x1e4 - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0010, lo: 0xaf, hi: 0xbf}, - // Block 0x41, offset 0x1e6 - {value: 0x0010, lo: 0x81, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x42, offset 0x1e8 - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb8}, - // Block 0x43, offset 0x1ea - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0034, lo: 0x94, hi: 0x94}, - {value: 0x0030, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x9f, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0030, lo: 0xb4, hi: 0xb4}, - // Block 0x44, offset 0x1f1 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xac}, - {value: 0x0010, lo: 0xae, hi: 0xb0}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - // Block 0x45, offset 0x1f6 - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x46, offset 0x1fa - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x89, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0014, lo: 0x93, hi: 0x93}, - {value: 0x0004, lo: 0x97, hi: 0x97}, - {value: 0x0024, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0x47, offset 0x203 - {value: 0x0014, lo: 0x8b, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x48, offset 0x206 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb8}, - // Block 0x49, offset 0x209 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x4a, offset 0x20f - {value: 0x0010, lo: 0x80, hi: 0xb5}, - // Block 0x4b, offset 0x210 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbb}, - // Block 0x4c, offset 0x21b - {value: 0x0010, lo: 0x86, hi: 0x8f}, - // Block 0x4d, offset 0x21c - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x4e, offset 0x21d - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - // Block 0x4f, offset 0x222 - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x9e}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xac}, - {value: 0x0010, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xbc}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x50, offset 0x22f - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xa7, hi: 0xa7}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - {value: 0x0034, lo: 0xb5, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbc}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x51, offset 0x238 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0024, lo: 0x81, hi: 0x82}, - {value: 0x0034, lo: 0x83, hi: 0x84}, - {value: 0x0024, lo: 0x85, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0024, lo: 0x8b, hi: 0x8e}, - // Block 0x52, offset 0x23e - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x53, offset 0x246 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0030, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xab, hi: 0xab}, - {value: 0x0034, lo: 0xac, hi: 0xac}, - {value: 0x0024, lo: 0xad, hi: 0xb3}, - // Block 0x54, offset 0x24f - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0030, lo: 0xaa, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbf}, - // Block 0x55, offset 0x258 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0030, lo: 0xb2, hi: 0xb3}, - // Block 0x56, offset 0x261 - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0x57, offset 0x266 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8d, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x58, offset 0x269 - {value: 0x31ea, lo: 0x80, hi: 0x80}, - {value: 0x326a, lo: 0x81, hi: 0x81}, - {value: 0x32ea, lo: 0x82, hi: 0x82}, - {value: 0x336a, lo: 0x83, hi: 0x83}, - {value: 0x33ea, lo: 0x84, hi: 0x84}, - {value: 0x346a, lo: 0x85, hi: 0x85}, - {value: 0x34ea, lo: 0x86, hi: 0x86}, - {value: 0x356a, lo: 0x87, hi: 0x87}, - {value: 0x35ea, lo: 0x88, hi: 0x88}, - {value: 0x8353, lo: 0x90, hi: 0xba}, - {value: 0x8353, lo: 0xbd, hi: 0xbf}, - // Block 0x59, offset 0x274 - {value: 0x0024, lo: 0x90, hi: 0x92}, - {value: 0x0034, lo: 0x94, hi: 0x99}, - {value: 0x0024, lo: 0x9a, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9f}, - {value: 0x0024, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0034, lo: 0xa2, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xb3}, - {value: 0x0024, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb7}, - {value: 0x0024, lo: 0xb8, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xba}, - // Block 0x5a, offset 0x282 - {value: 0x0012, lo: 0x80, hi: 0xab}, - {value: 0x0015, lo: 0xac, hi: 0xbf}, - // Block 0x5b, offset 0x284 - {value: 0x0015, lo: 0x80, hi: 0xaa}, - {value: 0x0012, lo: 0xab, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb8}, - {value: 0x8752, lo: 0xb9, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbc}, - {value: 0x8b52, lo: 0xbd, hi: 0xbd}, - {value: 0x0012, lo: 0xbe, hi: 0xbf}, - // Block 0x5c, offset 0x28b - {value: 0x0012, lo: 0x80, hi: 0x8d}, - {value: 0x8f52, lo: 0x8e, hi: 0x8e}, - {value: 0x0012, lo: 0x8f, hi: 0x9a}, - {value: 0x0015, lo: 0x9b, hi: 0xbf}, - // Block 0x5d, offset 0x28f - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0024, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbd}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x5e, offset 0x29b - {value: 0x0117, lo: 0x80, hi: 0xbf}, - // Block 0x5f, offset 0x29c - {value: 0x0117, lo: 0x80, hi: 0x95}, - {value: 0x369a, lo: 0x96, hi: 0x96}, - {value: 0x374a, lo: 0x97, hi: 0x97}, - {value: 0x37fa, lo: 0x98, hi: 0x98}, - {value: 0x38aa, lo: 0x99, hi: 0x99}, - {value: 0x395a, lo: 0x9a, hi: 0x9a}, - {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, - {value: 0x0012, lo: 0x9c, hi: 0x9d}, - {value: 0x3abb, lo: 0x9e, hi: 0x9e}, - {value: 0x0012, lo: 0x9f, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x60, offset 0x2a7 - {value: 0x0812, lo: 0x80, hi: 0x87}, - {value: 0x0813, lo: 0x88, hi: 0x8f}, - {value: 0x0812, lo: 0x90, hi: 0x95}, - {value: 0x0813, lo: 0x98, hi: 0x9d}, - {value: 0x0812, lo: 0xa0, hi: 0xa7}, - {value: 0x0813, lo: 0xa8, hi: 0xaf}, - {value: 0x0812, lo: 0xb0, hi: 0xb7}, - {value: 0x0813, lo: 0xb8, hi: 0xbf}, - // Block 0x61, offset 0x2af - {value: 0x0004, lo: 0x8b, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8f}, - {value: 0x0054, lo: 0x98, hi: 0x99}, - {value: 0x0054, lo: 0xa4, hi: 0xa4}, - {value: 0x0054, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xaa, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x62, offset 0x2b7 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x94, hi: 0x94}, - {value: 0x0014, lo: 0xa0, hi: 0xa4}, - {value: 0x0014, lo: 0xa6, hi: 0xaf}, - {value: 0x0015, lo: 0xb1, hi: 0xb1}, - {value: 0x0015, lo: 0xbf, hi: 0xbf}, - // Block 0x63, offset 0x2bd - {value: 0x0015, lo: 0x90, hi: 0x9c}, - // Block 0x64, offset 0x2be - {value: 0x0024, lo: 0x90, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x93}, - {value: 0x0024, lo: 0x94, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0xa0}, - {value: 0x0024, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa4}, - {value: 0x0034, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa7}, - {value: 0x0034, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xa9}, - {value: 0x0034, lo: 0xaa, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - // Block 0x65, offset 0x2cc - {value: 0x0016, lo: 0x85, hi: 0x86}, - {value: 0x0012, lo: 0x87, hi: 0x89}, - {value: 0xa452, lo: 0x8e, hi: 0x8e}, - {value: 0x1013, lo: 0xa0, hi: 0xaf}, - {value: 0x1012, lo: 0xb0, hi: 0xbf}, - // Block 0x66, offset 0x2d1 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x88}, - // Block 0x67, offset 0x2d4 - {value: 0xa753, lo: 0xb6, hi: 0xb7}, - {value: 0xaa53, lo: 0xb8, hi: 0xb9}, - {value: 0xad53, lo: 0xba, hi: 0xbb}, - {value: 0xaa53, lo: 0xbc, hi: 0xbd}, - {value: 0xa753, lo: 0xbe, hi: 0xbf}, - // Block 0x68, offset 0x2d9 - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6553, lo: 0x90, hi: 0x9f}, - {value: 0xb053, lo: 0xa0, hi: 0xaf}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0x69, offset 0x2dd - {value: 0x0117, lo: 0x80, hi: 0xa3}, - {value: 0x0012, lo: 0xa4, hi: 0xa4}, - {value: 0x0716, lo: 0xab, hi: 0xac}, - {value: 0x0316, lo: 0xad, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb3}, - // Block 0x6a, offset 0x2e3 - {value: 0x6c52, lo: 0x80, hi: 0x9f}, - {value: 0x7052, lo: 0xa0, hi: 0xa5}, - {value: 0x7052, lo: 0xa7, hi: 0xa7}, - {value: 0x7052, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x6b, offset 0x2e8 - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x6c, offset 0x2eb - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0010, lo: 0xb0, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x6d, offset 0x2f0 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9e}, - {value: 0x0024, lo: 0xa0, hi: 0xbf}, - // Block 0x6e, offset 0x2f5 - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - // Block 0x6f, offset 0x2f6 - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0xaa, hi: 0xad}, - {value: 0x0030, lo: 0xae, hi: 0xaf}, - {value: 0x0004, lo: 0xb1, hi: 0xb5}, - {value: 0x0014, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - // Block 0x70, offset 0x2fc - {value: 0x0034, lo: 0x99, hi: 0x9a}, - {value: 0x0004, lo: 0x9b, hi: 0x9e}, - // Block 0x71, offset 0x2fe - {value: 0x0004, lo: 0xbc, hi: 0xbe}, - // Block 0x72, offset 0x2ff - {value: 0x0010, lo: 0x85, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x73, offset 0x301 - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x74, offset 0x303 - {value: 0x0010, lo: 0x80, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0xbf}, - // Block 0x75, offset 0x306 - {value: 0x0010, lo: 0x80, hi: 0x8c}, - // Block 0x76, offset 0x307 - {value: 0x0010, lo: 0x90, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x77, offset 0x309 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0xab}, - // Block 0x78, offset 0x30c - {value: 0x0117, lo: 0x80, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb2}, - {value: 0x0024, lo: 0xb4, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x79, offset 0x312 - {value: 0x0117, lo: 0x80, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9d}, - {value: 0x0024, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x7a, offset 0x316 - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb1}, - // Block 0x7b, offset 0x318 - {value: 0x0004, lo: 0x80, hi: 0x87}, - {value: 0x0014, lo: 0x88, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xaf}, - {value: 0x0012, lo: 0xb0, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xbf}, - // Block 0x7c, offset 0x31d - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x0015, lo: 0xb0, hi: 0xb0}, - {value: 0x0012, lo: 0xb1, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x8753, lo: 0xbd, hi: 0xbd}, - {value: 0x0117, lo: 0xbe, hi: 0xbf}, - // Block 0x7d, offset 0x324 - {value: 0x0117, lo: 0x80, hi: 0x83}, - {value: 0x6553, lo: 0x84, hi: 0x84}, - {value: 0x908b, lo: 0x85, hi: 0x85}, - {value: 0x8f53, lo: 0x86, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x0117, lo: 0x90, hi: 0x91}, - {value: 0x0012, lo: 0x93, hi: 0x93}, - {value: 0x0012, lo: 0x95, hi: 0x95}, - {value: 0x0117, lo: 0x96, hi: 0x99}, - {value: 0x0015, lo: 0xb2, hi: 0xb4}, - {value: 0x0316, lo: 0xb5, hi: 0xb6}, - {value: 0x0010, lo: 0xb7, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbf}, - // Block 0x7e, offset 0x334 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x8c, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0034, lo: 0xac, hi: 0xac}, - // Block 0x7f, offset 0x33e - {value: 0x0010, lo: 0x80, hi: 0xb3}, - // Block 0x80, offset 0x33f - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xa0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb7}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x81, offset 0x348 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x82, offset 0x34c - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0x92}, - {value: 0x0030, lo: 0x93, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0x83, offset 0x351 - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x84, offset 0x359 - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0004, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x85, offset 0x35f - {value: 0x0010, lo: 0x80, hi: 0xa8}, - {value: 0x0014, lo: 0xa9, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0x86, offset 0x365 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x87, offset 0x36f - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0024, lo: 0xbe, hi: 0xbf}, - // Block 0x88, offset 0x374 - {value: 0x0024, lo: 0x81, hi: 0x81}, - {value: 0x0004, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - // Block 0x89, offset 0x37d - {value: 0x0010, lo: 0x81, hi: 0x86}, - {value: 0x0010, lo: 0x89, hi: 0x8e}, - {value: 0x0010, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x8a, offset 0x383 - {value: 0x0012, lo: 0x80, hi: 0x92}, - {value: 0xb352, lo: 0x93, hi: 0x93}, - {value: 0x0012, lo: 0x94, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9f}, - {value: 0x0012, lo: 0xa0, hi: 0xa8}, - {value: 0x0015, lo: 0xa9, hi: 0xa9}, - {value: 0x0004, lo: 0xaa, hi: 0xab}, - {value: 0x74d2, lo: 0xb0, hi: 0xbf}, - // Block 0x8b, offset 0x38c - {value: 0x78d2, lo: 0x80, hi: 0x8f}, - {value: 0x7cd2, lo: 0x90, hi: 0x9f}, - {value: 0x80d2, lo: 0xa0, hi: 0xaf}, - {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, - // Block 0x8c, offset 0x390 - {value: 0x0010, lo: 0x80, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x8d, offset 0x398 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x8e, offset 0x39a - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x8b, hi: 0xbb}, - // Block 0x8f, offset 0x39c - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0xbf}, - // Block 0x90, offset 0x39f - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0004, lo: 0xb2, hi: 0xbf}, - // Block 0x91, offset 0x3a1 - {value: 0x0004, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x93, hi: 0xbf}, - // Block 0x92, offset 0x3a3 - {value: 0x0010, lo: 0x80, hi: 0xbd}, - // Block 0x93, offset 0x3a4 - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x94, offset 0x3a5 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0xbf}, - // Block 0x95, offset 0x3a7 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0xb0, hi: 0xbb}, - // Block 0x96, offset 0x3a9 - {value: 0x0014, lo: 0x80, hi: 0x8f}, - {value: 0x0054, lo: 0x93, hi: 0x93}, - {value: 0x0024, lo: 0xa0, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - // Block 0x97, offset 0x3af - {value: 0x0010, lo: 0x8d, hi: 0x8f}, - {value: 0x0054, lo: 0x92, hi: 0x92}, - {value: 0x0054, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0xb0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0x98, offset 0x3b4 - {value: 0x0010, lo: 0x80, hi: 0xbc}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x99, offset 0x3b6 - {value: 0x0054, lo: 0x87, hi: 0x87}, - {value: 0x0054, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0054, lo: 0x9a, hi: 0x9a}, - {value: 0x5f53, lo: 0xa1, hi: 0xba}, - {value: 0x0004, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9a, offset 0x3bd - {value: 0x0004, lo: 0x80, hi: 0x80}, - {value: 0x5f52, lo: 0x81, hi: 0x9a}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - // Block 0x9b, offset 0x3c0 - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbe}, - // Block 0x9c, offset 0x3c2 - {value: 0x0010, lo: 0x82, hi: 0x87}, - {value: 0x0010, lo: 0x8a, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0x97}, - {value: 0x0010, lo: 0x9a, hi: 0x9c}, - {value: 0x0004, lo: 0xa3, hi: 0xa3}, - {value: 0x0014, lo: 0xb9, hi: 0xbb}, - // Block 0x9d, offset 0x3c8 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0010, lo: 0x8d, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xba}, - {value: 0x0010, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9e, offset 0x3cd - {value: 0x0010, lo: 0x80, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x9d}, - // Block 0x9f, offset 0x3cf - {value: 0x0010, lo: 0x80, hi: 0xba}, - // Block 0xa0, offset 0x3d0 - {value: 0x0010, lo: 0x80, hi: 0xb4}, - // Block 0xa1, offset 0x3d1 - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0xa2, offset 0x3d2 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa3, offset 0x3d4 - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - // Block 0xa4, offset 0x3d6 - {value: 0x0010, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xad, hi: 0xbf}, - // Block 0xa5, offset 0x3d8 - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0xb5}, - {value: 0x0024, lo: 0xb6, hi: 0xba}, - // Block 0xa6, offset 0x3db - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa7, offset 0x3dd - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x91, hi: 0x95}, - // Block 0xa8, offset 0x3e0 - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x97}, - {value: 0xb653, lo: 0x98, hi: 0x9f}, - {value: 0xb953, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbf}, - // Block 0xa9, offset 0x3e8 - {value: 0xb652, lo: 0x80, hi: 0x87}, - {value: 0xb952, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xaa, offset 0x3eb - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0xb953, lo: 0xb0, hi: 0xb7}, - {value: 0xb653, lo: 0xb8, hi: 0xbf}, - // Block 0xab, offset 0x3ef - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x93}, - {value: 0xb952, lo: 0x98, hi: 0x9f}, - {value: 0xb652, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbb}, - // Block 0xac, offset 0x3f7 - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xad, offset 0x3f9 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0xbc53, lo: 0xb0, hi: 0xb0}, - {value: 0xbf53, lo: 0xb1, hi: 0xb1}, - {value: 0xc253, lo: 0xb2, hi: 0xb2}, - {value: 0xbf53, lo: 0xb3, hi: 0xb3}, - {value: 0xc553, lo: 0xb4, hi: 0xb4}, - {value: 0xbf53, lo: 0xb5, hi: 0xb5}, - {value: 0xc253, lo: 0xb6, hi: 0xb6}, - {value: 0xbf53, lo: 0xb7, hi: 0xb7}, - {value: 0xbc53, lo: 0xb8, hi: 0xb8}, - {value: 0xc853, lo: 0xb9, hi: 0xb9}, - {value: 0xcb53, lo: 0xba, hi: 0xba}, - {value: 0xce53, lo: 0xbc, hi: 0xbc}, - {value: 0xc853, lo: 0xbd, hi: 0xbd}, - {value: 0xcb53, lo: 0xbe, hi: 0xbe}, - {value: 0xc853, lo: 0xbf, hi: 0xbf}, - // Block 0xae, offset 0x409 - {value: 0x0010, lo: 0x80, hi: 0xb6}, - // Block 0xaf, offset 0x40a - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - // Block 0xb0, offset 0x40c - {value: 0x0015, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0015, lo: 0x83, hi: 0x85}, - {value: 0x0015, lo: 0x87, hi: 0xb0}, - {value: 0x0015, lo: 0xb2, hi: 0xba}, - // Block 0xb1, offset 0x411 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xb2, offset 0x417 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xb3, offset 0x419 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - // Block 0xb4, offset 0x41a - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - // Block 0xb5, offset 0x41c - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb9}, - // Block 0xb6, offset 0x41e - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xb7, offset 0x420 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x8e, hi: 0x8e}, - {value: 0x0024, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x99, hi: 0xb5}, - {value: 0x0024, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xb8, offset 0x42d - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0xb9, offset 0x42e - {value: 0x0010, lo: 0x80, hi: 0x9c}, - // Block 0xba, offset 0x42f - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - // Block 0xbb, offset 0x433 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - // Block 0xbc, offset 0x435 - {value: 0x0010, lo: 0x80, hi: 0x91}, - // Block 0xbd, offset 0x436 - {value: 0x0010, lo: 0x80, hi: 0x88}, - // Block 0xbe, offset 0x437 - {value: 0x5653, lo: 0x80, hi: 0xb2}, - // Block 0xbf, offset 0x438 - {value: 0x5652, lo: 0x80, hi: 0xb2}, - // Block 0xc0, offset 0x439 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc1, offset 0x43c - {value: 0x0010, lo: 0x80, hi: 0xa9}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0010, lo: 0xb0, hi: 0xb1}, - // Block 0xc2, offset 0x43f - {value: 0x0034, lo: 0xbd, hi: 0xbf}, - // Block 0xc3, offset 0x440 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xc4, offset 0x443 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x87}, - {value: 0x0024, lo: 0x88, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x8b}, - {value: 0x0024, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xc5, offset 0x44a - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0024, lo: 0x82, hi: 0x82}, - {value: 0x0034, lo: 0x83, hi: 0x83}, - {value: 0x0024, lo: 0x84, hi: 0x84}, - {value: 0x0034, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xc6, offset 0x450 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xc7, offset 0x452 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xc8, offset 0x456 - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xc9, offset 0x45e - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb6}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - // Block 0xca, offset 0x464 - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xcb, offset 0x468 - {value: 0x0024, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0xcc, offset 0x46f - {value: 0x0010, lo: 0x84, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - // Block 0xcd, offset 0x473 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xce, offset 0x477 - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x89, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - // Block 0xcf, offset 0x480 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb4}, - {value: 0x0030, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xb7}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xd0, offset 0x48a - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - // Block 0xd1, offset 0x48c - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xd2, offset 0x492 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa2}, - {value: 0x0014, lo: 0xa3, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xd3, offset 0x498 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xd4, offset 0x4a2 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0030, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9d, hi: 0xa3}, - {value: 0x0024, lo: 0xa6, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - // Block 0xd5, offset 0x4ac - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xd6, offset 0x4ae - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - // Block 0xd7, offset 0x4b7 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xd8, offset 0x4bd - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd9, offset 0x4c3 - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xda, offset 0x4c9 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x98, hi: 0x9b}, - {value: 0x0014, lo: 0x9c, hi: 0x9d}, - // Block 0xdb, offset 0x4cc - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xdc, offset 0x4d2 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xdd, offset 0x4d5 - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0014, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb5}, - {value: 0x0030, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - // Block 0xde, offset 0x4de - {value: 0x0010, lo: 0x80, hi: 0x89}, - // Block 0xdf, offset 0x4df - {value: 0x0014, lo: 0x9d, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xe0, offset 0x4e6 - {value: 0x0010, lo: 0x80, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - // Block 0xe1, offset 0x4ea - {value: 0x5f53, lo: 0xa0, hi: 0xbf}, - // Block 0xe2, offset 0x4eb - {value: 0x5f52, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xe3, offset 0x4ee - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x89, hi: 0x89}, - {value: 0x0010, lo: 0x8c, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0014, lo: 0xbb, hi: 0xbc}, - {value: 0x0030, lo: 0xbd, hi: 0xbd}, - {value: 0x0034, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xe4, offset 0x4f8 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0034, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xe5, offset 0x4fb - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - {value: 0x0010, lo: 0xaa, hi: 0xbf}, - // Block 0xe6, offset 0x4fd - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0014, lo: 0x94, hi: 0x97}, - {value: 0x0014, lo: 0x9a, hi: 0x9b}, - {value: 0x0010, lo: 0x9c, hi: 0x9f}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - // Block 0xe7, offset 0x504 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x8a}, - {value: 0x0010, lo: 0x8b, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbb, hi: 0xbe}, - // Block 0xe8, offset 0x50c - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0014, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x98}, - {value: 0x0014, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0x9c, hi: 0xbf}, - // Block 0xe9, offset 0x512 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0014, lo: 0x8a, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x99}, - {value: 0x0010, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xea, offset 0x519 - {value: 0x0010, lo: 0x80, hi: 0xb8}, - // Block 0xeb, offset 0x51a - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xec, offset 0x520 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0xed, offset 0x523 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0014, lo: 0x92, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xa9}, - {value: 0x0014, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0xee, offset 0x52b - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb6}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xef, offset 0x532 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa5}, - {value: 0x0010, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xbf}, - // Block 0xf0, offset 0x53c - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0014, lo: 0x90, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0x96}, - {value: 0x0034, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xf1, offset 0x544 - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - // Block 0xf2, offset 0x547 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xba}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xf3, offset 0x54c - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0030, lo: 0x81, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xf4, offset 0x550 - {value: 0x0010, lo: 0xb0, hi: 0xb0}, - // Block 0xf5, offset 0x551 - {value: 0x0010, lo: 0x80, hi: 0x99}, - // Block 0xf6, offset 0x552 - {value: 0x0010, lo: 0x80, hi: 0xae}, - // Block 0xf7, offset 0x553 - {value: 0x0010, lo: 0x80, hi: 0x83}, - // Block 0xf8, offset 0x554 - {value: 0x0010, lo: 0x80, hi: 0xb0}, - // Block 0xf9, offset 0x555 - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xbf}, - // Block 0xfa, offset 0x557 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x95}, - // Block 0xfb, offset 0x55a - {value: 0x0010, lo: 0x80, hi: 0x86}, - // Block 0xfc, offset 0x55b - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xfd, offset 0x55e - {value: 0x0010, lo: 0x80, hi: 0xbe}, - // Block 0xfe, offset 0x55f - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x90, hi: 0xad}, - {value: 0x0034, lo: 0xb0, hi: 0xb4}, - // Block 0xff, offset 0x562 - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - // Block 0x100, offset 0x564 - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa3, hi: 0xb7}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x101, offset 0x568 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - // Block 0x102, offset 0x569 - {value: 0x2013, lo: 0x80, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xbf}, - // Block 0x103, offset 0x56b - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x104, offset 0x56e - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0014, lo: 0x8f, hi: 0x9f}, - // Block 0x105, offset 0x570 - {value: 0x0014, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa3, hi: 0xa4}, - {value: 0x0030, lo: 0xb0, hi: 0xb1}, - // Block 0x106, offset 0x573 - {value: 0x0004, lo: 0xb0, hi: 0xb3}, - {value: 0x0004, lo: 0xb5, hi: 0xbb}, - {value: 0x0004, lo: 0xbd, hi: 0xbe}, - // Block 0x107, offset 0x576 - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbc}, - // Block 0x108, offset 0x578 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0034, lo: 0x9e, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa3}, - // Block 0x109, offset 0x57d - {value: 0x0014, lo: 0x80, hi: 0xad}, - {value: 0x0014, lo: 0xb0, hi: 0xbf}, - // Block 0x10a, offset 0x57f - {value: 0x0014, lo: 0x80, hi: 0x86}, - // Block 0x10b, offset 0x580 - {value: 0x0030, lo: 0xa5, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xa9}, - {value: 0x0030, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbf}, - // Block 0x10c, offset 0x585 - {value: 0x0034, lo: 0x80, hi: 0x82}, - {value: 0x0024, lo: 0x85, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8b}, - {value: 0x0024, lo: 0xaa, hi: 0xad}, - // Block 0x10d, offset 0x589 - {value: 0x0024, lo: 0x82, hi: 0x84}, - // Block 0x10e, offset 0x58a - {value: 0x0013, lo: 0x80, hi: 0x99}, - {value: 0x0012, lo: 0x9a, hi: 0xb3}, - {value: 0x0013, lo: 0xb4, hi: 0xbf}, - // Block 0x10f, offset 0x58d - {value: 0x0013, lo: 0x80, hi: 0x8d}, - {value: 0x0012, lo: 0x8e, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0xa7}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0x110, offset 0x591 - {value: 0x0013, lo: 0x80, hi: 0x81}, - {value: 0x0012, lo: 0x82, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0x9c}, - {value: 0x0013, lo: 0x9e, hi: 0x9f}, - {value: 0x0013, lo: 0xa2, hi: 0xa2}, - {value: 0x0013, lo: 0xa5, hi: 0xa6}, - {value: 0x0013, lo: 0xa9, hi: 0xac}, - {value: 0x0013, lo: 0xae, hi: 0xb5}, - {value: 0x0012, lo: 0xb6, hi: 0xb9}, - {value: 0x0012, lo: 0xbb, hi: 0xbb}, - {value: 0x0012, lo: 0xbd, hi: 0xbf}, - // Block 0x111, offset 0x59c - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0012, lo: 0x85, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0x112, offset 0x5a0 - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0013, lo: 0x84, hi: 0x85}, - {value: 0x0013, lo: 0x87, hi: 0x8a}, - {value: 0x0013, lo: 0x8d, hi: 0x94}, - {value: 0x0013, lo: 0x96, hi: 0x9c}, - {value: 0x0012, lo: 0x9e, hi: 0xb7}, - {value: 0x0013, lo: 0xb8, hi: 0xb9}, - {value: 0x0013, lo: 0xbb, hi: 0xbe}, - // Block 0x113, offset 0x5a8 - {value: 0x0013, lo: 0x80, hi: 0x84}, - {value: 0x0013, lo: 0x86, hi: 0x86}, - {value: 0x0013, lo: 0x8a, hi: 0x90}, - {value: 0x0012, lo: 0x92, hi: 0xab}, - {value: 0x0013, lo: 0xac, hi: 0xbf}, - // Block 0x114, offset 0x5ad - {value: 0x0013, lo: 0x80, hi: 0x85}, - {value: 0x0012, lo: 0x86, hi: 0x9f}, - {value: 0x0013, lo: 0xa0, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbf}, - // Block 0x115, offset 0x5b1 - {value: 0x0012, lo: 0x80, hi: 0x93}, - {value: 0x0013, lo: 0x94, hi: 0xad}, - {value: 0x0012, lo: 0xae, hi: 0xbf}, - // Block 0x116, offset 0x5b4 - {value: 0x0012, lo: 0x80, hi: 0x87}, - {value: 0x0013, lo: 0x88, hi: 0xa1}, - {value: 0x0012, lo: 0xa2, hi: 0xbb}, - {value: 0x0013, lo: 0xbc, hi: 0xbf}, - // Block 0x117, offset 0x5b8 - {value: 0x0013, lo: 0x80, hi: 0x95}, - {value: 0x0012, lo: 0x96, hi: 0xaf}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x118, offset 0x5bb - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0012, lo: 0x8a, hi: 0xa5}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0x119, offset 0x5be - {value: 0x0013, lo: 0x80, hi: 0x80}, - {value: 0x0012, lo: 0x82, hi: 0x9a}, - {value: 0x0012, lo: 0x9c, hi: 0xa1}, - {value: 0x0013, lo: 0xa2, hi: 0xba}, - {value: 0x0012, lo: 0xbc, hi: 0xbf}, - // Block 0x11a, offset 0x5c3 - {value: 0x0012, lo: 0x80, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0xb4}, - {value: 0x0012, lo: 0xb6, hi: 0xbf}, - // Block 0x11b, offset 0x5c7 - {value: 0x0012, lo: 0x80, hi: 0x8e}, - {value: 0x0012, lo: 0x90, hi: 0x95}, - {value: 0x0013, lo: 0x96, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x11c, offset 0x5cb - {value: 0x0012, lo: 0x80, hi: 0x88}, - {value: 0x0012, lo: 0x8a, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0x11d, offset 0x5cf - {value: 0x0012, lo: 0x80, hi: 0x82}, - {value: 0x0012, lo: 0x84, hi: 0x89}, - {value: 0x0017, lo: 0x8a, hi: 0x8b}, - {value: 0x0010, lo: 0x8e, hi: 0xbf}, - // Block 0x11e, offset 0x5d3 - {value: 0x0014, lo: 0x80, hi: 0xb6}, - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x11f, offset 0x5d5 - {value: 0x0014, lo: 0x80, hi: 0xac}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x120, offset 0x5d7 - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x9b, hi: 0x9f}, - {value: 0x0014, lo: 0xa1, hi: 0xaf}, - // Block 0x121, offset 0x5da - {value: 0x0012, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8a, hi: 0x8a}, - {value: 0x0012, lo: 0x8b, hi: 0x9e}, - {value: 0x0012, lo: 0xa5, hi: 0xaa}, - // Block 0x122, offset 0x5de - {value: 0x0024, lo: 0x80, hi: 0x86}, - {value: 0x0024, lo: 0x88, hi: 0x98}, - {value: 0x0024, lo: 0x9b, hi: 0xa1}, - {value: 0x0024, lo: 0xa3, hi: 0xa4}, - {value: 0x0024, lo: 0xa6, hi: 0xaa}, - {value: 0x0015, lo: 0xb0, hi: 0xbf}, - // Block 0x123, offset 0x5e4 - {value: 0x0015, lo: 0x80, hi: 0xad}, - // Block 0x124, offset 0x5e5 - {value: 0x0024, lo: 0x8f, hi: 0x8f}, - // Block 0x125, offset 0x5e6 - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - // Block 0x126, offset 0x5e9 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - // Block 0x127, offset 0x5eb - {value: 0x0010, lo: 0x90, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xae}, - // Block 0x128, offset 0x5ed - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0024, lo: 0xac, hi: 0xaf}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x129, offset 0x5f0 - {value: 0x0010, lo: 0x90, hi: 0xaa}, - {value: 0x0014, lo: 0xab, hi: 0xab}, - {value: 0x0034, lo: 0xac, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x12a, offset 0x5f5 - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xab}, - {value: 0x0010, lo: 0xad, hi: 0xae}, - {value: 0x0010, lo: 0xb0, hi: 0xbe}, - // Block 0x12b, offset 0x5f9 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0034, lo: 0x90, hi: 0x96}, - // Block 0x12c, offset 0x5fb - {value: 0xd152, lo: 0x80, hi: 0x81}, - {value: 0xd452, lo: 0x82, hi: 0x83}, - {value: 0x0024, lo: 0x84, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x12d, offset 0x601 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x9f}, - {value: 0x0010, lo: 0xa1, hi: 0xa2}, - {value: 0x0010, lo: 0xa4, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb7}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - // Block 0x12e, offset 0x60a - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x9b}, - {value: 0x0010, lo: 0xa1, hi: 0xa3}, - {value: 0x0010, lo: 0xa5, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xbb}, - // Block 0x12f, offset 0x60f - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x130, offset 0x610 - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x131, offset 0x613 - {value: 0x0013, lo: 0x80, hi: 0x89}, - // Block 0x132, offset 0x614 - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x133, offset 0x615 - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x134, offset 0x616 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0014, lo: 0xa0, hi: 0xbf}, - // Block 0x135, offset 0x618 - {value: 0x0014, lo: 0x80, hi: 0xbf}, - // Block 0x136, offset 0x619 - {value: 0x0014, lo: 0x80, hi: 0xaf}, -} - -// Total table size 16093 bytes (15KiB); checksum: EE91C452 diff --git a/embed/vendor/golang.org/x/text/cases/tables17.0.0.go b/embed/vendor/golang.org/x/text/cases/tables17.0.0.go deleted file mode 100644 index cee93cbd..00000000 --- a/embed/vendor/golang.org/x/text/cases/tables17.0.0.go +++ /dev/null @@ -1,2642 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -//go:build go1.27 - -package cases - -// UnicodeVersion is the Unicode version from which the tables in this package are derived. -const UnicodeVersion = "17.0.0" - -var xorData string = "" + // Size: 237 bytes - "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + - "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + - "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + - "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + - "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + - "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + - "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + - "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + - "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x03'" + - "\x00\x03)\x00\x03+\x00\x03/\x00\x03\x19\x00\x03\x1b\x00\x03\x1f\x00\x03 " + - "\x00\x01%\x00\x01'\x00\x01+\x00\x01-\x00\x01/\x00\x01;\x00\x01=\x00\x01" + - "\x1e\x00\x01\x22" - -var exceptions string = "" + // Size: 2478 bytes - "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + - "\x09sSS\x10\x1bꟜꟜ\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ" + - "\x10\x12LJLj\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12" + - "\x12dzdzDZ\x10\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10" + - "\x1bⱭⱭ\x10\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꟋꟋ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10" + - "\x1bꞮꞮ\x10\x1bⱢⱢ\x10\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10" + - "\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12β" + - "ΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ" + - "\x14$եւԵՒԵւ\x10\x1bᲐა\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ" + - "\x10\x1bᲖზ\x10\x1bᲗთ\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ" + - "\x10\x1bᲝო\x10\x1bᲞპ\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ" + - "\x10\x1bᲤფ\x10\x1bᲥქ\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც" + - "\x10\x1bᲫძ\x10\x1bᲬწ\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ" + - "\x10\x1bᲲჲ\x10\x1bᲳჳ\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ" + - "\x10\x1bᲹჹ\x10\x1bᲺჺ\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД" + - "\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" + - "\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" + - "ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" + - "ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + - "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + - "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + - "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + - "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + - "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + - "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + - "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + - "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" + - "\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" + - "ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" + - "̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" + - "ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" + - "\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" + - "\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" + - "\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ" + - "\x12\x10ɤɤ\x12\x10ƛƛ\x12\x12ffFFFf\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bff" + - "iFFIFfi\x13\x1bfflFFLFfl\x12\x12stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵ" + - "Մե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄխ" - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// caseTrie. Total size: 14000 bytes (13.67 KiB). Checksum: 76c852e9b991a172. -type caseTrie struct{} - -func newCaseTrie(i int) *caseTrie { - return &caseTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 24: - return uint16(caseValues[n<<6+uint32(b)]) - default: - n -= 24 - return uint16(sparse.lookup(n, b)) - } -} - -// caseValues: 26 blocks, 1664 entries, 3328 bytes -// The third block is the zero block. -var caseValues = [1664]uint16{ - // Block 0x0, offset 0x0 - 0x27: 0x0054, - 0x2e: 0x0054, - 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, - 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, - // Block 0x1, offset 0x40 - 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, - 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, - 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, - 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, - 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, - 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, - 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, - 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, - 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, - 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, - 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, - 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, - 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, - 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x02da, 0xdc: 0x1d53, 0xdd: 0x2c53, - 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, - 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, - 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, - 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, - 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, - 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, - // Block 0x4, offset 0x100 - 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x035b, 0x105: 0x03d9, - 0x106: 0x045a, 0x107: 0x04bb, 0x108: 0x0539, 0x109: 0x05ba, 0x10a: 0x061b, 0x10b: 0x0699, - 0x10c: 0x071a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, - 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, - 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, - 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, - 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, - 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, - 0x130: 0x077a, 0x131: 0x082b, 0x132: 0x08a9, 0x133: 0x092a, 0x134: 0x0113, 0x135: 0x0112, - 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, - 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, - // Block 0x5, offset 0x140 - 0x140: 0x0b0a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, - 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, - 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b8a, 0x151: 0x0c0a, - 0x152: 0x0c8a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, - 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0d0a, 0x15d: 0x0012, - 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d8a, 0x162: 0x0012, 0x163: 0x2052, - 0x164: 0x0e0a, 0x165: 0x0e8a, 0x166: 0x0f0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, - 0x16a: 0x0f8a, 0x16b: 0x100a, 0x16c: 0x108a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, - 0x170: 0x0012, 0x171: 0x110a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, - 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, - 0x17c: 0x0012, 0x17d: 0x118a, 0x17e: 0x0012, 0x17f: 0x0012, - // Block 0x6, offset 0x180 - 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x120a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, - 0x186: 0x0012, 0x187: 0x128a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, - 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, - 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0010, 0x196: 0x0012, 0x197: 0x0012, - 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x130a, - 0x19e: 0x138a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, - 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, - 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, - 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, - 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, - 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x140d, - 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, - 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, - 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, - 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, - 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, - 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, - 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, - 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, - 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, - 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, - // Block 0x8, offset 0x200 - 0x204: 0x0004, 0x205: 0x0004, - 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, - 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x148a, 0x211: 0x2013, - 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, - 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, - 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, - 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, - 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, - 0x230: 0x15ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, - 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, - 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, - // Block 0x9, offset 0x240 - 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x170a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, - 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, - 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x178a, 0x251: 0x180a, - 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x188a, 0x256: 0x190a, 0x257: 0x1812, - 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, - 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, - 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, - 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, - 0x270: 0x198a, 0x271: 0x1a0a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x1a8a, - 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, - 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, - // Block 0xa, offset 0x280 - 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, - 0x286: 0x6852, 0x287: 0x1b0a, 0x288: 0x0012, 0x28a: 0x0010, - 0x291: 0x0034, - 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, - 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, - 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, - 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, - 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, - 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, - 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, - 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x0010, 0x2c1: 0x0010, 0x2c2: 0x0010, 0x2c3: 0x0010, 0x2c4: 0x0010, 0x2c5: 0x0010, - 0x2c6: 0x0010, 0x2c7: 0x0010, 0x2c8: 0x0010, 0x2c9: 0x0014, 0x2ca: 0x0024, 0x2cb: 0x0024, - 0x2cc: 0x0024, 0x2cd: 0x0024, 0x2ce: 0x0024, 0x2cf: 0x0034, 0x2d0: 0x0034, 0x2d1: 0x0034, - 0x2d2: 0x0034, 0x2d3: 0x0034, 0x2d4: 0x0024, 0x2d5: 0x0024, 0x2d6: 0x0024, 0x2d7: 0x0024, - 0x2d8: 0x0024, 0x2d9: 0x0024, 0x2da: 0x0024, 0x2db: 0x0024, 0x2dc: 0x0024, 0x2dd: 0x0024, - 0x2de: 0x0024, 0x2df: 0x0024, 0x2e0: 0x0024, 0x2e1: 0x0024, 0x2e2: 0x0014, 0x2e3: 0x0034, - 0x2e4: 0x0024, 0x2e5: 0x0024, 0x2e6: 0x0034, 0x2e7: 0x0024, 0x2e8: 0x0024, 0x2e9: 0x0034, - 0x2ea: 0x0024, 0x2eb: 0x0024, 0x2ec: 0x0024, 0x2ed: 0x0034, 0x2ee: 0x0034, 0x2ef: 0x0034, - 0x2f0: 0x0034, 0x2f1: 0x0034, 0x2f2: 0x0034, 0x2f3: 0x0024, 0x2f4: 0x0024, 0x2f5: 0x0024, - 0x2f6: 0x0034, 0x2f7: 0x0024, 0x2f8: 0x0024, 0x2f9: 0x0034, 0x2fa: 0x0034, 0x2fb: 0x0024, - 0x2fc: 0x0024, 0x2fd: 0x0024, 0x2fe: 0x0024, 0x2ff: 0x0024, - // Block 0xc, offset 0x300 - 0x300: 0x7053, 0x301: 0x7053, 0x302: 0x7053, 0x303: 0x7053, 0x304: 0x7053, 0x305: 0x7053, - 0x307: 0x7053, - 0x30d: 0x7053, 0x310: 0x1bea, 0x311: 0x1c6a, - 0x312: 0x1cea, 0x313: 0x1d6a, 0x314: 0x1dea, 0x315: 0x1e6a, 0x316: 0x1eea, 0x317: 0x1f6a, - 0x318: 0x1fea, 0x319: 0x206a, 0x31a: 0x20ea, 0x31b: 0x216a, 0x31c: 0x21ea, 0x31d: 0x226a, - 0x31e: 0x22ea, 0x31f: 0x236a, 0x320: 0x23ea, 0x321: 0x246a, 0x322: 0x24ea, 0x323: 0x256a, - 0x324: 0x25ea, 0x325: 0x266a, 0x326: 0x26ea, 0x327: 0x276a, 0x328: 0x27ea, 0x329: 0x286a, - 0x32a: 0x28ea, 0x32b: 0x296a, 0x32c: 0x29ea, 0x32d: 0x2a6a, 0x32e: 0x2aea, 0x32f: 0x2b6a, - 0x330: 0x2bea, 0x331: 0x2c6a, 0x332: 0x2cea, 0x333: 0x2d6a, 0x334: 0x2dea, 0x335: 0x2e6a, - 0x336: 0x2eea, 0x337: 0x2f6a, 0x338: 0x2fea, 0x339: 0x306a, 0x33a: 0x30ea, - 0x33c: 0x0015, 0x33d: 0x316a, 0x33e: 0x31ea, 0x33f: 0x326a, - // Block 0xd, offset 0x340 - 0x340: 0x0812, 0x341: 0x0812, 0x342: 0x0812, 0x343: 0x0812, 0x344: 0x0812, 0x345: 0x0812, - 0x348: 0x0813, 0x349: 0x0813, 0x34a: 0x0813, 0x34b: 0x0813, - 0x34c: 0x0813, 0x34d: 0x0813, 0x350: 0x3c1a, 0x351: 0x0812, - 0x352: 0x3cfa, 0x353: 0x0812, 0x354: 0x3e3a, 0x355: 0x0812, 0x356: 0x3f7a, 0x357: 0x0812, - 0x359: 0x0813, 0x35b: 0x0813, 0x35d: 0x0813, - 0x35f: 0x0813, 0x360: 0x0812, 0x361: 0x0812, 0x362: 0x0812, 0x363: 0x0812, - 0x364: 0x0812, 0x365: 0x0812, 0x366: 0x0812, 0x367: 0x0812, 0x368: 0x0813, 0x369: 0x0813, - 0x36a: 0x0813, 0x36b: 0x0813, 0x36c: 0x0813, 0x36d: 0x0813, 0x36e: 0x0813, 0x36f: 0x0813, - 0x370: 0x9252, 0x371: 0x9252, 0x372: 0x9552, 0x373: 0x9552, 0x374: 0x9852, 0x375: 0x9852, - 0x376: 0x9b52, 0x377: 0x9b52, 0x378: 0x9e52, 0x379: 0x9e52, 0x37a: 0xa152, 0x37b: 0xa152, - 0x37c: 0x4d52, 0x37d: 0x4d52, - // Block 0xe, offset 0x380 - 0x380: 0x40ba, 0x381: 0x41aa, 0x382: 0x429a, 0x383: 0x438a, 0x384: 0x447a, 0x385: 0x456a, - 0x386: 0x465a, 0x387: 0x474a, 0x388: 0x4839, 0x389: 0x4929, 0x38a: 0x4a19, 0x38b: 0x4b09, - 0x38c: 0x4bf9, 0x38d: 0x4ce9, 0x38e: 0x4dd9, 0x38f: 0x4ec9, 0x390: 0x4fba, 0x391: 0x50aa, - 0x392: 0x519a, 0x393: 0x528a, 0x394: 0x537a, 0x395: 0x546a, 0x396: 0x555a, 0x397: 0x564a, - 0x398: 0x5739, 0x399: 0x5829, 0x39a: 0x5919, 0x39b: 0x5a09, 0x39c: 0x5af9, 0x39d: 0x5be9, - 0x39e: 0x5cd9, 0x39f: 0x5dc9, 0x3a0: 0x5eba, 0x3a1: 0x5faa, 0x3a2: 0x609a, 0x3a3: 0x618a, - 0x3a4: 0x627a, 0x3a5: 0x636a, 0x3a6: 0x645a, 0x3a7: 0x654a, 0x3a8: 0x6639, 0x3a9: 0x6729, - 0x3aa: 0x6819, 0x3ab: 0x6909, 0x3ac: 0x69f9, 0x3ad: 0x6ae9, 0x3ae: 0x6bd9, 0x3af: 0x6cc9, - 0x3b0: 0x0812, 0x3b1: 0x0812, 0x3b2: 0x6dba, 0x3b3: 0x6eca, 0x3b4: 0x6f9a, - 0x3b6: 0x707a, 0x3b7: 0x715a, 0x3b8: 0x0813, 0x3b9: 0x0813, 0x3ba: 0x9253, 0x3bb: 0x9253, - 0x3bc: 0x7299, 0x3bd: 0x0004, 0x3be: 0x736a, 0x3bf: 0x0004, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x0004, 0x3c1: 0x0004, 0x3c2: 0x73ea, 0x3c3: 0x74fa, 0x3c4: 0x75ca, - 0x3c6: 0x76aa, 0x3c7: 0x778a, 0x3c8: 0x9553, 0x3c9: 0x9553, 0x3ca: 0x9853, 0x3cb: 0x9853, - 0x3cc: 0x78c9, 0x3cd: 0x0004, 0x3ce: 0x0004, 0x3cf: 0x0004, 0x3d0: 0x0812, 0x3d1: 0x0812, - 0x3d2: 0x799a, 0x3d3: 0x7ada, 0x3d6: 0x7c1a, 0x3d7: 0x7cfa, - 0x3d8: 0x0813, 0x3d9: 0x0813, 0x3da: 0x9b53, 0x3db: 0x9b53, 0x3dd: 0x0004, - 0x3de: 0x0004, 0x3df: 0x0004, 0x3e0: 0x0812, 0x3e1: 0x0812, 0x3e2: 0x7e3a, 0x3e3: 0x7f7a, - 0x3e4: 0x80ba, 0x3e5: 0x0912, 0x3e6: 0x819a, 0x3e7: 0x827a, 0x3e8: 0x0813, 0x3e9: 0x0813, - 0x3ea: 0xa153, 0x3eb: 0xa153, 0x3ec: 0x0913, 0x3ed: 0x0004, 0x3ee: 0x0004, 0x3ef: 0x0004, - 0x3f2: 0x83ba, 0x3f3: 0x84ca, 0x3f4: 0x859a, - 0x3f6: 0x867a, 0x3f7: 0x875a, 0x3f8: 0x9e53, 0x3f9: 0x9e53, 0x3fa: 0x4d53, 0x3fb: 0x4d53, - 0x3fc: 0x8899, 0x3fd: 0x0004, 0x3fe: 0x0004, - // Block 0x10, offset 0x400 - 0x402: 0x0013, - 0x407: 0x0013, 0x40a: 0x0012, 0x40b: 0x0013, - 0x40c: 0x0013, 0x40d: 0x0013, 0x40e: 0x0012, 0x40f: 0x0012, 0x410: 0x0013, 0x411: 0x0013, - 0x412: 0x0013, 0x413: 0x0012, 0x415: 0x0013, - 0x419: 0x0013, 0x41a: 0x0013, 0x41b: 0x0013, 0x41c: 0x0013, 0x41d: 0x0013, - 0x424: 0x0013, 0x426: 0x896b, 0x428: 0x0013, - 0x42a: 0x89cb, 0x42b: 0x8a0b, 0x42c: 0x0013, 0x42d: 0x0013, 0x42f: 0x0012, - 0x430: 0x0013, 0x431: 0x0013, 0x432: 0xa453, 0x433: 0x0013, 0x434: 0x0012, 0x435: 0x0010, - 0x436: 0x0010, 0x437: 0x0010, 0x438: 0x0010, 0x439: 0x0012, - 0x43c: 0x0012, 0x43d: 0x0012, 0x43e: 0x0013, 0x43f: 0x0013, - // Block 0x11, offset 0x440 - 0x440: 0x1a13, 0x441: 0x1a13, 0x442: 0x1e13, 0x443: 0x1e13, 0x444: 0x1a13, 0x445: 0x1a13, - 0x446: 0x2613, 0x447: 0x2613, 0x448: 0x2a13, 0x449: 0x2a13, 0x44a: 0x2e13, 0x44b: 0x2e13, - 0x44c: 0x2a13, 0x44d: 0x2a13, 0x44e: 0x2613, 0x44f: 0x2613, 0x450: 0xa752, 0x451: 0xa752, - 0x452: 0xaa52, 0x453: 0xaa52, 0x454: 0xad52, 0x455: 0xad52, 0x456: 0xaa52, 0x457: 0xaa52, - 0x458: 0xa752, 0x459: 0xa752, 0x45a: 0x1a12, 0x45b: 0x1a12, 0x45c: 0x1e12, 0x45d: 0x1e12, - 0x45e: 0x1a12, 0x45f: 0x1a12, 0x460: 0x2612, 0x461: 0x2612, 0x462: 0x2a12, 0x463: 0x2a12, - 0x464: 0x2e12, 0x465: 0x2e12, 0x466: 0x2a12, 0x467: 0x2a12, 0x468: 0x2612, 0x469: 0x2612, - // Block 0x12, offset 0x480 - 0x480: 0x6552, 0x481: 0x6552, 0x482: 0x6552, 0x483: 0x6552, 0x484: 0x6552, 0x485: 0x6552, - 0x486: 0x6552, 0x487: 0x6552, 0x488: 0x6552, 0x489: 0x6552, 0x48a: 0x6552, 0x48b: 0x6552, - 0x48c: 0x6552, 0x48d: 0x6552, 0x48e: 0x6552, 0x48f: 0x6552, 0x490: 0xb052, 0x491: 0xb052, - 0x492: 0xb052, 0x493: 0xb052, 0x494: 0xb052, 0x495: 0xb052, 0x496: 0xb052, 0x497: 0xb052, - 0x498: 0xb052, 0x499: 0xb052, 0x49a: 0xb052, 0x49b: 0xb052, 0x49c: 0xb052, 0x49d: 0xb052, - 0x49e: 0xb052, 0x49f: 0xb052, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x8a6b, 0x4a3: 0x8b53, - 0x4a4: 0x8acb, 0x4a5: 0x8b2a, 0x4a6: 0x8b8a, 0x4a7: 0x0f13, 0x4a8: 0x0f12, 0x4a9: 0x0313, - 0x4aa: 0x0312, 0x4ab: 0x0713, 0x4ac: 0x0712, 0x4ad: 0x8beb, 0x4ae: 0x8c4b, 0x4af: 0x8cab, - 0x4b0: 0x8d0b, 0x4b1: 0x0012, 0x4b2: 0x0113, 0x4b3: 0x0112, 0x4b4: 0x0012, 0x4b5: 0x0313, - 0x4b6: 0x0312, 0x4b7: 0x0012, 0x4b8: 0x0012, 0x4b9: 0x0012, 0x4ba: 0x0012, 0x4bb: 0x0012, - 0x4bc: 0x0015, 0x4bd: 0x0015, 0x4be: 0x8d6b, 0x4bf: 0x8dcb, - // Block 0x13, offset 0x4c0 - 0x4c0: 0x0113, 0x4c1: 0x0112, 0x4c2: 0x0113, 0x4c3: 0x0112, 0x4c4: 0x0113, 0x4c5: 0x0112, - 0x4c6: 0x0113, 0x4c7: 0x0112, 0x4c8: 0x0014, 0x4c9: 0x0014, 0x4ca: 0x0014, 0x4cb: 0x0713, - 0x4cc: 0x0712, 0x4cd: 0x8e2b, 0x4ce: 0x0012, 0x4cf: 0x0010, 0x4d0: 0x0113, 0x4d1: 0x0112, - 0x4d2: 0x0113, 0x4d3: 0x0112, 0x4d4: 0x6552, 0x4d5: 0x0012, 0x4d6: 0x0113, 0x4d7: 0x0112, - 0x4d8: 0x0113, 0x4d9: 0x0112, 0x4da: 0x0113, 0x4db: 0x0112, 0x4dc: 0x0113, 0x4dd: 0x0112, - 0x4de: 0x0113, 0x4df: 0x0112, 0x4e0: 0x0113, 0x4e1: 0x0112, 0x4e2: 0x0113, 0x4e3: 0x0112, - 0x4e4: 0x0113, 0x4e5: 0x0112, 0x4e6: 0x0113, 0x4e7: 0x0112, 0x4e8: 0x0113, 0x4e9: 0x0112, - 0x4ea: 0x8e8b, 0x4eb: 0x8eeb, 0x4ec: 0x8f4b, 0x4ed: 0x8fab, 0x4ee: 0x900b, 0x4ef: 0x0012, - 0x4f0: 0x906b, 0x4f1: 0x90cb, 0x4f2: 0x912b, 0x4f3: 0xb353, 0x4f4: 0x0113, 0x4f5: 0x0112, - 0x4f6: 0x0113, 0x4f7: 0x0112, 0x4f8: 0x0113, 0x4f9: 0x0112, 0x4fa: 0x0113, 0x4fb: 0x0112, - 0x4fc: 0x0113, 0x4fd: 0x0112, 0x4fe: 0x0113, 0x4ff: 0x0112, - // Block 0x14, offset 0x500 - 0x500: 0x92aa, 0x501: 0x932a, 0x502: 0x93aa, 0x503: 0x942a, 0x504: 0x94da, 0x505: 0x958a, - 0x506: 0x960a, - 0x513: 0x968a, 0x514: 0x976a, 0x515: 0x984a, 0x516: 0x992a, 0x517: 0x9a0a, - 0x51d: 0x0010, - 0x51e: 0x0034, 0x51f: 0x0010, 0x520: 0x0010, 0x521: 0x0010, 0x522: 0x0010, 0x523: 0x0010, - 0x524: 0x0010, 0x525: 0x0010, 0x526: 0x0010, 0x527: 0x0010, 0x528: 0x0010, - 0x52a: 0x0010, 0x52b: 0x0010, 0x52c: 0x0010, 0x52d: 0x0010, 0x52e: 0x0010, 0x52f: 0x0010, - 0x530: 0x0010, 0x531: 0x0010, 0x532: 0x0010, 0x533: 0x0010, 0x534: 0x0010, 0x535: 0x0010, - 0x536: 0x0010, 0x538: 0x0010, 0x539: 0x0010, 0x53a: 0x0010, 0x53b: 0x0010, - 0x53c: 0x0010, 0x53e: 0x0010, - // Block 0x15, offset 0x540 - 0x540: 0x2713, 0x541: 0x2913, 0x542: 0x2b13, 0x543: 0x2913, 0x544: 0x2f13, 0x545: 0x2913, - 0x546: 0x2b13, 0x547: 0x2913, 0x548: 0x2713, 0x549: 0x3913, 0x54a: 0x3b13, - 0x54c: 0x3f13, 0x54d: 0x3913, 0x54e: 0x3b13, 0x54f: 0x3913, 0x550: 0x2713, 0x551: 0x2913, - 0x552: 0x2b13, 0x554: 0x2f13, 0x555: 0x2913, 0x557: 0xbc52, - 0x558: 0xbf52, 0x559: 0xc252, 0x55a: 0xbf52, 0x55b: 0xc552, 0x55c: 0xbf52, 0x55d: 0xc252, - 0x55e: 0xbf52, 0x55f: 0xbc52, 0x560: 0xc852, 0x561: 0xcb52, 0x563: 0xce52, - 0x564: 0xc852, 0x565: 0xcb52, 0x566: 0xc852, 0x567: 0x2712, 0x568: 0x2912, 0x569: 0x2b12, - 0x56a: 0x2912, 0x56b: 0x2f12, 0x56c: 0x2912, 0x56d: 0x2b12, 0x56e: 0x2912, 0x56f: 0x2712, - 0x570: 0x3912, 0x571: 0x3b12, 0x573: 0x3f12, 0x574: 0x3912, 0x575: 0x3b12, - 0x576: 0x3912, 0x577: 0x2712, 0x578: 0x2912, 0x579: 0x2b12, 0x57b: 0x2f12, - 0x57c: 0x2912, - // Block 0x16, offset 0x580 - 0x5a0: 0x1b13, 0x5a1: 0x1d13, 0x5a2: 0x1f13, 0x5a3: 0x1d13, - 0x5a4: 0x1b13, 0x5a5: 0xd453, 0x5a6: 0xd753, 0x5a7: 0xd453, 0x5a8: 0xda53, 0x5a9: 0xdd53, - 0x5aa: 0xe053, 0x5ab: 0xdd53, 0x5ac: 0xda53, 0x5ad: 0xd453, 0x5ae: 0xd753, 0x5af: 0xd453, - 0x5b0: 0xe353, 0x5b1: 0xe653, 0x5b2: 0x0553, 0x5b3: 0xe653, 0x5b4: 0xe353, 0x5b5: 0xd453, - 0x5b6: 0xd753, 0x5b7: 0xd453, 0x5b8: 0xda53, 0x5bb: 0x1b12, - 0x5bc: 0x1d12, 0x5bd: 0x1f12, 0x5be: 0x1d12, 0x5bf: 0x1b12, - // Block 0x17, offset 0x5c0 - 0x5c0: 0xd452, 0x5c1: 0xd752, 0x5c2: 0xd452, 0x5c3: 0xda52, 0x5c4: 0xdd52, 0x5c5: 0xe052, - 0x5c6: 0xdd52, 0x5c7: 0xda52, 0x5c8: 0xd452, 0x5c9: 0xd752, 0x5ca: 0xd452, 0x5cb: 0xe352, - 0x5cc: 0xe652, 0x5cd: 0x0552, 0x5ce: 0xe652, 0x5cf: 0xe352, 0x5d0: 0xd452, 0x5d1: 0xd752, - 0x5d2: 0xd452, 0x5d3: 0xda52, - // Block 0x18, offset 0x600 - 0x600: 0x2213, 0x601: 0x2213, 0x602: 0x2613, 0x603: 0x2613, 0x604: 0x2213, 0x605: 0x2213, - 0x606: 0x2e13, 0x607: 0x2e13, 0x608: 0x2213, 0x609: 0x2213, 0x60a: 0x2613, 0x60b: 0x2613, - 0x60c: 0x2213, 0x60d: 0x2213, 0x60e: 0x3e13, 0x60f: 0x3e13, 0x610: 0x2213, 0x611: 0x2213, - 0x612: 0x2613, 0x613: 0x2613, 0x614: 0x2213, 0x615: 0x2213, 0x616: 0x2e13, 0x617: 0x2e13, - 0x618: 0x2213, 0x619: 0x2213, 0x61a: 0x2613, 0x61b: 0x2613, 0x61c: 0x2213, 0x61d: 0x2213, - 0x61e: 0xe953, 0x61f: 0xe953, 0x620: 0xec53, 0x621: 0xec53, 0x622: 0x2212, 0x623: 0x2212, - 0x624: 0x2612, 0x625: 0x2612, 0x626: 0x2212, 0x627: 0x2212, 0x628: 0x2e12, 0x629: 0x2e12, - 0x62a: 0x2212, 0x62b: 0x2212, 0x62c: 0x2612, 0x62d: 0x2612, 0x62e: 0x2212, 0x62f: 0x2212, - 0x630: 0x3e12, 0x631: 0x3e12, 0x632: 0x2212, 0x633: 0x2212, 0x634: 0x2612, 0x635: 0x2612, - 0x636: 0x2212, 0x637: 0x2212, 0x638: 0x2e12, 0x639: 0x2e12, 0x63a: 0x2212, 0x63b: 0x2212, - 0x63c: 0x2612, 0x63d: 0x2612, 0x63e: 0x2212, 0x63f: 0x2212, - // Block 0x19, offset 0x640 - 0x642: 0x0010, - 0x647: 0x0010, 0x649: 0x0010, 0x64b: 0x0010, - 0x64d: 0x0010, 0x64e: 0x0010, 0x64f: 0x0010, 0x651: 0x0010, - 0x652: 0x0010, 0x654: 0x0010, 0x657: 0x0010, - 0x659: 0x0010, 0x65b: 0x0010, 0x65d: 0x0010, - 0x65f: 0x0010, 0x661: 0x0010, 0x662: 0x0010, - 0x664: 0x0010, 0x667: 0x0010, 0x668: 0x0010, 0x669: 0x0010, - 0x66a: 0x0010, 0x66c: 0x0010, 0x66d: 0x0010, 0x66e: 0x0010, 0x66f: 0x0010, - 0x670: 0x0010, 0x671: 0x0010, 0x672: 0x0010, 0x674: 0x0010, 0x675: 0x0010, - 0x676: 0x0010, 0x677: 0x0010, 0x679: 0x0010, 0x67a: 0x0010, 0x67b: 0x0010, - 0x67c: 0x0010, 0x67e: 0x0010, -} - -// caseIndex: 27 blocks, 1728 entries, 3456 bytes -// Block 0 is the zero block. -var caseIndex = [1728]uint16{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x18, 0xc3: 0x19, 0xc4: 0x1a, 0xc5: 0x1b, 0xc6: 0x01, 0xc7: 0x02, - 0xc8: 0x1c, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x1d, 0xcc: 0x1e, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, - 0xd0: 0x1f, 0xd1: 0x20, 0xd2: 0x21, 0xd3: 0x22, 0xd4: 0x23, 0xd5: 0x24, 0xd6: 0x08, 0xd7: 0x25, - 0xd8: 0x26, 0xd9: 0x27, 0xda: 0x28, 0xdb: 0x29, 0xdc: 0x2a, 0xdd: 0x2b, 0xde: 0x2c, 0xdf: 0x2d, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, - 0xf0: 0x16, 0xf3: 0x18, - // Block 0x4, offset 0x100 - 0x120: 0x2e, 0x121: 0x2f, 0x122: 0x30, 0x123: 0x09, 0x124: 0x31, 0x125: 0x32, 0x126: 0x33, 0x127: 0x34, - 0x128: 0x35, 0x129: 0x36, 0x12a: 0x37, 0x12b: 0x38, 0x12c: 0x39, 0x12d: 0x3a, 0x12e: 0x3b, 0x12f: 0x3c, - 0x130: 0x3d, 0x131: 0x3e, 0x132: 0x3f, 0x133: 0x40, 0x134: 0x41, 0x135: 0x42, 0x136: 0x43, 0x137: 0x44, - 0x138: 0x45, 0x139: 0x46, 0x13a: 0x47, 0x13b: 0x48, 0x13c: 0x49, 0x13d: 0x4a, 0x13e: 0x4b, 0x13f: 0x4c, - // Block 0x5, offset 0x140 - 0x140: 0x4d, 0x141: 0x4e, 0x142: 0x4f, 0x143: 0x0a, 0x144: 0x28, 0x145: 0x28, 0x146: 0x28, 0x147: 0x28, - 0x148: 0x28, 0x149: 0x50, 0x14a: 0x51, 0x14b: 0x52, 0x14c: 0x53, 0x14d: 0x54, 0x14e: 0x55, 0x14f: 0x56, - 0x150: 0x57, 0x151: 0x28, 0x152: 0x28, 0x153: 0x28, 0x154: 0x28, 0x155: 0x28, 0x156: 0x28, 0x157: 0x28, - 0x158: 0x28, 0x159: 0x58, 0x15a: 0x59, 0x15b: 0x5a, 0x15c: 0x5b, 0x15d: 0x5c, 0x15e: 0x5d, 0x15f: 0x5e, - 0x160: 0x5f, 0x161: 0x60, 0x162: 0x61, 0x163: 0x62, 0x164: 0x63, 0x165: 0x64, 0x167: 0x65, - 0x168: 0x66, 0x169: 0x67, 0x16a: 0x68, 0x16b: 0x69, 0x16c: 0x6a, 0x16d: 0x6b, 0x16e: 0x6c, 0x16f: 0x6d, - 0x170: 0x6e, 0x171: 0x6f, 0x172: 0x70, 0x173: 0x71, 0x174: 0x72, 0x175: 0x73, 0x176: 0x74, 0x177: 0x75, - 0x178: 0x76, 0x179: 0x76, 0x17a: 0x77, 0x17b: 0x76, 0x17c: 0x78, 0x17d: 0x0b, 0x17e: 0x0c, 0x17f: 0x0d, - // Block 0x6, offset 0x180 - 0x180: 0x79, 0x181: 0x7a, 0x182: 0x7b, 0x183: 0x7c, 0x184: 0x0e, 0x185: 0x7d, 0x186: 0x7e, - 0x192: 0x7f, 0x193: 0x0f, - 0x1b0: 0x80, 0x1b1: 0x10, 0x1b2: 0x76, 0x1b3: 0x81, 0x1b4: 0x82, 0x1b5: 0x83, 0x1b6: 0x84, 0x1b7: 0x85, - 0x1b8: 0x86, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x87, 0x1c2: 0x88, 0x1c3: 0x89, 0x1c4: 0x8a, 0x1c5: 0x28, 0x1c6: 0x8b, - // Block 0x8, offset 0x200 - 0x200: 0x8c, 0x201: 0x28, 0x202: 0x28, 0x203: 0x28, 0x204: 0x28, 0x205: 0x28, 0x206: 0x28, 0x207: 0x28, - 0x208: 0x28, 0x209: 0x28, 0x20a: 0x28, 0x20b: 0x28, 0x20c: 0x28, 0x20d: 0x28, 0x20e: 0x28, 0x20f: 0x28, - 0x210: 0x28, 0x211: 0x28, 0x212: 0x8d, 0x213: 0x8e, 0x214: 0x28, 0x215: 0x28, 0x216: 0x28, 0x217: 0x28, - 0x218: 0x8f, 0x219: 0x90, 0x21a: 0x91, 0x21b: 0x92, 0x21c: 0x93, 0x21d: 0x94, 0x21e: 0x11, 0x21f: 0x95, - 0x220: 0x96, 0x221: 0x97, 0x222: 0x28, 0x223: 0x98, 0x224: 0x99, 0x225: 0x9a, 0x226: 0x9b, 0x227: 0x9c, - 0x228: 0x9d, 0x229: 0x9e, 0x22a: 0x9f, 0x22b: 0xa0, 0x22c: 0xa1, 0x22d: 0xa2, 0x22e: 0xa3, 0x22f: 0xa4, - 0x230: 0x28, 0x231: 0x28, 0x232: 0x28, 0x233: 0x28, 0x234: 0x28, 0x235: 0x28, 0x236: 0x28, 0x237: 0x28, - 0x238: 0x28, 0x239: 0x28, 0x23a: 0x28, 0x23b: 0x28, 0x23c: 0x28, 0x23d: 0x28, 0x23e: 0x28, 0x23f: 0x28, - // Block 0x9, offset 0x240 - 0x240: 0x28, 0x241: 0x28, 0x242: 0x28, 0x243: 0x28, 0x244: 0x28, 0x245: 0x28, 0x246: 0x28, 0x247: 0x28, - 0x248: 0x28, 0x249: 0x28, 0x24a: 0x28, 0x24b: 0x28, 0x24c: 0x28, 0x24d: 0x28, 0x24e: 0x28, 0x24f: 0x28, - 0x250: 0x28, 0x251: 0x28, 0x252: 0x28, 0x253: 0x28, 0x254: 0x28, 0x255: 0x28, 0x256: 0x28, 0x257: 0x28, - 0x258: 0x28, 0x259: 0x28, 0x25a: 0x28, 0x25b: 0x28, 0x25c: 0x28, 0x25d: 0x28, 0x25e: 0x28, 0x25f: 0x28, - 0x260: 0x28, 0x261: 0x28, 0x262: 0x28, 0x263: 0x28, 0x264: 0x28, 0x265: 0x28, 0x266: 0x28, 0x267: 0x28, - 0x268: 0x28, 0x269: 0x28, 0x26a: 0x28, 0x26b: 0x28, 0x26c: 0x28, 0x26d: 0x28, 0x26e: 0x28, 0x26f: 0x28, - 0x270: 0x28, 0x271: 0x28, 0x272: 0x28, 0x273: 0x28, 0x274: 0x28, 0x275: 0x28, 0x276: 0x28, 0x277: 0x28, - 0x278: 0x28, 0x279: 0x28, 0x27a: 0x28, 0x27b: 0x28, 0x27c: 0x28, 0x27d: 0x28, 0x27e: 0x28, 0x27f: 0x28, - // Block 0xa, offset 0x280 - 0x280: 0x28, 0x281: 0x28, 0x282: 0x28, 0x283: 0x28, 0x284: 0x28, 0x285: 0x28, 0x286: 0x28, 0x287: 0x28, - 0x288: 0x28, 0x289: 0x28, 0x28a: 0x28, 0x28b: 0x28, 0x28c: 0x28, 0x28d: 0x28, 0x28e: 0x28, 0x28f: 0x28, - 0x290: 0x28, 0x291: 0x28, 0x292: 0x28, 0x293: 0x28, 0x294: 0x28, 0x295: 0x28, 0x296: 0x28, 0x297: 0x28, - 0x298: 0x28, 0x299: 0x28, 0x29a: 0x28, 0x29b: 0x28, 0x29c: 0x28, 0x29d: 0x28, 0x29e: 0xa5, 0x29f: 0xa6, - // Block 0xb, offset 0x2c0 - 0x2ec: 0x12, 0x2ed: 0xa7, 0x2ee: 0xa8, 0x2ef: 0xa9, - 0x2f0: 0x28, 0x2f1: 0x28, 0x2f2: 0x28, 0x2f3: 0x28, 0x2f4: 0xaa, 0x2f5: 0xab, 0x2f6: 0xac, 0x2f7: 0xad, - 0x2f8: 0xae, 0x2f9: 0xaf, 0x2fa: 0x28, 0x2fb: 0xb0, 0x2fc: 0xb1, 0x2fd: 0xb2, 0x2fe: 0xb3, 0x2ff: 0xb4, - // Block 0xc, offset 0x300 - 0x300: 0xb5, 0x301: 0xb6, 0x302: 0x28, 0x303: 0xb7, 0x305: 0xb8, 0x307: 0xb9, - 0x30a: 0xba, 0x30b: 0xbb, 0x30c: 0xbc, 0x30d: 0xbd, 0x30e: 0xbe, 0x30f: 0xbf, - 0x310: 0xc0, 0x311: 0xc1, 0x312: 0xc2, 0x313: 0xc3, 0x314: 0xc4, 0x315: 0xc5, 0x316: 0x13, 0x317: 0x97, - 0x318: 0x28, 0x319: 0x28, 0x31a: 0x28, 0x31b: 0x28, 0x31c: 0xc6, 0x31d: 0xc7, 0x31e: 0xc8, - 0x320: 0xc9, 0x321: 0xca, 0x322: 0xcb, 0x323: 0xcc, 0x324: 0xcd, 0x325: 0xce, 0x326: 0xcf, - 0x328: 0xd0, 0x329: 0xd1, 0x32a: 0xd2, 0x32b: 0xd3, 0x32c: 0x62, 0x32d: 0xd4, 0x32e: 0xd5, - 0x330: 0x28, 0x331: 0xd6, 0x332: 0xd7, 0x333: 0xd8, 0x334: 0xd9, 0x335: 0xda, 0x336: 0xdb, - 0x33a: 0xdc, 0x33b: 0xdd, 0x33c: 0xde, 0x33d: 0xdf, 0x33e: 0xe0, 0x33f: 0xe1, - // Block 0xd, offset 0x340 - 0x340: 0xe2, 0x341: 0xe3, 0x342: 0xe4, 0x343: 0xe5, 0x344: 0xe6, 0x345: 0xe7, 0x346: 0xe8, 0x347: 0xe9, - 0x348: 0xea, 0x349: 0xeb, 0x34a: 0xec, 0x34b: 0xed, 0x34c: 0xee, 0x34d: 0xef, 0x34e: 0xf0, 0x34f: 0xf1, - 0x350: 0xf2, 0x351: 0xf3, 0x352: 0xf4, 0x353: 0xf5, 0x356: 0xf6, 0x357: 0xf7, - 0x358: 0xf8, 0x359: 0xf9, 0x35a: 0xfa, 0x35b: 0xfb, 0x35c: 0xfc, - 0x360: 0xfd, 0x362: 0xfe, 0x363: 0xff, 0x364: 0x100, 0x365: 0x101, 0x366: 0x102, 0x367: 0x103, - 0x368: 0x104, 0x369: 0x105, 0x36a: 0x106, 0x36b: 0x107, 0x36d: 0x108, 0x36f: 0x109, - 0x370: 0x10a, 0x371: 0x10b, 0x372: 0x10c, 0x374: 0x10d, 0x375: 0x10e, 0x376: 0x10f, 0x377: 0x110, - 0x37b: 0x111, 0x37c: 0x112, 0x37d: 0x113, 0x37e: 0x114, - // Block 0xe, offset 0x380 - 0x380: 0x28, 0x381: 0x28, 0x382: 0x28, 0x383: 0x28, 0x384: 0x28, 0x385: 0x28, 0x386: 0x28, 0x387: 0x28, - 0x388: 0x28, 0x389: 0x28, 0x38a: 0x28, 0x38b: 0x28, 0x38c: 0x28, 0x38d: 0x28, 0x38e: 0xce, - 0x390: 0x28, 0x391: 0x115, 0x392: 0x28, 0x393: 0x28, 0x394: 0x28, 0x395: 0x116, - 0x3be: 0xab, 0x3bf: 0x117, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x28, 0x3c1: 0x28, 0x3c2: 0x28, 0x3c3: 0x28, 0x3c4: 0x28, 0x3c5: 0x28, 0x3c6: 0x28, 0x3c7: 0x28, - 0x3c8: 0x28, 0x3c9: 0x28, 0x3ca: 0x28, 0x3cb: 0x28, 0x3cc: 0x28, 0x3cd: 0x28, 0x3ce: 0x28, 0x3cf: 0x28, - 0x3d0: 0x118, 0x3d1: 0x119, 0x3d2: 0x28, 0x3d3: 0x28, 0x3d4: 0x28, 0x3d5: 0x28, 0x3d6: 0x28, 0x3d7: 0x28, - 0x3d8: 0x28, 0x3d9: 0x28, 0x3da: 0x28, 0x3db: 0x28, 0x3dc: 0x28, 0x3dd: 0x28, 0x3de: 0x28, 0x3df: 0x28, - 0x3e0: 0x28, 0x3e1: 0x28, 0x3e2: 0x28, 0x3e3: 0x28, 0x3e4: 0x28, 0x3e5: 0x28, 0x3e6: 0x28, 0x3e7: 0x28, - 0x3e8: 0x28, 0x3e9: 0x28, 0x3ea: 0x28, 0x3eb: 0x28, 0x3ec: 0x28, 0x3ed: 0x28, 0x3ee: 0x28, 0x3ef: 0x28, - 0x3f0: 0x28, 0x3f1: 0x28, 0x3f2: 0x28, 0x3f3: 0x28, 0x3f4: 0x28, 0x3f5: 0x28, 0x3f6: 0x28, 0x3f7: 0x28, - 0x3f8: 0x28, 0x3f9: 0x28, 0x3fa: 0x28, 0x3fb: 0x28, 0x3fc: 0x28, 0x3fd: 0x28, 0x3fe: 0x28, 0x3ff: 0x28, - // Block 0x10, offset 0x400 - 0x400: 0x28, 0x401: 0x28, 0x402: 0x28, 0x403: 0x28, 0x404: 0x28, 0x405: 0x28, 0x406: 0x28, 0x407: 0x28, - 0x408: 0x28, 0x409: 0x28, 0x40a: 0x28, 0x40b: 0x28, 0x40c: 0x28, 0x40d: 0x28, 0x40e: 0x28, 0x40f: 0xb7, - 0x410: 0x28, 0x411: 0x28, 0x412: 0x28, 0x413: 0x28, 0x414: 0x28, 0x415: 0x28, 0x416: 0x28, 0x417: 0x28, - 0x418: 0x28, 0x419: 0x11a, - // Block 0x11, offset 0x440 - 0x444: 0x11b, - 0x460: 0x28, 0x461: 0x28, 0x462: 0x28, 0x463: 0x28, 0x464: 0x28, 0x465: 0x28, 0x466: 0x28, 0x467: 0x28, - 0x468: 0x107, 0x469: 0x11c, 0x46a: 0x11d, 0x46b: 0x11e, 0x46c: 0x11f, 0x46d: 0x120, 0x46e: 0x121, - 0x475: 0x122, - 0x479: 0x123, 0x47a: 0x14, 0x47b: 0x15, 0x47c: 0x28, 0x47d: 0x124, 0x47e: 0x125, 0x47f: 0x126, - // Block 0x12, offset 0x480 - 0x4bf: 0x127, - // Block 0x13, offset 0x4c0 - 0x4f0: 0x28, 0x4f1: 0x128, 0x4f2: 0x129, - // Block 0x14, offset 0x500 - 0x533: 0x12a, - 0x53c: 0x12b, 0x53d: 0x12c, - // Block 0x15, offset 0x540 - 0x545: 0x12d, 0x546: 0x12e, - 0x549: 0x12f, - 0x550: 0x130, 0x551: 0x131, 0x552: 0x132, 0x553: 0x133, 0x554: 0x134, 0x555: 0x135, 0x556: 0x136, 0x557: 0x137, - 0x558: 0x138, 0x559: 0x139, 0x55a: 0x13a, 0x55b: 0x13b, 0x55c: 0x13c, 0x55d: 0x13d, 0x55e: 0x13e, 0x55f: 0x13f, - 0x568: 0x140, 0x569: 0x141, 0x56a: 0x142, - 0x57c: 0x143, - // Block 0x16, offset 0x580 - 0x580: 0x144, 0x581: 0x145, 0x582: 0x146, 0x584: 0x147, 0x585: 0x148, - 0x58a: 0x149, 0x58b: 0x14a, - 0x593: 0x14b, 0x597: 0x14c, - 0x59b: 0x14d, 0x59f: 0x14e, - 0x5a0: 0x28, 0x5a1: 0x28, 0x5a2: 0x28, 0x5a3: 0x14f, 0x5a4: 0x16, 0x5a5: 0x150, - 0x5b8: 0x151, 0x5b9: 0x17, 0x5ba: 0x152, - // Block 0x17, offset 0x5c0 - 0x5c4: 0x153, 0x5c5: 0x154, 0x5c6: 0x155, - 0x5cf: 0x156, - 0x5ef: 0x12a, - // Block 0x18, offset 0x600 - 0x610: 0x0a, 0x611: 0x0b, 0x612: 0x0c, 0x613: 0x0d, 0x614: 0x0e, 0x616: 0x0f, - 0x61a: 0x10, 0x61b: 0x11, 0x61c: 0x12, 0x61d: 0x13, 0x61e: 0x14, 0x61f: 0x15, - // Block 0x19, offset 0x640 - 0x640: 0x157, 0x641: 0x158, 0x644: 0x158, 0x645: 0x158, 0x646: 0x158, 0x647: 0x159, - // Block 0x1a, offset 0x680 - 0x6a0: 0x17, -} - -// sparseOffsets: 323 entries, 646 bytes -var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x34, 0x37, 0x3b, 0x3e, 0x42, 0x4c, 0x4e, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xaf, 0xb7, 0xbd, 0xcb, 0xd6, 0xe3, 0xee, 0xfa, 0x104, 0x110, 0x11b, 0x127, 0x133, 0x13b, 0x145, 0x150, 0x15b, 0x167, 0x16d, 0x178, 0x17e, 0x186, 0x189, 0x18e, 0x192, 0x196, 0x19d, 0x1a6, 0x1ae, 0x1af, 0x1b8, 0x1bf, 0x1c7, 0x1cd, 0x1d2, 0x1d6, 0x1d9, 0x1db, 0x1de, 0x1e3, 0x1e4, 0x1e6, 0x1e8, 0x1ea, 0x1f1, 0x1f6, 0x1fa, 0x203, 0x206, 0x209, 0x20f, 0x210, 0x21b, 0x21c, 0x21d, 0x222, 0x22f, 0x238, 0x243, 0x24b, 0x254, 0x25d, 0x266, 0x26b, 0x26e, 0x27a, 0x288, 0x28a, 0x291, 0x295, 0x2a1, 0x2a2, 0x2ad, 0x2b5, 0x2bd, 0x2c3, 0x2c4, 0x2d2, 0x2d7, 0x2da, 0x2df, 0x2e3, 0x2e9, 0x2ee, 0x2f1, 0x2f6, 0x2fb, 0x2fc, 0x302, 0x304, 0x305, 0x307, 0x309, 0x30c, 0x30d, 0x30f, 0x312, 0x318, 0x31c, 0x31e, 0x323, 0x32a, 0x339, 0x343, 0x344, 0x34d, 0x351, 0x356, 0x35e, 0x364, 0x36a, 0x374, 0x379, 0x382, 0x388, 0x391, 0x395, 0x39d, 0x39f, 0x3a1, 0x3a4, 0x3a6, 0x3a8, 0x3a9, 0x3aa, 0x3ac, 0x3ae, 0x3b4, 0x3b9, 0x3bb, 0x3c2, 0x3c5, 0x3c7, 0x3cd, 0x3d2, 0x3d4, 0x3d5, 0x3d6, 0x3d7, 0x3d9, 0x3db, 0x3dd, 0x3e0, 0x3e2, 0x3e5, 0x3ed, 0x3f0, 0x3f4, 0x3fc, 0x3fe, 0x40e, 0x40f, 0x411, 0x416, 0x41c, 0x41e, 0x41f, 0x421, 0x423, 0x424, 0x426, 0x433, 0x434, 0x435, 0x439, 0x43b, 0x43c, 0x43d, 0x43e, 0x43f, 0x442, 0x44a, 0x44b, 0x44e, 0x454, 0x457, 0x45e, 0x464, 0x466, 0x46a, 0x472, 0x478, 0x47c, 0x483, 0x487, 0x48b, 0x494, 0x49e, 0x4a0, 0x4a6, 0x4ac, 0x4b6, 0x4c0, 0x4c6, 0x4d2, 0x4d4, 0x4dd, 0x4e3, 0x4e9, 0x4ef, 0x4f2, 0x4f8, 0x4fb, 0x504, 0x506, 0x50f, 0x513, 0x514, 0x517, 0x521, 0x524, 0x526, 0x52d, 0x535, 0x53b, 0x542, 0x543, 0x549, 0x54b, 0x551, 0x554, 0x55c, 0x563, 0x56d, 0x576, 0x57a, 0x57d, 0x582, 0x587, 0x588, 0x589, 0x58a, 0x58b, 0x58d, 0x591, 0x592, 0x598, 0x59b, 0x59c, 0x59f, 0x5a1, 0x5a5, 0x5a6, 0x5aa, 0x5ac, 0x5af, 0x5b1, 0x5b5, 0x5b8, 0x5ba, 0x5bf, 0x5c0, 0x5c2, 0x5c3, 0x5c8, 0x5cc, 0x5cd, 0x5d0, 0x5d4, 0x5df, 0x5e3, 0x5eb, 0x5f0, 0x5f4, 0x5f7, 0x5fb, 0x5fe, 0x601, 0x606, 0x60a, 0x60e, 0x612, 0x616, 0x618, 0x61a, 0x61d, 0x621, 0x627, 0x628, 0x629, 0x62c, 0x62e, 0x630, 0x633, 0x638, 0x63c, 0x647, 0x64b, 0x64d, 0x653, 0x65c, 0x661, 0x662, 0x665, 0x666, 0x667, 0x669, 0x66a, 0x66b} - -// sparseValues: 1643 entries, 6572 bytes -var sparseValues = [1643]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0004, lo: 0xa8, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xaa}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0004, lo: 0xaf, hi: 0xaf}, - {value: 0x0004, lo: 0xb4, hi: 0xb4}, - {value: 0x001a, lo: 0xb5, hi: 0xb5}, - {value: 0x0054, lo: 0xb7, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xb8}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - // Block 0x1, offset 0x9 - {value: 0x2013, lo: 0x80, hi: 0x96}, - {value: 0x2013, lo: 0x98, hi: 0x9e}, - {value: 0x009a, lo: 0x9f, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xb6}, - {value: 0x2012, lo: 0xb8, hi: 0xbe}, - {value: 0x0252, lo: 0xbf, hi: 0xbf}, - // Block 0x2, offset 0xf - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x011b, lo: 0xb0, hi: 0xb0}, - {value: 0x019a, lo: 0xb1, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb7}, - {value: 0x0012, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x0553, lo: 0xbf, hi: 0xbf}, - // Block 0x3, offset 0x18 - {value: 0x0552, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x01da, lo: 0x89, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xb7}, - {value: 0x0253, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x028a, lo: 0xbf, hi: 0xbf}, - // Block 0x4, offset 0x24 - {value: 0x0117, lo: 0x80, hi: 0x9f}, - {value: 0x2f53, lo: 0xa0, hi: 0xa0}, - {value: 0x0012, lo: 0xa1, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xb3}, - {value: 0x0012, lo: 0xb4, hi: 0xb9}, - {value: 0x098b, lo: 0xba, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x2953, lo: 0xbd, hi: 0xbd}, - {value: 0x0a0b, lo: 0xbe, hi: 0xbe}, - {value: 0x0a8a, lo: 0xbf, hi: 0xbf}, - // Block 0x5, offset 0x2e - {value: 0x0015, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x97}, - {value: 0x0004, lo: 0x98, hi: 0x9d}, - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0015, lo: 0xa0, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xbf}, - // Block 0x6, offset 0x34 - {value: 0x0024, lo: 0x80, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbf}, - // Block 0x7, offset 0x37 - {value: 0x6553, lo: 0x80, hi: 0x8f}, - {value: 0x2013, lo: 0x90, hi: 0x9f}, - {value: 0x5f53, lo: 0xa0, hi: 0xaf}, - {value: 0x2012, lo: 0xb0, hi: 0xbf}, - // Block 0x8, offset 0x3b - {value: 0x5f52, lo: 0x80, hi: 0x8f}, - {value: 0x6552, lo: 0x90, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x9, offset 0x3e - {value: 0x0117, lo: 0x80, hi: 0x81}, - {value: 0x0024, lo: 0x83, hi: 0x87}, - {value: 0x0014, lo: 0x88, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xbf}, - // Block 0xa, offset 0x42 - {value: 0x0f13, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x0716, lo: 0x8b, hi: 0x8c}, - {value: 0x0316, lo: 0x8d, hi: 0x8e}, - {value: 0x0f12, lo: 0x8f, hi: 0x8f}, - {value: 0x0117, lo: 0x90, hi: 0xbf}, - // Block 0xb, offset 0x4c - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x6553, lo: 0xb1, hi: 0xbf}, - // Block 0xc, offset 0x4e - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6853, lo: 0x90, hi: 0x96}, - {value: 0x0014, lo: 0x99, hi: 0x99}, - {value: 0x0010, lo: 0x9a, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0054, lo: 0x9f, hi: 0x9f}, - {value: 0x0012, lo: 0xa0, hi: 0xa0}, - {value: 0x6552, lo: 0xa1, hi: 0xaf}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0xd, offset 0x57 - {value: 0x0034, lo: 0x81, hi: 0x82}, - {value: 0x0024, lo: 0x84, hi: 0x84}, - {value: 0x0034, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0xaa}, - {value: 0x0010, lo: 0xaf, hi: 0xb3}, - {value: 0x0054, lo: 0xb4, hi: 0xb4}, - // Block 0xe, offset 0x5e - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0024, lo: 0x90, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0014, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xf, offset 0x63 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9c}, - {value: 0x0024, lo: 0x9d, hi: 0x9e}, - {value: 0x0034, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x10, offset 0x71 - {value: 0x0010, lo: 0x80, hi: 0xbf}, - // Block 0x11, offset 0x72 - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0024, lo: 0x9f, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xaa, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x12, offset 0x80 - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0034, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0034, lo: 0xb1, hi: 0xb1}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbd}, - {value: 0x0034, lo: 0xbe, hi: 0xbe}, - {value: 0x0024, lo: 0xbf, hi: 0xbf}, - // Block 0x13, offset 0x8f - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0024, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x88}, - {value: 0x0024, lo: 0x89, hi: 0x8a}, - {value: 0x0010, lo: 0x8d, hi: 0xbf}, - // Block 0x14, offset 0x99 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x15, offset 0x9c - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xb1}, - {value: 0x0034, lo: 0xb2, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0x16, offset 0xa3 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x99}, - {value: 0x0014, lo: 0x9a, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0xa3}, - {value: 0x0014, lo: 0xa4, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xad}, - // Block 0x17, offset 0xab - {value: 0x0010, lo: 0x80, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0xa0, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x18, offset 0xaf - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0004, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x8f}, - {value: 0x0014, lo: 0x90, hi: 0x91}, - {value: 0x0024, lo: 0x97, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x9b}, - {value: 0x0024, lo: 0x9c, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x19, offset 0xb7 - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1a, offset 0xbd - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0x1b, offset 0xcb - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb6, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1c, offset 0xd6 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xb1}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - // Block 0x1d, offset 0xe3 - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x1e, offset 0xee - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x99, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x1f, offset 0xfa - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x20, offset 0x104 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x85}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xbf}, - // Block 0x21, offset 0x110 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x22, offset 0x11b - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x23, offset 0x127 - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0010, lo: 0xa8, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x24, offset 0x133 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x25, offset 0x13b - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbf}, - // Block 0x26, offset 0x145 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x88}, - {value: 0x0014, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x27, offset 0x150 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x28, offset 0x15b - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x9c, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb3}, - // Block 0x29, offset 0x167 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x2a, offset 0x16d - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x94, hi: 0x97}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xba, hi: 0xbf}, - // Block 0x2b, offset 0x178 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x96}, - {value: 0x0010, lo: 0x9a, hi: 0xb1}, - {value: 0x0010, lo: 0xb3, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x2c, offset 0x17e - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x94}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9f}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - // Block 0x2d, offset 0x186 - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - // Block 0x2e, offset 0x189 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x2f, offset 0x18e - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - {value: 0x0014, lo: 0xbb, hi: 0xbc}, - // Block 0x30, offset 0x192 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x31, offset 0x196 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0034, lo: 0x98, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0034, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x32, offset 0x19d - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xac}, - {value: 0x0034, lo: 0xb1, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xba, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x33, offset 0x1a6 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0024, lo: 0x82, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x86, hi: 0x87}, - {value: 0x0010, lo: 0x88, hi: 0x8c}, - {value: 0x0014, lo: 0x8d, hi: 0x97}, - {value: 0x0014, lo: 0x99, hi: 0xbc}, - // Block 0x34, offset 0x1ae - {value: 0x0034, lo: 0x86, hi: 0x86}, - // Block 0x35, offset 0x1af - {value: 0x0010, lo: 0xab, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbe}, - // Block 0x36, offset 0x1b8 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x96, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x99}, - {value: 0x0014, lo: 0x9e, hi: 0xa0}, - {value: 0x0010, lo: 0xa2, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xad}, - {value: 0x0014, lo: 0xb1, hi: 0xb4}, - // Block 0x37, offset 0x1bf - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x6c53, lo: 0xa0, hi: 0xbf}, - // Block 0x38, offset 0x1c7 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x9a, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x39, offset 0x1cd - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x3a, offset 0x1d2 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x82, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3b, offset 0x1d6 - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3c, offset 0x1d9 - {value: 0x0010, lo: 0x80, hi: 0x9a}, - {value: 0x0024, lo: 0x9d, hi: 0x9f}, - // Block 0x3d, offset 0x1db - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x7453, lo: 0xa0, hi: 0xaf}, - {value: 0x7853, lo: 0xb0, hi: 0xbf}, - // Block 0x3e, offset 0x1de - {value: 0x7c53, lo: 0x80, hi: 0x8f}, - {value: 0x8053, lo: 0x90, hi: 0x9f}, - {value: 0x7c53, lo: 0xa0, hi: 0xaf}, - {value: 0x0813, lo: 0xb0, hi: 0xb5}, - {value: 0x0892, lo: 0xb8, hi: 0xbd}, - // Block 0x3f, offset 0x1e3 - {value: 0x0010, lo: 0x81, hi: 0xbf}, - // Block 0x40, offset 0x1e4 - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0010, lo: 0xaf, hi: 0xbf}, - // Block 0x41, offset 0x1e6 - {value: 0x0010, lo: 0x81, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x42, offset 0x1e8 - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb8}, - // Block 0x43, offset 0x1ea - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0034, lo: 0x94, hi: 0x94}, - {value: 0x0030, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x9f, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0030, lo: 0xb4, hi: 0xb4}, - // Block 0x44, offset 0x1f1 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xac}, - {value: 0x0010, lo: 0xae, hi: 0xb0}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - // Block 0x45, offset 0x1f6 - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x46, offset 0x1fa - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x89, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0014, lo: 0x93, hi: 0x93}, - {value: 0x0004, lo: 0x97, hi: 0x97}, - {value: 0x0024, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0x47, offset 0x203 - {value: 0x0014, lo: 0x8b, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x48, offset 0x206 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb8}, - // Block 0x49, offset 0x209 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x4a, offset 0x20f - {value: 0x0010, lo: 0x80, hi: 0xb5}, - // Block 0x4b, offset 0x210 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbb}, - // Block 0x4c, offset 0x21b - {value: 0x0010, lo: 0x86, hi: 0x8f}, - // Block 0x4d, offset 0x21c - {value: 0x0010, lo: 0x90, hi: 0x9a}, - // Block 0x4e, offset 0x21d - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - // Block 0x4f, offset 0x222 - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x9e}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xac}, - {value: 0x0010, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xbc}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x50, offset 0x22f - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xa7, hi: 0xa7}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - {value: 0x0034, lo: 0xb5, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbc}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x51, offset 0x238 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0024, lo: 0x81, hi: 0x82}, - {value: 0x0034, lo: 0x83, hi: 0x84}, - {value: 0x0024, lo: 0x85, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0024, lo: 0x8b, hi: 0x9c}, - {value: 0x0034, lo: 0x9d, hi: 0x9d}, - {value: 0x0024, lo: 0xa0, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - // Block 0x52, offset 0x243 - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x53, offset 0x24b - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0030, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xab, hi: 0xab}, - {value: 0x0034, lo: 0xac, hi: 0xac}, - {value: 0x0024, lo: 0xad, hi: 0xb3}, - // Block 0x54, offset 0x254 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0030, lo: 0xaa, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbf}, - // Block 0x55, offset 0x25d - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0030, lo: 0xb2, hi: 0xb3}, - // Block 0x56, offset 0x266 - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0x57, offset 0x26b - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8d, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x58, offset 0x26e - {value: 0x32ea, lo: 0x80, hi: 0x80}, - {value: 0x336a, lo: 0x81, hi: 0x81}, - {value: 0x33ea, lo: 0x82, hi: 0x82}, - {value: 0x346a, lo: 0x83, hi: 0x83}, - {value: 0x34ea, lo: 0x84, hi: 0x84}, - {value: 0x356a, lo: 0x85, hi: 0x85}, - {value: 0x35ea, lo: 0x86, hi: 0x86}, - {value: 0x366a, lo: 0x87, hi: 0x87}, - {value: 0x36ea, lo: 0x88, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x8353, lo: 0x90, hi: 0xba}, - {value: 0x8353, lo: 0xbd, hi: 0xbf}, - // Block 0x59, offset 0x27a - {value: 0x0024, lo: 0x90, hi: 0x92}, - {value: 0x0034, lo: 0x94, hi: 0x99}, - {value: 0x0024, lo: 0x9a, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9f}, - {value: 0x0024, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0034, lo: 0xa2, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xb3}, - {value: 0x0024, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb7}, - {value: 0x0024, lo: 0xb8, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xba}, - // Block 0x5a, offset 0x288 - {value: 0x0012, lo: 0x80, hi: 0xab}, - {value: 0x0015, lo: 0xac, hi: 0xbf}, - // Block 0x5b, offset 0x28a - {value: 0x0015, lo: 0x80, hi: 0xaa}, - {value: 0x0012, lo: 0xab, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb8}, - {value: 0x8752, lo: 0xb9, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbc}, - {value: 0x8b52, lo: 0xbd, hi: 0xbd}, - {value: 0x0012, lo: 0xbe, hi: 0xbf}, - // Block 0x5c, offset 0x291 - {value: 0x0012, lo: 0x80, hi: 0x8d}, - {value: 0x8f52, lo: 0x8e, hi: 0x8e}, - {value: 0x0012, lo: 0x8f, hi: 0x9a}, - {value: 0x0015, lo: 0x9b, hi: 0xbf}, - // Block 0x5d, offset 0x295 - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0024, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbd}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x5e, offset 0x2a1 - {value: 0x0117, lo: 0x80, hi: 0xbf}, - // Block 0x5f, offset 0x2a2 - {value: 0x0117, lo: 0x80, hi: 0x95}, - {value: 0x379a, lo: 0x96, hi: 0x96}, - {value: 0x384a, lo: 0x97, hi: 0x97}, - {value: 0x38fa, lo: 0x98, hi: 0x98}, - {value: 0x39aa, lo: 0x99, hi: 0x99}, - {value: 0x3a5a, lo: 0x9a, hi: 0x9a}, - {value: 0x3b0a, lo: 0x9b, hi: 0x9b}, - {value: 0x0012, lo: 0x9c, hi: 0x9d}, - {value: 0x3bbb, lo: 0x9e, hi: 0x9e}, - {value: 0x0012, lo: 0x9f, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x60, offset 0x2ad - {value: 0x0812, lo: 0x80, hi: 0x87}, - {value: 0x0813, lo: 0x88, hi: 0x8f}, - {value: 0x0812, lo: 0x90, hi: 0x95}, - {value: 0x0813, lo: 0x98, hi: 0x9d}, - {value: 0x0812, lo: 0xa0, hi: 0xa7}, - {value: 0x0813, lo: 0xa8, hi: 0xaf}, - {value: 0x0812, lo: 0xb0, hi: 0xb7}, - {value: 0x0813, lo: 0xb8, hi: 0xbf}, - // Block 0x61, offset 0x2b5 - {value: 0x0004, lo: 0x8b, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8f}, - {value: 0x0054, lo: 0x98, hi: 0x99}, - {value: 0x0054, lo: 0xa4, hi: 0xa4}, - {value: 0x0054, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xaa, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x62, offset 0x2bd - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x94, hi: 0x94}, - {value: 0x0014, lo: 0xa0, hi: 0xa4}, - {value: 0x0014, lo: 0xa6, hi: 0xaf}, - {value: 0x0015, lo: 0xb1, hi: 0xb1}, - {value: 0x0015, lo: 0xbf, hi: 0xbf}, - // Block 0x63, offset 0x2c3 - {value: 0x0015, lo: 0x90, hi: 0x9c}, - // Block 0x64, offset 0x2c4 - {value: 0x0024, lo: 0x90, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x93}, - {value: 0x0024, lo: 0x94, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0xa0}, - {value: 0x0024, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa4}, - {value: 0x0034, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa7}, - {value: 0x0034, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xa9}, - {value: 0x0034, lo: 0xaa, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - // Block 0x65, offset 0x2d2 - {value: 0x0016, lo: 0x85, hi: 0x86}, - {value: 0x0012, lo: 0x87, hi: 0x89}, - {value: 0xa452, lo: 0x8e, hi: 0x8e}, - {value: 0x1013, lo: 0xa0, hi: 0xaf}, - {value: 0x1012, lo: 0xb0, hi: 0xbf}, - // Block 0x66, offset 0x2d7 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x88}, - // Block 0x67, offset 0x2da - {value: 0xa753, lo: 0xb6, hi: 0xb7}, - {value: 0xaa53, lo: 0xb8, hi: 0xb9}, - {value: 0xad53, lo: 0xba, hi: 0xbb}, - {value: 0xaa53, lo: 0xbc, hi: 0xbd}, - {value: 0xa753, lo: 0xbe, hi: 0xbf}, - // Block 0x68, offset 0x2df - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6553, lo: 0x90, hi: 0x9f}, - {value: 0xb053, lo: 0xa0, hi: 0xaf}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0x69, offset 0x2e3 - {value: 0x0117, lo: 0x80, hi: 0xa3}, - {value: 0x0012, lo: 0xa4, hi: 0xa4}, - {value: 0x0716, lo: 0xab, hi: 0xac}, - {value: 0x0316, lo: 0xad, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb3}, - // Block 0x6a, offset 0x2e9 - {value: 0x6c52, lo: 0x80, hi: 0x9f}, - {value: 0x7052, lo: 0xa0, hi: 0xa5}, - {value: 0x7052, lo: 0xa7, hi: 0xa7}, - {value: 0x7052, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x6b, offset 0x2ee - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x6c, offset 0x2f1 - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0010, lo: 0xb0, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x6d, offset 0x2f6 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9e}, - {value: 0x0024, lo: 0xa0, hi: 0xbf}, - // Block 0x6e, offset 0x2fb - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - // Block 0x6f, offset 0x2fc - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0xaa, hi: 0xad}, - {value: 0x0030, lo: 0xae, hi: 0xaf}, - {value: 0x0004, lo: 0xb1, hi: 0xb5}, - {value: 0x0014, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - // Block 0x70, offset 0x302 - {value: 0x0034, lo: 0x99, hi: 0x9a}, - {value: 0x0004, lo: 0x9b, hi: 0x9e}, - // Block 0x71, offset 0x304 - {value: 0x0004, lo: 0xbc, hi: 0xbe}, - // Block 0x72, offset 0x305 - {value: 0x0010, lo: 0x85, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x73, offset 0x307 - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x74, offset 0x309 - {value: 0x0010, lo: 0x80, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0xbf}, - // Block 0x75, offset 0x30c - {value: 0x0010, lo: 0x80, hi: 0x8c}, - // Block 0x76, offset 0x30d - {value: 0x0010, lo: 0x90, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x77, offset 0x30f - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0xab}, - // Block 0x78, offset 0x312 - {value: 0x0117, lo: 0x80, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb2}, - {value: 0x0024, lo: 0xb4, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x79, offset 0x318 - {value: 0x0117, lo: 0x80, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9d}, - {value: 0x0024, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x7a, offset 0x31c - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb1}, - // Block 0x7b, offset 0x31e - {value: 0x0004, lo: 0x80, hi: 0x87}, - {value: 0x0014, lo: 0x88, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xaf}, - {value: 0x0012, lo: 0xb0, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xbf}, - // Block 0x7c, offset 0x323 - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x0015, lo: 0xb0, hi: 0xb0}, - {value: 0x0012, lo: 0xb1, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x8753, lo: 0xbd, hi: 0xbd}, - {value: 0x0117, lo: 0xbe, hi: 0xbf}, - // Block 0x7d, offset 0x32a - {value: 0x0117, lo: 0x80, hi: 0x83}, - {value: 0x6553, lo: 0x84, hi: 0x84}, - {value: 0x918b, lo: 0x85, hi: 0x85}, - {value: 0x8f53, lo: 0x86, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x91eb, lo: 0x8b, hi: 0x8b}, - {value: 0x0117, lo: 0x8c, hi: 0x9b}, - {value: 0x924b, lo: 0x9c, hi: 0x9c}, - {value: 0x0015, lo: 0xb1, hi: 0xb4}, - {value: 0x0316, lo: 0xb5, hi: 0xb6}, - {value: 0x0010, lo: 0xb7, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbf}, - // Block 0x7e, offset 0x339 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x8c, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0034, lo: 0xac, hi: 0xac}, - // Block 0x7f, offset 0x343 - {value: 0x0010, lo: 0x80, hi: 0xb3}, - // Block 0x80, offset 0x344 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xa0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb7}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x81, offset 0x34d - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x82, offset 0x351 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0x92}, - {value: 0x0030, lo: 0x93, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0x83, offset 0x356 - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x84, offset 0x35e - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0004, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x85, offset 0x364 - {value: 0x0010, lo: 0x80, hi: 0xa8}, - {value: 0x0014, lo: 0xa9, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0x86, offset 0x36a - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x87, offset 0x374 - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0024, lo: 0xbe, hi: 0xbf}, - // Block 0x88, offset 0x379 - {value: 0x0024, lo: 0x81, hi: 0x81}, - {value: 0x0004, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - // Block 0x89, offset 0x382 - {value: 0x0010, lo: 0x81, hi: 0x86}, - {value: 0x0010, lo: 0x89, hi: 0x8e}, - {value: 0x0010, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x8a, offset 0x388 - {value: 0x0012, lo: 0x80, hi: 0x92}, - {value: 0xb352, lo: 0x93, hi: 0x93}, - {value: 0x0012, lo: 0x94, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9f}, - {value: 0x0012, lo: 0xa0, hi: 0xa8}, - {value: 0x0015, lo: 0xa9, hi: 0xa9}, - {value: 0x0004, lo: 0xaa, hi: 0xab}, - {value: 0x74d2, lo: 0xb0, hi: 0xbf}, - // Block 0x8b, offset 0x391 - {value: 0x78d2, lo: 0x80, hi: 0x8f}, - {value: 0x7cd2, lo: 0x90, hi: 0x9f}, - {value: 0x80d2, lo: 0xa0, hi: 0xaf}, - {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, - // Block 0x8c, offset 0x395 - {value: 0x0010, lo: 0x80, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x8d, offset 0x39d - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x8e, offset 0x39f - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x8b, hi: 0xbb}, - // Block 0x8f, offset 0x3a1 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0xbf}, - // Block 0x90, offset 0x3a4 - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0004, lo: 0xb2, hi: 0xbf}, - // Block 0x91, offset 0x3a6 - {value: 0x0004, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x93, hi: 0xbf}, - // Block 0x92, offset 0x3a8 - {value: 0x0010, lo: 0x80, hi: 0xbd}, - // Block 0x93, offset 0x3a9 - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x94, offset 0x3aa - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0xbf}, - // Block 0x95, offset 0x3ac - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0xb0, hi: 0xbb}, - // Block 0x96, offset 0x3ae - {value: 0x0014, lo: 0x80, hi: 0x8f}, - {value: 0x0054, lo: 0x93, hi: 0x93}, - {value: 0x0024, lo: 0xa0, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - // Block 0x97, offset 0x3b4 - {value: 0x0010, lo: 0x8d, hi: 0x8f}, - {value: 0x0054, lo: 0x92, hi: 0x92}, - {value: 0x0054, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0xb0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0x98, offset 0x3b9 - {value: 0x0010, lo: 0x80, hi: 0xbc}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x99, offset 0x3bb - {value: 0x0054, lo: 0x87, hi: 0x87}, - {value: 0x0054, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0054, lo: 0x9a, hi: 0x9a}, - {value: 0x5f53, lo: 0xa1, hi: 0xba}, - {value: 0x0004, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9a, offset 0x3c2 - {value: 0x0004, lo: 0x80, hi: 0x80}, - {value: 0x5f52, lo: 0x81, hi: 0x9a}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - // Block 0x9b, offset 0x3c5 - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbe}, - // Block 0x9c, offset 0x3c7 - {value: 0x0010, lo: 0x82, hi: 0x87}, - {value: 0x0010, lo: 0x8a, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0x97}, - {value: 0x0010, lo: 0x9a, hi: 0x9c}, - {value: 0x0004, lo: 0xa3, hi: 0xa3}, - {value: 0x0014, lo: 0xb9, hi: 0xbb}, - // Block 0x9d, offset 0x3cd - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0010, lo: 0x8d, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xba}, - {value: 0x0010, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9e, offset 0x3d2 - {value: 0x0010, lo: 0x80, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x9d}, - // Block 0x9f, offset 0x3d4 - {value: 0x0010, lo: 0x80, hi: 0xba}, - // Block 0xa0, offset 0x3d5 - {value: 0x0010, lo: 0x80, hi: 0xb4}, - // Block 0xa1, offset 0x3d6 - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0xa2, offset 0x3d7 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa3, offset 0x3d9 - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - // Block 0xa4, offset 0x3db - {value: 0x0010, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xad, hi: 0xbf}, - // Block 0xa5, offset 0x3dd - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0xb5}, - {value: 0x0024, lo: 0xb6, hi: 0xba}, - // Block 0xa6, offset 0x3e0 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa7, offset 0x3e2 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x91, hi: 0x95}, - // Block 0xa8, offset 0x3e5 - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x97}, - {value: 0xb653, lo: 0x98, hi: 0x9f}, - {value: 0xb953, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbf}, - // Block 0xa9, offset 0x3ed - {value: 0xb652, lo: 0x80, hi: 0x87}, - {value: 0xb952, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xaa, offset 0x3f0 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0xb953, lo: 0xb0, hi: 0xb7}, - {value: 0xb653, lo: 0xb8, hi: 0xbf}, - // Block 0xab, offset 0x3f4 - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x93}, - {value: 0xb952, lo: 0x98, hi: 0x9f}, - {value: 0xb652, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbb}, - // Block 0xac, offset 0x3fc - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xad, offset 0x3fe - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0xbc53, lo: 0xb0, hi: 0xb0}, - {value: 0xbf53, lo: 0xb1, hi: 0xb1}, - {value: 0xc253, lo: 0xb2, hi: 0xb2}, - {value: 0xbf53, lo: 0xb3, hi: 0xb3}, - {value: 0xc553, lo: 0xb4, hi: 0xb4}, - {value: 0xbf53, lo: 0xb5, hi: 0xb5}, - {value: 0xc253, lo: 0xb6, hi: 0xb6}, - {value: 0xbf53, lo: 0xb7, hi: 0xb7}, - {value: 0xbc53, lo: 0xb8, hi: 0xb8}, - {value: 0xc853, lo: 0xb9, hi: 0xb9}, - {value: 0xcb53, lo: 0xba, hi: 0xba}, - {value: 0xce53, lo: 0xbc, hi: 0xbc}, - {value: 0xc853, lo: 0xbd, hi: 0xbd}, - {value: 0xcb53, lo: 0xbe, hi: 0xbe}, - {value: 0xc853, lo: 0xbf, hi: 0xbf}, - // Block 0xae, offset 0x40e - {value: 0x0010, lo: 0x80, hi: 0xb6}, - // Block 0xaf, offset 0x40f - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - // Block 0xb0, offset 0x411 - {value: 0x0015, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0015, lo: 0x83, hi: 0x85}, - {value: 0x0015, lo: 0x87, hi: 0xb0}, - {value: 0x0015, lo: 0xb2, hi: 0xba}, - // Block 0xb1, offset 0x416 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xb2, offset 0x41c - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xb3, offset 0x41e - {value: 0x0010, lo: 0x80, hi: 0x9e}, - // Block 0xb4, offset 0x41f - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - // Block 0xb5, offset 0x421 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb9}, - // Block 0xb6, offset 0x423 - {value: 0x0010, lo: 0x80, hi: 0x99}, - // Block 0xb7, offset 0x424 - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xb8, offset 0x426 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x8e, hi: 0x8e}, - {value: 0x0024, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x99, hi: 0xb5}, - {value: 0x0024, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xb9, offset 0x433 - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0xba, offset 0x434 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - // Block 0xbb, offset 0x435 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - // Block 0xbc, offset 0x439 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - // Block 0xbd, offset 0x43b - {value: 0x0010, lo: 0x80, hi: 0x91}, - // Block 0xbe, offset 0x43c - {value: 0x0010, lo: 0x80, hi: 0x88}, - // Block 0xbf, offset 0x43d - {value: 0x5653, lo: 0x80, hi: 0xb2}, - // Block 0xc0, offset 0x43e - {value: 0x5652, lo: 0x80, hi: 0xb2}, - // Block 0xc1, offset 0x43f - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc2, offset 0x442 - {value: 0x0010, lo: 0x80, hi: 0x8d}, - {value: 0x0014, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x8f, hi: 0x8f}, - {value: 0x2013, lo: 0x90, hi: 0x9f}, - {value: 0xd153, lo: 0xa0, hi: 0xa5}, - {value: 0x0024, lo: 0xa9, hi: 0xad}, - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - {value: 0x2012, lo: 0xb0, hi: 0xbf}, - // Block 0xc3, offset 0x44a - {value: 0xd152, lo: 0x80, hi: 0x85}, - // Block 0xc4, offset 0x44b - {value: 0x0010, lo: 0x80, hi: 0xa9}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0010, lo: 0xb0, hi: 0xb1}, - // Block 0xc5, offset 0x44e - {value: 0x0010, lo: 0x82, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0x86, hi: 0x87}, - {value: 0x0034, lo: 0xba, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0034, lo: 0xbd, hi: 0xbf}, - // Block 0xc6, offset 0x454 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xc7, offset 0x457 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x87}, - {value: 0x0024, lo: 0x88, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x8b}, - {value: 0x0024, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xc8, offset 0x45e - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0024, lo: 0x82, hi: 0x82}, - {value: 0x0034, lo: 0x83, hi: 0x83}, - {value: 0x0024, lo: 0x84, hi: 0x84}, - {value: 0x0034, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xc9, offset 0x464 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xca, offset 0x466 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xcb, offset 0x46a - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xcc, offset 0x472 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb6}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - // Block 0xcd, offset 0x478 - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xce, offset 0x47c - {value: 0x0024, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0xcf, offset 0x483 - {value: 0x0010, lo: 0x84, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - // Block 0xd0, offset 0x487 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xd1, offset 0x48b - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x89, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - // Block 0xd2, offset 0x494 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb4}, - {value: 0x0030, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xb7}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xd3, offset 0x49e - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - // Block 0xd4, offset 0x4a0 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xd5, offset 0x4a6 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa2}, - {value: 0x0014, lo: 0xa3, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xd6, offset 0x4ac - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xd7, offset 0x4b6 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0030, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9d, hi: 0xa3}, - {value: 0x0024, lo: 0xa6, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - // Block 0xd8, offset 0x4c0 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xba}, - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0xd9, offset 0x4c6 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0010, lo: 0x8c, hi: 0x8d}, - {value: 0x0034, lo: 0x8e, hi: 0x8e}, - {value: 0x0030, lo: 0x8f, hi: 0x8f}, - {value: 0x0034, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x91, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x92}, - {value: 0x0010, lo: 0x93, hi: 0x93}, - {value: 0x0014, lo: 0xa1, hi: 0xa2}, - // Block 0xda, offset 0x4d2 - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xdb, offset 0x4d4 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - // Block 0xdc, offset 0x4dd - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xdd, offset 0x4e3 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xde, offset 0x4e9 - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xdf, offset 0x4ef - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x98, hi: 0x9b}, - {value: 0x0014, lo: 0x9c, hi: 0x9d}, - // Block 0xe0, offset 0x4f2 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xe1, offset 0x4f8 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xe2, offset 0x4fb - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0014, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb5}, - {value: 0x0030, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - // Block 0xe3, offset 0x504 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x90, hi: 0xa3}, - // Block 0xe4, offset 0x506 - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0014, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xe5, offset 0x50f - {value: 0x0010, lo: 0x80, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - // Block 0xe6, offset 0x513 - {value: 0x5f53, lo: 0xa0, hi: 0xbf}, - // Block 0xe7, offset 0x514 - {value: 0x5f52, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xe8, offset 0x517 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x89, hi: 0x89}, - {value: 0x0010, lo: 0x8c, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0014, lo: 0xbb, hi: 0xbc}, - {value: 0x0030, lo: 0xbd, hi: 0xbd}, - {value: 0x0034, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xe9, offset 0x521 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0034, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xea, offset 0x524 - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - {value: 0x0010, lo: 0xaa, hi: 0xbf}, - // Block 0xeb, offset 0x526 - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0014, lo: 0x94, hi: 0x97}, - {value: 0x0014, lo: 0x9a, hi: 0x9b}, - {value: 0x0010, lo: 0x9c, hi: 0x9f}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - // Block 0xec, offset 0x52d - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x8a}, - {value: 0x0010, lo: 0x8b, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbb, hi: 0xbe}, - // Block 0xed, offset 0x535 - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0014, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x98}, - {value: 0x0014, lo: 0x99, hi: 0x9b}, - {value: 0x0010, lo: 0x9c, hi: 0xbf}, - // Block 0xee, offset 0x53b - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0014, lo: 0x8a, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x99}, - {value: 0x0010, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xef, offset 0x542 - {value: 0x0010, lo: 0x80, hi: 0xb8}, - // Block 0xf0, offset 0x543 - {value: 0x0014, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa4}, - {value: 0x0010, lo: 0xa5, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - // Block 0xf1, offset 0x549 - {value: 0x0010, lo: 0x80, hi: 0xa0}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xf2, offset 0x54b - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xf3, offset 0x551 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0xf4, offset 0x554 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0014, lo: 0x92, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xa9}, - {value: 0x0014, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0xf5, offset 0x55c - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb6}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xf6, offset 0x563 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa5}, - {value: 0x0010, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xbf}, - // Block 0xf7, offset 0x56d - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0014, lo: 0x90, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0x96}, - {value: 0x0034, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xf8, offset 0x576 - {value: 0x0010, lo: 0x80, hi: 0x98}, - {value: 0x0014, lo: 0x99, hi: 0x99}, - {value: 0x0010, lo: 0x9a, hi: 0x9b}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xf9, offset 0x57a - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - // Block 0xfa, offset 0x57d - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xba}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xfb, offset 0x582 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0030, lo: 0x81, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0x9a, hi: 0x9a}, - // Block 0xfc, offset 0x587 - {value: 0x0010, lo: 0xb0, hi: 0xb0}, - // Block 0xfd, offset 0x588 - {value: 0x0010, lo: 0x80, hi: 0xae}, - // Block 0xfe, offset 0x589 - {value: 0x0010, lo: 0x80, hi: 0x83}, - // Block 0xff, offset 0x58a - {value: 0x0010, lo: 0x80, hi: 0xb0}, - // Block 0x100, offset 0x58b - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xbf}, - // Block 0x101, offset 0x58d - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x102, offset 0x591 - {value: 0x0010, lo: 0x80, hi: 0x86}, - // Block 0x103, offset 0x592 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0014, lo: 0x9e, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xae}, - {value: 0x0034, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x104, offset 0x598 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x105, offset 0x59b - {value: 0x0010, lo: 0x80, hi: 0xbe}, - // Block 0x106, offset 0x59c - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x90, hi: 0xad}, - {value: 0x0034, lo: 0xb0, hi: 0xb4}, - // Block 0x107, offset 0x59f - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - // Block 0x108, offset 0x5a1 - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa3, hi: 0xb7}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x109, offset 0x5a5 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - // Block 0x10a, offset 0x5a6 - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xaa}, - {value: 0x0014, lo: 0xab, hi: 0xac}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x10b, offset 0x5aa - {value: 0x2013, lo: 0x80, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xbf}, - // Block 0x10c, offset 0x5ac - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x10d, offset 0x5af - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0014, lo: 0x8f, hi: 0x9f}, - // Block 0x10e, offset 0x5b1 - {value: 0x0014, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa3, hi: 0xa4}, - {value: 0x0030, lo: 0xb0, hi: 0xb1}, - {value: 0x0004, lo: 0xb2, hi: 0xb3}, - // Block 0x10f, offset 0x5b5 - {value: 0x0004, lo: 0xb0, hi: 0xb3}, - {value: 0x0004, lo: 0xb5, hi: 0xbb}, - {value: 0x0004, lo: 0xbd, hi: 0xbe}, - // Block 0x110, offset 0x5b8 - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbc}, - // Block 0x111, offset 0x5ba - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0034, lo: 0x9e, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa3}, - // Block 0x112, offset 0x5bf - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x113, offset 0x5c0 - {value: 0x0014, lo: 0x80, hi: 0xad}, - {value: 0x0014, lo: 0xb0, hi: 0xbf}, - // Block 0x114, offset 0x5c2 - {value: 0x0014, lo: 0x80, hi: 0x86}, - // Block 0x115, offset 0x5c3 - {value: 0x0030, lo: 0xa5, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xa9}, - {value: 0x0030, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbf}, - // Block 0x116, offset 0x5c8 - {value: 0x0034, lo: 0x80, hi: 0x82}, - {value: 0x0024, lo: 0x85, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8b}, - {value: 0x0024, lo: 0xaa, hi: 0xad}, - // Block 0x117, offset 0x5cc - {value: 0x0024, lo: 0x82, hi: 0x84}, - // Block 0x118, offset 0x5cd - {value: 0x0013, lo: 0x80, hi: 0x99}, - {value: 0x0012, lo: 0x9a, hi: 0xb3}, - {value: 0x0013, lo: 0xb4, hi: 0xbf}, - // Block 0x119, offset 0x5d0 - {value: 0x0013, lo: 0x80, hi: 0x8d}, - {value: 0x0012, lo: 0x8e, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0xa7}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0x11a, offset 0x5d4 - {value: 0x0013, lo: 0x80, hi: 0x81}, - {value: 0x0012, lo: 0x82, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0x9c}, - {value: 0x0013, lo: 0x9e, hi: 0x9f}, - {value: 0x0013, lo: 0xa2, hi: 0xa2}, - {value: 0x0013, lo: 0xa5, hi: 0xa6}, - {value: 0x0013, lo: 0xa9, hi: 0xac}, - {value: 0x0013, lo: 0xae, hi: 0xb5}, - {value: 0x0012, lo: 0xb6, hi: 0xb9}, - {value: 0x0012, lo: 0xbb, hi: 0xbb}, - {value: 0x0012, lo: 0xbd, hi: 0xbf}, - // Block 0x11b, offset 0x5df - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0012, lo: 0x85, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0x11c, offset 0x5e3 - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0013, lo: 0x84, hi: 0x85}, - {value: 0x0013, lo: 0x87, hi: 0x8a}, - {value: 0x0013, lo: 0x8d, hi: 0x94}, - {value: 0x0013, lo: 0x96, hi: 0x9c}, - {value: 0x0012, lo: 0x9e, hi: 0xb7}, - {value: 0x0013, lo: 0xb8, hi: 0xb9}, - {value: 0x0013, lo: 0xbb, hi: 0xbe}, - // Block 0x11d, offset 0x5eb - {value: 0x0013, lo: 0x80, hi: 0x84}, - {value: 0x0013, lo: 0x86, hi: 0x86}, - {value: 0x0013, lo: 0x8a, hi: 0x90}, - {value: 0x0012, lo: 0x92, hi: 0xab}, - {value: 0x0013, lo: 0xac, hi: 0xbf}, - // Block 0x11e, offset 0x5f0 - {value: 0x0013, lo: 0x80, hi: 0x85}, - {value: 0x0012, lo: 0x86, hi: 0x9f}, - {value: 0x0013, lo: 0xa0, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbf}, - // Block 0x11f, offset 0x5f4 - {value: 0x0012, lo: 0x80, hi: 0x93}, - {value: 0x0013, lo: 0x94, hi: 0xad}, - {value: 0x0012, lo: 0xae, hi: 0xbf}, - // Block 0x120, offset 0x5f7 - {value: 0x0012, lo: 0x80, hi: 0x87}, - {value: 0x0013, lo: 0x88, hi: 0xa1}, - {value: 0x0012, lo: 0xa2, hi: 0xbb}, - {value: 0x0013, lo: 0xbc, hi: 0xbf}, - // Block 0x121, offset 0x5fb - {value: 0x0013, lo: 0x80, hi: 0x95}, - {value: 0x0012, lo: 0x96, hi: 0xaf}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x122, offset 0x5fe - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0012, lo: 0x8a, hi: 0xa5}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0x123, offset 0x601 - {value: 0x0013, lo: 0x80, hi: 0x80}, - {value: 0x0012, lo: 0x82, hi: 0x9a}, - {value: 0x0012, lo: 0x9c, hi: 0xa1}, - {value: 0x0013, lo: 0xa2, hi: 0xba}, - {value: 0x0012, lo: 0xbc, hi: 0xbf}, - // Block 0x124, offset 0x606 - {value: 0x0012, lo: 0x80, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0xb4}, - {value: 0x0012, lo: 0xb6, hi: 0xbf}, - // Block 0x125, offset 0x60a - {value: 0x0012, lo: 0x80, hi: 0x8e}, - {value: 0x0012, lo: 0x90, hi: 0x95}, - {value: 0x0013, lo: 0x96, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x126, offset 0x60e - {value: 0x0012, lo: 0x80, hi: 0x88}, - {value: 0x0012, lo: 0x8a, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0x127, offset 0x612 - {value: 0x0012, lo: 0x80, hi: 0x82}, - {value: 0x0012, lo: 0x84, hi: 0x89}, - {value: 0x0017, lo: 0x8a, hi: 0x8b}, - {value: 0x0010, lo: 0x8e, hi: 0xbf}, - // Block 0x128, offset 0x616 - {value: 0x0014, lo: 0x80, hi: 0xb6}, - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x129, offset 0x618 - {value: 0x0014, lo: 0x80, hi: 0xac}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x12a, offset 0x61a - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x9b, hi: 0x9f}, - {value: 0x0014, lo: 0xa1, hi: 0xaf}, - // Block 0x12b, offset 0x61d - {value: 0x0012, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8a, hi: 0x8a}, - {value: 0x0012, lo: 0x8b, hi: 0x9e}, - {value: 0x0012, lo: 0xa5, hi: 0xaa}, - // Block 0x12c, offset 0x621 - {value: 0x0024, lo: 0x80, hi: 0x86}, - {value: 0x0024, lo: 0x88, hi: 0x98}, - {value: 0x0024, lo: 0x9b, hi: 0xa1}, - {value: 0x0024, lo: 0xa3, hi: 0xa4}, - {value: 0x0024, lo: 0xa6, hi: 0xaa}, - {value: 0x0015, lo: 0xb0, hi: 0xbf}, - // Block 0x12d, offset 0x627 - {value: 0x0015, lo: 0x80, hi: 0xad}, - // Block 0x12e, offset 0x628 - {value: 0x0024, lo: 0x8f, hi: 0x8f}, - // Block 0x12f, offset 0x629 - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - // Block 0x130, offset 0x62c - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - // Block 0x131, offset 0x62e - {value: 0x0010, lo: 0x90, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xae}, - // Block 0x132, offset 0x630 - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0024, lo: 0xac, hi: 0xaf}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x133, offset 0x633 - {value: 0x0010, lo: 0x90, hi: 0xaa}, - {value: 0x0014, lo: 0xab, hi: 0xab}, - {value: 0x0034, lo: 0xac, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x134, offset 0x638 - {value: 0x0010, lo: 0x90, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xae}, - {value: 0x0034, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xb0, hi: 0xba}, - // Block 0x135, offset 0x63c - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa2}, - {value: 0x0024, lo: 0xa3, hi: 0xa3}, - {value: 0x0010, lo: 0xa4, hi: 0xa5}, - {value: 0x0024, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb0, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xb5}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x136, offset 0x647 - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xab}, - {value: 0x0010, lo: 0xad, hi: 0xae}, - {value: 0x0010, lo: 0xb0, hi: 0xbe}, - // Block 0x137, offset 0x64b - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0034, lo: 0x90, hi: 0x96}, - // Block 0x138, offset 0x64d - {value: 0xe952, lo: 0x80, hi: 0x81}, - {value: 0xec52, lo: 0x82, hi: 0x83}, - {value: 0x0024, lo: 0x84, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x139, offset 0x653 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x9f}, - {value: 0x0010, lo: 0xa1, hi: 0xa2}, - {value: 0x0010, lo: 0xa4, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb7}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - // Block 0x13a, offset 0x65c - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x9b}, - {value: 0x0010, lo: 0xa1, hi: 0xa3}, - {value: 0x0010, lo: 0xa5, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xbb}, - // Block 0x13b, offset 0x661 - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x13c, offset 0x662 - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x13d, offset 0x665 - {value: 0x0013, lo: 0x80, hi: 0x89}, - // Block 0x13e, offset 0x666 - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x13f, offset 0x667 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0014, lo: 0xa0, hi: 0xbf}, - // Block 0x140, offset 0x669 - {value: 0x0014, lo: 0x80, hi: 0xbf}, - // Block 0x141, offset 0x66a - {value: 0x0014, lo: 0x80, hi: 0xaf}, -} - -// Total table size 16747 bytes (16KiB); checksum: D520269F diff --git a/embed/vendor/golang.org/x/text/cases/trieval.go b/embed/vendor/golang.org/x/text/cases/trieval.go deleted file mode 100644 index 4e4d13fe..00000000 --- a/embed/vendor/golang.org/x/text/cases/trieval.go +++ /dev/null @@ -1,217 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package cases - -// This file contains definitions for interpreting the trie value of the case -// trie generated by "go run gen*.go". It is shared by both the generator -// program and the resultant package. Sharing is achieved by the generator -// copying gen_trieval.go to trieval.go and changing what's above this comment. - -// info holds case information for a single rune. It is the value returned -// by a trie lookup. Most mapping information can be stored in a single 16-bit -// value. If not, for example when a rune is mapped to multiple runes, the value -// stores some basic case data and an index into an array with additional data. -// -// The per-rune values have the following format: -// -// if (exception) { -// 15..4 unsigned exception index -// } else { -// 15..8 XOR pattern or index to XOR pattern for case mapping -// Only 13..8 are used for XOR patterns. -// 7 inverseFold (fold to upper, not to lower) -// 6 index: interpret the XOR pattern as an index -// or isMid if case mode is cIgnorableUncased. -// 5..4 CCC: zero (normal or break), above or other -// } -// 3 exception: interpret this value as an exception index -// (TODO: is this bit necessary? Probably implied from case mode.) -// 2..0 case mode -// -// For the non-exceptional cases, a rune must be either uncased, lowercase or -// uppercase. If the rune is cased, the XOR pattern maps either a lowercase -// rune to uppercase or an uppercase rune to lowercase (applied to the 10 -// least-significant bits of the rune). -// -// See the definitions below for a more detailed description of the various -// bits. -type info uint16 - -const ( - casedMask = 0x0003 - fullCasedMask = 0x0007 - ignorableMask = 0x0006 - ignorableValue = 0x0004 - - inverseFoldBit = 1 << 7 - isMidBit = 1 << 6 - - exceptionBit = 1 << 3 - exceptionShift = 4 - numExceptionBits = 12 - - xorIndexBit = 1 << 6 - xorShift = 8 - - // There is no mapping if all xor bits and the exception bit are zero. - hasMappingMask = 0xff80 | exceptionBit -) - -// The case mode bits encodes the case type of a rune. This includes uncased, -// title, upper and lower case and case ignorable. (For a definition of these -// terms see Chapter 3 of The Unicode Standard Core Specification.) In some rare -// cases, a rune can be both cased and case-ignorable. This is encoded by -// cIgnorableCased. A rune of this type is always lower case. Some runes are -// cased while not having a mapping. -// -// A common pattern for scripts in the Unicode standard is for upper and lower -// case runes to alternate for increasing rune values (e.g. the accented Latin -// ranges starting from U+0100 and U+1E00 among others and some Cyrillic -// characters). We use this property by defining a cXORCase mode, where the case -// mode (always upper or lower case) is derived from the rune value. As the XOR -// pattern for case mappings is often identical for successive runes, using -// cXORCase can result in large series of identical trie values. This, in turn, -// allows us to better compress the trie blocks. -const ( - cUncased info = iota // 000 - cTitle // 001 - cLower // 010 - cUpper // 011 - cIgnorableUncased // 100 - cIgnorableCased // 101 // lower case if mappings exist - cXORCase // 11x // case is cLower | ((rune&1) ^ x) - - maxCaseMode = cUpper -) - -func (c info) isCased() bool { - return c&casedMask != 0 -} - -func (c info) isCaseIgnorable() bool { - return c&ignorableMask == ignorableValue -} - -func (c info) isNotCasedAndNotCaseIgnorable() bool { - return c&fullCasedMask == 0 -} - -func (c info) isCaseIgnorableAndNotCased() bool { - return c&fullCasedMask == cIgnorableUncased -} - -func (c info) isMid() bool { - return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased -} - -// The case mapping implementation will need to know about various Canonical -// Combining Class (CCC) values. We encode two of these in the trie value: -// cccZero (0) and cccAbove (230). If the value is cccOther, it means that -// CCC(r) > 0, but not 230. A value of cccBreak means that CCC(r) == 0 and that -// the rune also has the break category Break (see below). -const ( - cccBreak info = iota << 4 - cccZero - cccAbove - cccOther - - cccMask = cccBreak | cccZero | cccAbove | cccOther -) - -const ( - starter = 0 - above = 230 - iotaSubscript = 240 -) - -// The exceptions slice holds data that does not fit in a normal info entry. -// The entry is pointed to by the exception index in an entry. It has the -// following format: -// -// Header: -// -// byte 0: -// 7..6 unused -// 5..4 CCC type (same bits as entry) -// 3 unused -// 2..0 length of fold -// -// byte 1: -// 7..6 unused -// 5..3 length of 1st mapping of case type -// 2..0 length of 2nd mapping of case type -// -// case 1st 2nd -// lower -> upper, title -// upper -> lower, title -// title -> lower, upper -// -// Lengths with the value 0x7 indicate no value and implies no change. -// A length of 0 indicates a mapping to zero-length string. -// -// Body bytes: -// -// case folding bytes -// lowercase mapping bytes -// uppercase mapping bytes -// titlecase mapping bytes -// closure mapping bytes (for NFKC_Casefold). (TODO) -// -// Fallbacks: -// -// missing fold -> lower -// missing title -> upper -// all missing -> original rune -// -// exceptions starts with a dummy byte to enforce that there is no zero index -// value. -const ( - lengthMask = 0x07 - lengthBits = 3 - noChange = 0 -) - -// References to generated trie. - -var trie = newCaseTrie(0) - -var sparse = sparseBlocks{ - values: sparseValues[:], - offsets: sparseOffsets[:], -} - -// Sparse block lookup code. - -// valueRange is an entry in a sparse block. -type valueRange struct { - value uint16 - lo, hi byte -} - -type sparseBlocks struct { - values []valueRange - offsets []uint16 -} - -// lookup returns the value from values block n for byte b using binary search. -func (s *sparseBlocks) lookup(n uint32, b byte) uint16 { - lo := s.offsets[n] - hi := s.offsets[n+1] - for lo < hi { - m := lo + (hi-lo)/2 - r := s.values[m] - if r.lo <= b && b <= r.hi { - return r.value - } - if b < r.lo { - hi = m - } else { - lo = m + 1 - } - } - return 0 -} - -// lastRuneForTesting is the last rune used for testing. Everything after this -// is boring. -const lastRuneForTesting = rune(0x1FFFF) diff --git a/embed/vendor/golang.org/x/text/internal/internal.go b/embed/vendor/golang.org/x/text/internal/internal.go deleted file mode 100644 index 3cddbbdd..00000000 --- a/embed/vendor/golang.org/x/text/internal/internal.go +++ /dev/null @@ -1,49 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package internal contains non-exported functionality that are used by -// packages in the text repository. -package internal // import "golang.org/x/text/internal" - -import ( - "sort" - - "golang.org/x/text/language" -) - -// SortTags sorts tags in place. -func SortTags(tags []language.Tag) { - sort.Sort(sorter(tags)) -} - -type sorter []language.Tag - -func (s sorter) Len() int { - return len(s) -} - -func (s sorter) Swap(i, j int) { - s[i], s[j] = s[j], s[i] -} - -func (s sorter) Less(i, j int) bool { - return s[i].String() < s[j].String() -} - -// UniqueTags sorts and filters duplicate tags in place and returns a slice with -// only unique tags. -func UniqueTags(tags []language.Tag) []language.Tag { - if len(tags) <= 1 { - return tags - } - SortTags(tags) - k := 0 - for i := 1; i < len(tags); i++ { - if tags[k].String() < tags[i].String() { - k++ - tags[k] = tags[i] - } - } - return tags[:k+1] -} diff --git a/embed/vendor/golang.org/x/text/internal/language/common.go b/embed/vendor/golang.org/x/text/internal/language/common.go deleted file mode 100644 index cdfdb749..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/common.go +++ /dev/null @@ -1,16 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// This file contains code common to the maketables.go and the package code. - -// AliasType is the type of an alias in AliasMap. -type AliasType int8 - -const ( - Deprecated AliasType = iota - Macro - Legacy - - AliasTypeUnknown AliasType = -1 -) diff --git a/embed/vendor/golang.org/x/text/internal/language/compact.go b/embed/vendor/golang.org/x/text/internal/language/compact.go deleted file mode 100644 index 46a00150..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/compact.go +++ /dev/null @@ -1,29 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// CompactCoreInfo is a compact integer with the three core tags encoded. -type CompactCoreInfo uint32 - -// GetCompactCore generates a uint32 value that is guaranteed to be unique for -// different language, region, and script values. -func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { - if t.LangID > langNoIndexOffset { - return 0, false - } - cci |= CompactCoreInfo(t.LangID) << (8 + 12) - cci |= CompactCoreInfo(t.ScriptID) << 12 - cci |= CompactCoreInfo(t.RegionID) - return cci, true -} - -// Tag generates a tag from c. -func (c CompactCoreInfo) Tag() Tag { - return Tag{ - LangID: Language(c >> 20), - RegionID: Region(c & 0x3ff), - ScriptID: Script(c>>12) & 0xff, - } -} diff --git a/embed/vendor/golang.org/x/text/internal/language/compact/compact.go b/embed/vendor/golang.org/x/text/internal/language/compact/compact.go deleted file mode 100644 index 1b36935e..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/compact/compact.go +++ /dev/null @@ -1,61 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package compact defines a compact representation of language tags. -// -// Common language tags (at least all for which locale information is defined -// in CLDR) are assigned a unique index. Each Tag is associated with such an -// ID for selecting language-related resources (such as translations) as well -// as one for selecting regional defaults (currency, number formatting, etc.) -// -// It may want to export this functionality at some point, but at this point -// this is only available for use within x/text. -package compact // import "golang.org/x/text/internal/language/compact" - -import ( - "sort" - "strings" - - "golang.org/x/text/internal/language" -) - -// ID is an integer identifying a single tag. -type ID uint16 - -func getCoreIndex(t language.Tag) (id ID, ok bool) { - cci, ok := language.GetCompactCore(t) - if !ok { - return 0, false - } - i := sort.Search(len(coreTags), func(i int) bool { - return cci <= coreTags[i] - }) - if i == len(coreTags) || coreTags[i] != cci { - return 0, false - } - return ID(i), true -} - -// Parent returns the ID of the parent or the root ID if id is already the root. -func (id ID) Parent() ID { - return parents[id] -} - -// Tag converts id to an internal language Tag. -func (id ID) Tag() language.Tag { - if int(id) >= len(coreTags) { - return specialTags[int(id)-len(coreTags)] - } - return coreTags[id].Tag() -} - -var specialTags []language.Tag - -func init() { - tags := strings.Split(specialTagsStr, " ") - specialTags = make([]language.Tag, len(tags)) - for i, t := range tags { - specialTags[i] = language.MustParse(t) - } -} diff --git a/embed/vendor/golang.org/x/text/internal/language/compact/language.go b/embed/vendor/golang.org/x/text/internal/language/compact/language.go deleted file mode 100644 index 8c1b6666..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/compact/language.go +++ /dev/null @@ -1,260 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_index.go -output tables.go -//go:generate go run gen_parents.go - -package compact - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "strings" - - "golang.org/x/text/internal/language" -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. -type Tag struct { - // NOTE: exported tags will become part of the public API. - language ID - locale ID - full fullTag // always a language.Tag for now. -} - -const _und = 0 - -type fullTag interface { - IsRoot() bool - Parent() language.Tag -} - -// Make a compact Tag from a fully specified internal language Tag. -func Make(t language.Tag) (tag Tag) { - if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { - if r, err := language.ParseRegion(region[:2]); err == nil { - tFull := t - t, _ = t.SetTypeForKey("rg", "") - // TODO: should we not consider "va" for the language tag? - var exact1, exact2 bool - tag.language, exact1 = FromTag(t) - t.RegionID = r - tag.locale, exact2 = FromTag(t) - if !exact1 || !exact2 { - tag.full = tFull - } - return tag - } - } - lang, ok := FromTag(t) - tag.language = lang - tag.locale = lang - if !ok { - tag.full = t - } - return tag -} - -// Tag returns an internal language Tag version of this tag. -func (t Tag) Tag() language.Tag { - if t.full != nil { - return t.full.(language.Tag) - } - tag := t.language.Tag() - if t.language != t.locale { - loc := t.locale.Tag() - tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") - } - return tag -} - -// IsCompact reports whether this tag is fully defined in terms of ID. -func (t *Tag) IsCompact() bool { - return t.full == nil -} - -// MayHaveVariants reports whether a tag may have variants. If it returns false -// it is guaranteed the tag does not have variants. -func (t Tag) MayHaveVariants() bool { - return t.full != nil || int(t.language) >= len(coreTags) -} - -// MayHaveExtensions reports whether a tag may have extensions. If it returns -// false it is guaranteed the tag does not have them. -func (t Tag) MayHaveExtensions() bool { - return t.full != nil || - int(t.language) >= len(coreTags) || - t.language != t.locale -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - if t.full != nil { - return t.full.IsRoot() - } - return t.language == _und -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -func (t Tag) Parent() Tag { - if t.full != nil { - return Make(t.full.Parent()) - } - if t.language != t.locale { - // Simulate stripping -u-rg-xxxxxx - return Tag{language: t.language, locale: t.language} - } - // TODO: use parent lookup table once cycle from internal package is - // removed. Probably by internalizing the table and declaring this fast - // enough. - // lang := compactID(internal.Parent(uint16(t.language))) - lang, _ := FromTag(t.language.Tag().Parent()) - return Tag{language: lang, locale: lang} -} - -// nextToken returns token t and the rest of the string. -func nextToken(s string) (t, tail string) { - p := strings.Index(s[1:], "-") - if p == -1 { - return s[1:], "" - } - p++ - return s[1:p], s[p:] -} - -// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags -// for which data exists in the text repository.The index will change over time -// and should not be stored in persistent storage. If t does not match a compact -// index, exact will be false and the compact index will be returned for the -// first match after repeatedly taking the Parent of t. -func LanguageID(t Tag) (id ID, exact bool) { - return t.language, t.full == nil -} - -// RegionalID returns the ID for the regional variant of this tag. This index is -// used to indicate region-specific overrides, such as default currency, default -// calendar and week data, default time cycle, and default measurement system -// and unit preferences. -// -// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US -// settings for currency, number formatting, etc. The CompactIndex for this tag -// will be that for en-GB, while the RegionalID will be the one corresponding to -// en-US. -func RegionalID(t Tag) (id ID, exact bool) { - return t.locale, t.full == nil -} - -// LanguageTag returns t stripped of regional variant indicators. -// -// At the moment this means it is stripped of a regional and variant subtag "rg" -// and "va" in the "u" extension. -func (t Tag) LanguageTag() Tag { - if t.full == nil { - return Tag{language: t.language, locale: t.language} - } - tt := t.Tag() - tt.SetTypeForKey("rg", "") - tt.SetTypeForKey("va", "") - return Make(tt) -} - -// RegionalTag returns the regional variant of the tag. -// -// At the moment this means that the region is set from the regional subtag -// "rg" in the "u" extension. -func (t Tag) RegionalTag() Tag { - rt := Tag{language: t.locale, locale: t.locale} - if t.full == nil { - return rt - } - b := language.Builder{} - tag := t.Tag() - // tag, _ = tag.SetTypeForKey("rg", "") - b.SetTag(t.locale.Tag()) - if v := tag.Variants(); v != "" { - for _, v := range strings.Split(v, "-") { - b.AddVariant(v) - } - } - for _, e := range tag.Extensions() { - b.AddExt(e) - } - return t -} - -// FromTag reports closest matching ID for an internal language Tag. -func FromTag(t language.Tag) (id ID, exact bool) { - // TODO: perhaps give more frequent tags a lower index. - // TODO: we could make the indexes stable. This will excluded some - // possibilities for optimization, so don't do this quite yet. - exact = true - - b, s, r := t.Raw() - if t.HasString() { - if t.IsPrivateUse() { - // We have no entries for user-defined tags. - return 0, false - } - hasExtra := false - if t.HasVariants() { - if t.HasExtensions() { - build := language.Builder{} - build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) - build.AddVariant(t.Variants()) - exact = false - t = build.Make() - } - hasExtra = true - } else if _, ok := t.Extension('u'); ok { - // TODO: va may mean something else. Consider not considering it. - // Strip all but the 'va' entry. - old := t - variant := t.TypeForKey("va") - t = language.Tag{LangID: b, ScriptID: s, RegionID: r} - if variant != "" { - t, _ = t.SetTypeForKey("va", variant) - hasExtra = true - } - exact = old == t - } else { - exact = false - } - if hasExtra { - // We have some variants. - for i, s := range specialTags { - if s == t { - return ID(i + len(coreTags)), exact - } - } - exact = false - } - } - if x, ok := getCoreIndex(t); ok { - return x, exact - } - exact = false - if r != 0 && s == 0 { - // Deal with cases where an extra script is inserted for the region. - t, _ := t.Maximize() - if x, ok := getCoreIndex(t); ok { - return x, exact - } - } - for t = t.Parent(); t != root; t = t.Parent() { - // No variants specified: just compare core components. - // The key has the form lllssrrr, where l, s, and r are nibbles for - // respectively the langID, scriptID, and regionID. - if x, ok := getCoreIndex(t); ok { - return x, exact - } - } - return 0, exact -} - -var root = language.Tag{} diff --git a/embed/vendor/golang.org/x/text/internal/language/compact/parents.go b/embed/vendor/golang.org/x/text/internal/language/compact/parents.go deleted file mode 100644 index 8d810723..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/compact/parents.go +++ /dev/null @@ -1,120 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package compact - -// parents maps a compact index of a tag to the compact index of the parent of -// this tag. -var parents = []ID{ // 775 elements - // Entry 0 - 3F - 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, - 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, - 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, - 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, - 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, - // Entry 40 - 7F - 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, - 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, - 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, - 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, - 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, - 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, - 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, - 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, - // Entry 80 - BF - 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, - 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, - 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, - 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, - // Entry C0 - FF - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, - 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, - 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, - 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, - 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, - // Entry 100 - 13F - 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, - 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, - 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, - 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, - 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - // Entry 140 - 17F - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, - 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, - 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, - 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, - 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, - 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, - // Entry 180 - 1BF - 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, - 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, - 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, - 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, - 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, - 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, - 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, - 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, - // Entry 1C0 - 1FF - 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, - 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, - 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, - 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, - 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, - 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, - 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, - 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, - // Entry 200 - 23F - 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, - 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, - 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, - 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, - 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, - 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, - 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, - // Entry 240 - 27F - 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, - 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, - 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, - 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, - 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, - 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, - 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, - 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, - // Entry 280 - 2BF - 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, - 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, - 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, - 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, - 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, - 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, - 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, - 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, - // Entry 2C0 - 2FF - 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, - 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, - 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, - 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, - 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, - 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, - 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, - 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, - // Entry 300 - 33F - 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, -} // Size: 1574 bytes - -// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/embed/vendor/golang.org/x/text/internal/language/compact/tables.go b/embed/vendor/golang.org/x/text/internal/language/compact/tables.go deleted file mode 100644 index a09ed198..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/compact/tables.go +++ /dev/null @@ -1,1015 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package compact - -import "golang.org/x/text/internal/language" - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "32" - -// NumCompactTags is the number of common tags. The maximum tag is -// NumCompactTags-1. -const NumCompactTags = 775 -const ( - undIndex ID = 0 - afIndex ID = 1 - afNAIndex ID = 2 - afZAIndex ID = 3 - agqIndex ID = 4 - agqCMIndex ID = 5 - akIndex ID = 6 - akGHIndex ID = 7 - amIndex ID = 8 - amETIndex ID = 9 - arIndex ID = 10 - ar001Index ID = 11 - arAEIndex ID = 12 - arBHIndex ID = 13 - arDJIndex ID = 14 - arDZIndex ID = 15 - arEGIndex ID = 16 - arEHIndex ID = 17 - arERIndex ID = 18 - arILIndex ID = 19 - arIQIndex ID = 20 - arJOIndex ID = 21 - arKMIndex ID = 22 - arKWIndex ID = 23 - arLBIndex ID = 24 - arLYIndex ID = 25 - arMAIndex ID = 26 - arMRIndex ID = 27 - arOMIndex ID = 28 - arPSIndex ID = 29 - arQAIndex ID = 30 - arSAIndex ID = 31 - arSDIndex ID = 32 - arSOIndex ID = 33 - arSSIndex ID = 34 - arSYIndex ID = 35 - arTDIndex ID = 36 - arTNIndex ID = 37 - arYEIndex ID = 38 - arsIndex ID = 39 - asIndex ID = 40 - asINIndex ID = 41 - asaIndex ID = 42 - asaTZIndex ID = 43 - astIndex ID = 44 - astESIndex ID = 45 - azIndex ID = 46 - azCyrlIndex ID = 47 - azCyrlAZIndex ID = 48 - azLatnIndex ID = 49 - azLatnAZIndex ID = 50 - basIndex ID = 51 - basCMIndex ID = 52 - beIndex ID = 53 - beBYIndex ID = 54 - bemIndex ID = 55 - bemZMIndex ID = 56 - bezIndex ID = 57 - bezTZIndex ID = 58 - bgIndex ID = 59 - bgBGIndex ID = 60 - bhIndex ID = 61 - bmIndex ID = 62 - bmMLIndex ID = 63 - bnIndex ID = 64 - bnBDIndex ID = 65 - bnINIndex ID = 66 - boIndex ID = 67 - boCNIndex ID = 68 - boINIndex ID = 69 - brIndex ID = 70 - brFRIndex ID = 71 - brxIndex ID = 72 - brxINIndex ID = 73 - bsIndex ID = 74 - bsCyrlIndex ID = 75 - bsCyrlBAIndex ID = 76 - bsLatnIndex ID = 77 - bsLatnBAIndex ID = 78 - caIndex ID = 79 - caADIndex ID = 80 - caESIndex ID = 81 - caFRIndex ID = 82 - caITIndex ID = 83 - ccpIndex ID = 84 - ccpBDIndex ID = 85 - ccpINIndex ID = 86 - ceIndex ID = 87 - ceRUIndex ID = 88 - cggIndex ID = 89 - cggUGIndex ID = 90 - chrIndex ID = 91 - chrUSIndex ID = 92 - ckbIndex ID = 93 - ckbIQIndex ID = 94 - ckbIRIndex ID = 95 - csIndex ID = 96 - csCZIndex ID = 97 - cuIndex ID = 98 - cuRUIndex ID = 99 - cyIndex ID = 100 - cyGBIndex ID = 101 - daIndex ID = 102 - daDKIndex ID = 103 - daGLIndex ID = 104 - davIndex ID = 105 - davKEIndex ID = 106 - deIndex ID = 107 - deATIndex ID = 108 - deBEIndex ID = 109 - deCHIndex ID = 110 - deDEIndex ID = 111 - deITIndex ID = 112 - deLIIndex ID = 113 - deLUIndex ID = 114 - djeIndex ID = 115 - djeNEIndex ID = 116 - dsbIndex ID = 117 - dsbDEIndex ID = 118 - duaIndex ID = 119 - duaCMIndex ID = 120 - dvIndex ID = 121 - dyoIndex ID = 122 - dyoSNIndex ID = 123 - dzIndex ID = 124 - dzBTIndex ID = 125 - ebuIndex ID = 126 - ebuKEIndex ID = 127 - eeIndex ID = 128 - eeGHIndex ID = 129 - eeTGIndex ID = 130 - elIndex ID = 131 - elCYIndex ID = 132 - elGRIndex ID = 133 - enIndex ID = 134 - en001Index ID = 135 - en150Index ID = 136 - enAGIndex ID = 137 - enAIIndex ID = 138 - enASIndex ID = 139 - enATIndex ID = 140 - enAUIndex ID = 141 - enBBIndex ID = 142 - enBEIndex ID = 143 - enBIIndex ID = 144 - enBMIndex ID = 145 - enBSIndex ID = 146 - enBWIndex ID = 147 - enBZIndex ID = 148 - enCAIndex ID = 149 - enCCIndex ID = 150 - enCHIndex ID = 151 - enCKIndex ID = 152 - enCMIndex ID = 153 - enCXIndex ID = 154 - enCYIndex ID = 155 - enDEIndex ID = 156 - enDGIndex ID = 157 - enDKIndex ID = 158 - enDMIndex ID = 159 - enERIndex ID = 160 - enFIIndex ID = 161 - enFJIndex ID = 162 - enFKIndex ID = 163 - enFMIndex ID = 164 - enGBIndex ID = 165 - enGDIndex ID = 166 - enGGIndex ID = 167 - enGHIndex ID = 168 - enGIIndex ID = 169 - enGMIndex ID = 170 - enGUIndex ID = 171 - enGYIndex ID = 172 - enHKIndex ID = 173 - enIEIndex ID = 174 - enILIndex ID = 175 - enIMIndex ID = 176 - enINIndex ID = 177 - enIOIndex ID = 178 - enJEIndex ID = 179 - enJMIndex ID = 180 - enKEIndex ID = 181 - enKIIndex ID = 182 - enKNIndex ID = 183 - enKYIndex ID = 184 - enLCIndex ID = 185 - enLRIndex ID = 186 - enLSIndex ID = 187 - enMGIndex ID = 188 - enMHIndex ID = 189 - enMOIndex ID = 190 - enMPIndex ID = 191 - enMSIndex ID = 192 - enMTIndex ID = 193 - enMUIndex ID = 194 - enMWIndex ID = 195 - enMYIndex ID = 196 - enNAIndex ID = 197 - enNFIndex ID = 198 - enNGIndex ID = 199 - enNLIndex ID = 200 - enNRIndex ID = 201 - enNUIndex ID = 202 - enNZIndex ID = 203 - enPGIndex ID = 204 - enPHIndex ID = 205 - enPKIndex ID = 206 - enPNIndex ID = 207 - enPRIndex ID = 208 - enPWIndex ID = 209 - enRWIndex ID = 210 - enSBIndex ID = 211 - enSCIndex ID = 212 - enSDIndex ID = 213 - enSEIndex ID = 214 - enSGIndex ID = 215 - enSHIndex ID = 216 - enSIIndex ID = 217 - enSLIndex ID = 218 - enSSIndex ID = 219 - enSXIndex ID = 220 - enSZIndex ID = 221 - enTCIndex ID = 222 - enTKIndex ID = 223 - enTOIndex ID = 224 - enTTIndex ID = 225 - enTVIndex ID = 226 - enTZIndex ID = 227 - enUGIndex ID = 228 - enUMIndex ID = 229 - enUSIndex ID = 230 - enVCIndex ID = 231 - enVGIndex ID = 232 - enVIIndex ID = 233 - enVUIndex ID = 234 - enWSIndex ID = 235 - enZAIndex ID = 236 - enZMIndex ID = 237 - enZWIndex ID = 238 - eoIndex ID = 239 - eo001Index ID = 240 - esIndex ID = 241 - es419Index ID = 242 - esARIndex ID = 243 - esBOIndex ID = 244 - esBRIndex ID = 245 - esBZIndex ID = 246 - esCLIndex ID = 247 - esCOIndex ID = 248 - esCRIndex ID = 249 - esCUIndex ID = 250 - esDOIndex ID = 251 - esEAIndex ID = 252 - esECIndex ID = 253 - esESIndex ID = 254 - esGQIndex ID = 255 - esGTIndex ID = 256 - esHNIndex ID = 257 - esICIndex ID = 258 - esMXIndex ID = 259 - esNIIndex ID = 260 - esPAIndex ID = 261 - esPEIndex ID = 262 - esPHIndex ID = 263 - esPRIndex ID = 264 - esPYIndex ID = 265 - esSVIndex ID = 266 - esUSIndex ID = 267 - esUYIndex ID = 268 - esVEIndex ID = 269 - etIndex ID = 270 - etEEIndex ID = 271 - euIndex ID = 272 - euESIndex ID = 273 - ewoIndex ID = 274 - ewoCMIndex ID = 275 - faIndex ID = 276 - faAFIndex ID = 277 - faIRIndex ID = 278 - ffIndex ID = 279 - ffCMIndex ID = 280 - ffGNIndex ID = 281 - ffMRIndex ID = 282 - ffSNIndex ID = 283 - fiIndex ID = 284 - fiFIIndex ID = 285 - filIndex ID = 286 - filPHIndex ID = 287 - foIndex ID = 288 - foDKIndex ID = 289 - foFOIndex ID = 290 - frIndex ID = 291 - frBEIndex ID = 292 - frBFIndex ID = 293 - frBIIndex ID = 294 - frBJIndex ID = 295 - frBLIndex ID = 296 - frCAIndex ID = 297 - frCDIndex ID = 298 - frCFIndex ID = 299 - frCGIndex ID = 300 - frCHIndex ID = 301 - frCIIndex ID = 302 - frCMIndex ID = 303 - frDJIndex ID = 304 - frDZIndex ID = 305 - frFRIndex ID = 306 - frGAIndex ID = 307 - frGFIndex ID = 308 - frGNIndex ID = 309 - frGPIndex ID = 310 - frGQIndex ID = 311 - frHTIndex ID = 312 - frKMIndex ID = 313 - frLUIndex ID = 314 - frMAIndex ID = 315 - frMCIndex ID = 316 - frMFIndex ID = 317 - frMGIndex ID = 318 - frMLIndex ID = 319 - frMQIndex ID = 320 - frMRIndex ID = 321 - frMUIndex ID = 322 - frNCIndex ID = 323 - frNEIndex ID = 324 - frPFIndex ID = 325 - frPMIndex ID = 326 - frREIndex ID = 327 - frRWIndex ID = 328 - frSCIndex ID = 329 - frSNIndex ID = 330 - frSYIndex ID = 331 - frTDIndex ID = 332 - frTGIndex ID = 333 - frTNIndex ID = 334 - frVUIndex ID = 335 - frWFIndex ID = 336 - frYTIndex ID = 337 - furIndex ID = 338 - furITIndex ID = 339 - fyIndex ID = 340 - fyNLIndex ID = 341 - gaIndex ID = 342 - gaIEIndex ID = 343 - gdIndex ID = 344 - gdGBIndex ID = 345 - glIndex ID = 346 - glESIndex ID = 347 - gswIndex ID = 348 - gswCHIndex ID = 349 - gswFRIndex ID = 350 - gswLIIndex ID = 351 - guIndex ID = 352 - guINIndex ID = 353 - guwIndex ID = 354 - guzIndex ID = 355 - guzKEIndex ID = 356 - gvIndex ID = 357 - gvIMIndex ID = 358 - haIndex ID = 359 - haGHIndex ID = 360 - haNEIndex ID = 361 - haNGIndex ID = 362 - hawIndex ID = 363 - hawUSIndex ID = 364 - heIndex ID = 365 - heILIndex ID = 366 - hiIndex ID = 367 - hiINIndex ID = 368 - hrIndex ID = 369 - hrBAIndex ID = 370 - hrHRIndex ID = 371 - hsbIndex ID = 372 - hsbDEIndex ID = 373 - huIndex ID = 374 - huHUIndex ID = 375 - hyIndex ID = 376 - hyAMIndex ID = 377 - idIndex ID = 378 - idIDIndex ID = 379 - igIndex ID = 380 - igNGIndex ID = 381 - iiIndex ID = 382 - iiCNIndex ID = 383 - inIndex ID = 384 - ioIndex ID = 385 - isIndex ID = 386 - isISIndex ID = 387 - itIndex ID = 388 - itCHIndex ID = 389 - itITIndex ID = 390 - itSMIndex ID = 391 - itVAIndex ID = 392 - iuIndex ID = 393 - iwIndex ID = 394 - jaIndex ID = 395 - jaJPIndex ID = 396 - jboIndex ID = 397 - jgoIndex ID = 398 - jgoCMIndex ID = 399 - jiIndex ID = 400 - jmcIndex ID = 401 - jmcTZIndex ID = 402 - jvIndex ID = 403 - jwIndex ID = 404 - kaIndex ID = 405 - kaGEIndex ID = 406 - kabIndex ID = 407 - kabDZIndex ID = 408 - kajIndex ID = 409 - kamIndex ID = 410 - kamKEIndex ID = 411 - kcgIndex ID = 412 - kdeIndex ID = 413 - kdeTZIndex ID = 414 - keaIndex ID = 415 - keaCVIndex ID = 416 - khqIndex ID = 417 - khqMLIndex ID = 418 - kiIndex ID = 419 - kiKEIndex ID = 420 - kkIndex ID = 421 - kkKZIndex ID = 422 - kkjIndex ID = 423 - kkjCMIndex ID = 424 - klIndex ID = 425 - klGLIndex ID = 426 - klnIndex ID = 427 - klnKEIndex ID = 428 - kmIndex ID = 429 - kmKHIndex ID = 430 - knIndex ID = 431 - knINIndex ID = 432 - koIndex ID = 433 - koKPIndex ID = 434 - koKRIndex ID = 435 - kokIndex ID = 436 - kokINIndex ID = 437 - ksIndex ID = 438 - ksINIndex ID = 439 - ksbIndex ID = 440 - ksbTZIndex ID = 441 - ksfIndex ID = 442 - ksfCMIndex ID = 443 - kshIndex ID = 444 - kshDEIndex ID = 445 - kuIndex ID = 446 - kwIndex ID = 447 - kwGBIndex ID = 448 - kyIndex ID = 449 - kyKGIndex ID = 450 - lagIndex ID = 451 - lagTZIndex ID = 452 - lbIndex ID = 453 - lbLUIndex ID = 454 - lgIndex ID = 455 - lgUGIndex ID = 456 - lktIndex ID = 457 - lktUSIndex ID = 458 - lnIndex ID = 459 - lnAOIndex ID = 460 - lnCDIndex ID = 461 - lnCFIndex ID = 462 - lnCGIndex ID = 463 - loIndex ID = 464 - loLAIndex ID = 465 - lrcIndex ID = 466 - lrcIQIndex ID = 467 - lrcIRIndex ID = 468 - ltIndex ID = 469 - ltLTIndex ID = 470 - luIndex ID = 471 - luCDIndex ID = 472 - luoIndex ID = 473 - luoKEIndex ID = 474 - luyIndex ID = 475 - luyKEIndex ID = 476 - lvIndex ID = 477 - lvLVIndex ID = 478 - masIndex ID = 479 - masKEIndex ID = 480 - masTZIndex ID = 481 - merIndex ID = 482 - merKEIndex ID = 483 - mfeIndex ID = 484 - mfeMUIndex ID = 485 - mgIndex ID = 486 - mgMGIndex ID = 487 - mghIndex ID = 488 - mghMZIndex ID = 489 - mgoIndex ID = 490 - mgoCMIndex ID = 491 - mkIndex ID = 492 - mkMKIndex ID = 493 - mlIndex ID = 494 - mlINIndex ID = 495 - mnIndex ID = 496 - mnMNIndex ID = 497 - moIndex ID = 498 - mrIndex ID = 499 - mrINIndex ID = 500 - msIndex ID = 501 - msBNIndex ID = 502 - msMYIndex ID = 503 - msSGIndex ID = 504 - mtIndex ID = 505 - mtMTIndex ID = 506 - muaIndex ID = 507 - muaCMIndex ID = 508 - myIndex ID = 509 - myMMIndex ID = 510 - mznIndex ID = 511 - mznIRIndex ID = 512 - nahIndex ID = 513 - naqIndex ID = 514 - naqNAIndex ID = 515 - nbIndex ID = 516 - nbNOIndex ID = 517 - nbSJIndex ID = 518 - ndIndex ID = 519 - ndZWIndex ID = 520 - ndsIndex ID = 521 - ndsDEIndex ID = 522 - ndsNLIndex ID = 523 - neIndex ID = 524 - neINIndex ID = 525 - neNPIndex ID = 526 - nlIndex ID = 527 - nlAWIndex ID = 528 - nlBEIndex ID = 529 - nlBQIndex ID = 530 - nlCWIndex ID = 531 - nlNLIndex ID = 532 - nlSRIndex ID = 533 - nlSXIndex ID = 534 - nmgIndex ID = 535 - nmgCMIndex ID = 536 - nnIndex ID = 537 - nnNOIndex ID = 538 - nnhIndex ID = 539 - nnhCMIndex ID = 540 - noIndex ID = 541 - nqoIndex ID = 542 - nrIndex ID = 543 - nsoIndex ID = 544 - nusIndex ID = 545 - nusSSIndex ID = 546 - nyIndex ID = 547 - nynIndex ID = 548 - nynUGIndex ID = 549 - omIndex ID = 550 - omETIndex ID = 551 - omKEIndex ID = 552 - orIndex ID = 553 - orINIndex ID = 554 - osIndex ID = 555 - osGEIndex ID = 556 - osRUIndex ID = 557 - paIndex ID = 558 - paArabIndex ID = 559 - paArabPKIndex ID = 560 - paGuruIndex ID = 561 - paGuruINIndex ID = 562 - papIndex ID = 563 - plIndex ID = 564 - plPLIndex ID = 565 - prgIndex ID = 566 - prg001Index ID = 567 - psIndex ID = 568 - psAFIndex ID = 569 - ptIndex ID = 570 - ptAOIndex ID = 571 - ptBRIndex ID = 572 - ptCHIndex ID = 573 - ptCVIndex ID = 574 - ptGQIndex ID = 575 - ptGWIndex ID = 576 - ptLUIndex ID = 577 - ptMOIndex ID = 578 - ptMZIndex ID = 579 - ptPTIndex ID = 580 - ptSTIndex ID = 581 - ptTLIndex ID = 582 - quIndex ID = 583 - quBOIndex ID = 584 - quECIndex ID = 585 - quPEIndex ID = 586 - rmIndex ID = 587 - rmCHIndex ID = 588 - rnIndex ID = 589 - rnBIIndex ID = 590 - roIndex ID = 591 - roMDIndex ID = 592 - roROIndex ID = 593 - rofIndex ID = 594 - rofTZIndex ID = 595 - ruIndex ID = 596 - ruBYIndex ID = 597 - ruKGIndex ID = 598 - ruKZIndex ID = 599 - ruMDIndex ID = 600 - ruRUIndex ID = 601 - ruUAIndex ID = 602 - rwIndex ID = 603 - rwRWIndex ID = 604 - rwkIndex ID = 605 - rwkTZIndex ID = 606 - sahIndex ID = 607 - sahRUIndex ID = 608 - saqIndex ID = 609 - saqKEIndex ID = 610 - sbpIndex ID = 611 - sbpTZIndex ID = 612 - sdIndex ID = 613 - sdPKIndex ID = 614 - sdhIndex ID = 615 - seIndex ID = 616 - seFIIndex ID = 617 - seNOIndex ID = 618 - seSEIndex ID = 619 - sehIndex ID = 620 - sehMZIndex ID = 621 - sesIndex ID = 622 - sesMLIndex ID = 623 - sgIndex ID = 624 - sgCFIndex ID = 625 - shIndex ID = 626 - shiIndex ID = 627 - shiLatnIndex ID = 628 - shiLatnMAIndex ID = 629 - shiTfngIndex ID = 630 - shiTfngMAIndex ID = 631 - siIndex ID = 632 - siLKIndex ID = 633 - skIndex ID = 634 - skSKIndex ID = 635 - slIndex ID = 636 - slSIIndex ID = 637 - smaIndex ID = 638 - smiIndex ID = 639 - smjIndex ID = 640 - smnIndex ID = 641 - smnFIIndex ID = 642 - smsIndex ID = 643 - snIndex ID = 644 - snZWIndex ID = 645 - soIndex ID = 646 - soDJIndex ID = 647 - soETIndex ID = 648 - soKEIndex ID = 649 - soSOIndex ID = 650 - sqIndex ID = 651 - sqALIndex ID = 652 - sqMKIndex ID = 653 - sqXKIndex ID = 654 - srIndex ID = 655 - srCyrlIndex ID = 656 - srCyrlBAIndex ID = 657 - srCyrlMEIndex ID = 658 - srCyrlRSIndex ID = 659 - srCyrlXKIndex ID = 660 - srLatnIndex ID = 661 - srLatnBAIndex ID = 662 - srLatnMEIndex ID = 663 - srLatnRSIndex ID = 664 - srLatnXKIndex ID = 665 - ssIndex ID = 666 - ssyIndex ID = 667 - stIndex ID = 668 - svIndex ID = 669 - svAXIndex ID = 670 - svFIIndex ID = 671 - svSEIndex ID = 672 - swIndex ID = 673 - swCDIndex ID = 674 - swKEIndex ID = 675 - swTZIndex ID = 676 - swUGIndex ID = 677 - syrIndex ID = 678 - taIndex ID = 679 - taINIndex ID = 680 - taLKIndex ID = 681 - taMYIndex ID = 682 - taSGIndex ID = 683 - teIndex ID = 684 - teINIndex ID = 685 - teoIndex ID = 686 - teoKEIndex ID = 687 - teoUGIndex ID = 688 - tgIndex ID = 689 - tgTJIndex ID = 690 - thIndex ID = 691 - thTHIndex ID = 692 - tiIndex ID = 693 - tiERIndex ID = 694 - tiETIndex ID = 695 - tigIndex ID = 696 - tkIndex ID = 697 - tkTMIndex ID = 698 - tlIndex ID = 699 - tnIndex ID = 700 - toIndex ID = 701 - toTOIndex ID = 702 - trIndex ID = 703 - trCYIndex ID = 704 - trTRIndex ID = 705 - tsIndex ID = 706 - ttIndex ID = 707 - ttRUIndex ID = 708 - twqIndex ID = 709 - twqNEIndex ID = 710 - tzmIndex ID = 711 - tzmMAIndex ID = 712 - ugIndex ID = 713 - ugCNIndex ID = 714 - ukIndex ID = 715 - ukUAIndex ID = 716 - urIndex ID = 717 - urINIndex ID = 718 - urPKIndex ID = 719 - uzIndex ID = 720 - uzArabIndex ID = 721 - uzArabAFIndex ID = 722 - uzCyrlIndex ID = 723 - uzCyrlUZIndex ID = 724 - uzLatnIndex ID = 725 - uzLatnUZIndex ID = 726 - vaiIndex ID = 727 - vaiLatnIndex ID = 728 - vaiLatnLRIndex ID = 729 - vaiVaiiIndex ID = 730 - vaiVaiiLRIndex ID = 731 - veIndex ID = 732 - viIndex ID = 733 - viVNIndex ID = 734 - voIndex ID = 735 - vo001Index ID = 736 - vunIndex ID = 737 - vunTZIndex ID = 738 - waIndex ID = 739 - waeIndex ID = 740 - waeCHIndex ID = 741 - woIndex ID = 742 - woSNIndex ID = 743 - xhIndex ID = 744 - xogIndex ID = 745 - xogUGIndex ID = 746 - yavIndex ID = 747 - yavCMIndex ID = 748 - yiIndex ID = 749 - yi001Index ID = 750 - yoIndex ID = 751 - yoBJIndex ID = 752 - yoNGIndex ID = 753 - yueIndex ID = 754 - yueHansIndex ID = 755 - yueHansCNIndex ID = 756 - yueHantIndex ID = 757 - yueHantHKIndex ID = 758 - zghIndex ID = 759 - zghMAIndex ID = 760 - zhIndex ID = 761 - zhHansIndex ID = 762 - zhHansCNIndex ID = 763 - zhHansHKIndex ID = 764 - zhHansMOIndex ID = 765 - zhHansSGIndex ID = 766 - zhHantIndex ID = 767 - zhHantHKIndex ID = 768 - zhHantMOIndex ID = 769 - zhHantTWIndex ID = 770 - zuIndex ID = 771 - zuZAIndex ID = 772 - caESvalenciaIndex ID = 773 - enUSuvaposixIndex ID = 774 -) - -var coreTags = []language.CompactCoreInfo{ // 773 elements - // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d3, 0x01600162, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, - 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, - 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, - 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, - 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, - 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, - // Entry 20 - 3F - 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, - 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, - 0x04300000, 0x0430009a, 0x04400000, 0x04400130, - 0x04800000, 0x0480006f, 0x05800000, 0x05820000, - 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, - 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500163, 0x07900000, 0x07900130, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, - // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, - 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, - 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, - 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, - 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, - 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, - 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, - // Entry 60 - 7F - 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, - 0x10000000, 0x1000007c, 0x10100000, 0x10100064, - 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, - 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, - 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, - // Entry 80 - 9F - 0x13000000, 0x13000081, 0x13000123, 0x13600000, - 0x1360005e, 0x13600088, 0x13900000, 0x13900001, - 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, - 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, - 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, - 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, - 0x13900061, 0x13900062, 0x13900064, 0x13900065, - // Entry A0 - BF - 0x1390006e, 0x13900073, 0x13900074, 0x13900075, - 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, - 0x13900081, 0x13900082, 0x13900084, 0x1390008b, - 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, - 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, - 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, - 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, - 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, - // Entry C0 - DF - 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, - 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, - 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, - 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, - 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, - 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, - 0x1390010f, 0x13900110, 0x13900113, 0x13900118, - 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, - // Entry E0 - FF - 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, - 0x13900132, 0x13900134, 0x13900136, 0x1390013a, - 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, - 0x13900162, 0x13900163, 0x13900165, 0x13c00000, - 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, - 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, - 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, - // Entry 100 - 11F - 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, - 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, - 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, - 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, - 0x14500000, 0x1450006f, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, - 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, - 0x15100000, 0x15100073, 0x15300000, 0x153000e8, - // Entry 120 - 13F - 0x15800000, 0x15800064, 0x15800077, 0x15e00000, - 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, - 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, - 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, - 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, - 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, - 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, - // Entry 140 - 15F - 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, - 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, - 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, - 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, - 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, - 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, - 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, - 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, - // Entry 160 - 17F - 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, - 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, - 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, - 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, - 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, - 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, - 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, - // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, - 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, - 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a3, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, - 0x21200068, 0x21600000, 0x21700000, 0x217000a5, - 0x21f00000, 0x22300000, 0x22300130, 0x22700000, - // Entry 1A0 - 1BF - 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, - 0x239000a5, 0x24200000, 0x242000af, 0x24400000, - 0x24400052, 0x24500000, 0x24500083, 0x24600000, - 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, - 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, - 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, - 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, - // Entry 1C0 - 1DF - 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, - 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, - 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, - 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, - 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, - 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, - // Entry 1E0 - 1FF - 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, - 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, - 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, - 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, - 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, - 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, - 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, - // Entry 200 - 21F - 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, - 0x34700000, 0x347000db, 0x34700111, 0x34e00000, - 0x34e00165, 0x35000000, 0x35000061, 0x350000da, - 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005c, - 0x367000da, 0x36700117, 0x3670011c, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, - 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, - // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000118, 0x38700000, - 0x38900000, 0x38900132, 0x39000000, 0x39000070, - 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, - 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, - 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, - 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, - 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, - // Entry 240 - 25F - 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, - 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, - 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, - 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, - 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, - 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, - 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, - // Entry 260 - 27F - 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, - 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, - 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, - 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, - 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, - 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, - 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, - // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, - 0x42300000, 0x42300165, 0x42900000, 0x42900063, - 0x42900070, 0x429000a5, 0x42900116, 0x43100000, - 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, - 0x43220000, 0x43220033, 0x432200be, 0x43220106, - 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, - 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400073, - // Entry 2A0 - 2BF - 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, - 0x44500130, 0x44500132, 0x44e00000, 0x45000000, - 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, - 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, - 0x46400132, 0x46700000, 0x46700125, 0x46b00000, - 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, - 0x47100000, 0x47600000, 0x47600128, 0x47a00000, - 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, - // Entry 2C0 - 2DF - 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, - 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, - 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, - 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, - 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, - 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, - // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, - 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, - 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, - 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, - // Entry 300 - 31F - 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, - 0x52f00162, -} // Size: 3116 bytes - -const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" - -// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/embed/vendor/golang.org/x/text/internal/language/compact/tags.go b/embed/vendor/golang.org/x/text/internal/language/compact/tags.go deleted file mode 100644 index ca135d29..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/compact/tags.go +++ /dev/null @@ -1,91 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package compact - -var ( - und = Tag{} - - Und Tag = Tag{} - - Afrikaans Tag = Tag{language: afIndex, locale: afIndex} - Amharic Tag = Tag{language: amIndex, locale: amIndex} - Arabic Tag = Tag{language: arIndex, locale: arIndex} - ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} - Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} - Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} - Bengali Tag = Tag{language: bnIndex, locale: bnIndex} - Catalan Tag = Tag{language: caIndex, locale: caIndex} - Czech Tag = Tag{language: csIndex, locale: csIndex} - Danish Tag = Tag{language: daIndex, locale: daIndex} - German Tag = Tag{language: deIndex, locale: deIndex} - Greek Tag = Tag{language: elIndex, locale: elIndex} - English Tag = Tag{language: enIndex, locale: enIndex} - AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} - BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} - Spanish Tag = Tag{language: esIndex, locale: esIndex} - EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} - LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} - Estonian Tag = Tag{language: etIndex, locale: etIndex} - Persian Tag = Tag{language: faIndex, locale: faIndex} - Finnish Tag = Tag{language: fiIndex, locale: fiIndex} - Filipino Tag = Tag{language: filIndex, locale: filIndex} - French Tag = Tag{language: frIndex, locale: frIndex} - CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} - Gujarati Tag = Tag{language: guIndex, locale: guIndex} - Hebrew Tag = Tag{language: heIndex, locale: heIndex} - Hindi Tag = Tag{language: hiIndex, locale: hiIndex} - Croatian Tag = Tag{language: hrIndex, locale: hrIndex} - Hungarian Tag = Tag{language: huIndex, locale: huIndex} - Armenian Tag = Tag{language: hyIndex, locale: hyIndex} - Indonesian Tag = Tag{language: idIndex, locale: idIndex} - Icelandic Tag = Tag{language: isIndex, locale: isIndex} - Italian Tag = Tag{language: itIndex, locale: itIndex} - Japanese Tag = Tag{language: jaIndex, locale: jaIndex} - Georgian Tag = Tag{language: kaIndex, locale: kaIndex} - Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} - Khmer Tag = Tag{language: kmIndex, locale: kmIndex} - Kannada Tag = Tag{language: knIndex, locale: knIndex} - Korean Tag = Tag{language: koIndex, locale: koIndex} - Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} - Lao Tag = Tag{language: loIndex, locale: loIndex} - Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} - Latvian Tag = Tag{language: lvIndex, locale: lvIndex} - Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} - Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} - Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} - Marathi Tag = Tag{language: mrIndex, locale: mrIndex} - Malay Tag = Tag{language: msIndex, locale: msIndex} - Burmese Tag = Tag{language: myIndex, locale: myIndex} - Nepali Tag = Tag{language: neIndex, locale: neIndex} - Dutch Tag = Tag{language: nlIndex, locale: nlIndex} - Norwegian Tag = Tag{language: noIndex, locale: noIndex} - Punjabi Tag = Tag{language: paIndex, locale: paIndex} - Polish Tag = Tag{language: plIndex, locale: plIndex} - Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} - BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} - EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} - Romanian Tag = Tag{language: roIndex, locale: roIndex} - Russian Tag = Tag{language: ruIndex, locale: ruIndex} - Sinhala Tag = Tag{language: siIndex, locale: siIndex} - Slovak Tag = Tag{language: skIndex, locale: skIndex} - Slovenian Tag = Tag{language: slIndex, locale: slIndex} - Albanian Tag = Tag{language: sqIndex, locale: sqIndex} - Serbian Tag = Tag{language: srIndex, locale: srIndex} - SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} - Swedish Tag = Tag{language: svIndex, locale: svIndex} - Swahili Tag = Tag{language: swIndex, locale: swIndex} - Tamil Tag = Tag{language: taIndex, locale: taIndex} - Telugu Tag = Tag{language: teIndex, locale: teIndex} - Thai Tag = Tag{language: thIndex, locale: thIndex} - Turkish Tag = Tag{language: trIndex, locale: trIndex} - Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} - Urdu Tag = Tag{language: urIndex, locale: urIndex} - Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} - Vietnamese Tag = Tag{language: viIndex, locale: viIndex} - Chinese Tag = Tag{language: zhIndex, locale: zhIndex} - SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} - TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} - Zulu Tag = Tag{language: zuIndex, locale: zuIndex} -) diff --git a/embed/vendor/golang.org/x/text/internal/language/compose.go b/embed/vendor/golang.org/x/text/internal/language/compose.go deleted file mode 100644 index 4ae78e0f..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/compose.go +++ /dev/null @@ -1,167 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "sort" - "strings" -) - -// A Builder allows constructing a Tag from individual components. -// Its main user is Compose in the top-level language package. -type Builder struct { - Tag Tag - - private string // the x extension - variants []string - extensions []string -} - -// Make returns a new Tag from the current settings. -func (b *Builder) Make() Tag { - t := b.Tag - - if len(b.extensions) > 0 || len(b.variants) > 0 { - sort.Sort(sortVariants(b.variants)) - sort.Strings(b.extensions) - - if b.private != "" { - b.extensions = append(b.extensions, b.private) - } - n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) - buf := make([]byte, n) - p := t.genCoreBytes(buf) - t.pVariant = byte(p) - p += appendTokens(buf[p:], b.variants...) - t.pExt = uint16(p) - p += appendTokens(buf[p:], b.extensions...) - t.str = string(buf[:p]) - // We may not always need to remake the string, but when or when not - // to do so is rather tricky. - scan := makeScanner(buf[:p]) - t, _ = parse(&scan, "") - return t - - } else if b.private != "" { - t.str = b.private - t.RemakeString() - } - return t -} - -// SetTag copies all the settings from a given Tag. Any previously set values -// are discarded. -func (b *Builder) SetTag(t Tag) { - b.Tag.LangID = t.LangID - b.Tag.RegionID = t.RegionID - b.Tag.ScriptID = t.ScriptID - // TODO: optimize - b.variants = b.variants[:0] - if variants := t.Variants(); variants != "" { - for _, vr := range strings.Split(variants[1:], "-") { - b.variants = append(b.variants, vr) - } - } - b.extensions, b.private = b.extensions[:0], "" - for _, e := range t.Extensions() { - b.AddExt(e) - } -} - -// AddExt adds extension e to the tag. e must be a valid extension as returned -// by Tag.Extension. If the extension already exists, it will be discarded, -// except for a -u extension, where non-existing key-type pairs will added. -func (b *Builder) AddExt(e string) { - if e[0] == 'x' { - if b.private == "" { - b.private = e - } - return - } - for i, s := range b.extensions { - if s[0] == e[0] { - if e[0] == 'u' { - b.extensions[i] += e[1:] - } - return - } - } - b.extensions = append(b.extensions, e) -} - -// SetExt sets the extension e to the tag. e must be a valid extension as -// returned by Tag.Extension. If the extension already exists, it will be -// overwritten, except for a -u extension, where the individual key-type pairs -// will be set. -func (b *Builder) SetExt(e string) { - if e[0] == 'x' { - b.private = e - return - } - for i, s := range b.extensions { - if s[0] == e[0] { - if e[0] == 'u' { - b.extensions[i] = e + s[1:] - } else { - b.extensions[i] = e - } - return - } - } - b.extensions = append(b.extensions, e) -} - -// AddVariant adds any number of variants. -func (b *Builder) AddVariant(v ...string) { - for _, v := range v { - if v != "" { - b.variants = append(b.variants, v) - } - } -} - -// ClearVariants removes any variants previously added, including those -// copied from a Tag in SetTag. -func (b *Builder) ClearVariants() { - b.variants = b.variants[:0] -} - -// ClearExtensions removes any extensions previously added, including those -// copied from a Tag in SetTag. -func (b *Builder) ClearExtensions() { - b.private = "" - b.extensions = b.extensions[:0] -} - -func tokenLen(token ...string) (n int) { - for _, t := range token { - n += len(t) + 1 - } - return -} - -func appendTokens(b []byte, token ...string) int { - p := 0 - for _, t := range token { - b[p] = '-' - copy(b[p+1:], t) - p += 1 + len(t) - } - return p -} - -type sortVariants []string - -func (s sortVariants) Len() int { - return len(s) -} - -func (s sortVariants) Swap(i, j int) { - s[j], s[i] = s[i], s[j] -} - -func (s sortVariants) Less(i, j int) bool { - return variantIndex[s[i]] < variantIndex[s[j]] -} diff --git a/embed/vendor/golang.org/x/text/internal/language/coverage.go b/embed/vendor/golang.org/x/text/internal/language/coverage.go deleted file mode 100644 index 9b20b88f..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/coverage.go +++ /dev/null @@ -1,28 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// BaseLanguages returns the list of all supported base languages. It generates -// the list by traversing the internal structures. -func BaseLanguages() []Language { - base := make([]Language, 0, NumLanguages) - for i := 0; i < langNoIndexOffset; i++ { - // We included "und" already for the value 0. - if i != nonCanonicalUnd { - base = append(base, Language(i)) - } - } - i := langNoIndexOffset - for _, v := range langNoIndex { - for k := 0; k < 8; k++ { - if v&1 == 1 { - base = append(base, Language(i)) - } - v >>= 1 - i++ - } - } - return base -} diff --git a/embed/vendor/golang.org/x/text/internal/language/language.go b/embed/vendor/golang.org/x/text/internal/language/language.go deleted file mode 100644 index 09d41c73..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/language.go +++ /dev/null @@ -1,627 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_common.go -output tables.go - -package language // import "golang.org/x/text/internal/language" - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "errors" - "fmt" - "strings" -) - -const ( - // maxCoreSize is the maximum size of a BCP 47 tag without variants and - // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. - maxCoreSize = 12 - - // max99thPercentileSize is a somewhat arbitrary buffer size that presumably - // is large enough to hold at least 99% of the BCP 47 tags. - max99thPercentileSize = 32 - - // maxSimpleUExtensionSize is the maximum size of a -u extension with one - // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). - maxSimpleUExtensionSize = 14 -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. The zero value of Tag is Und. -type Tag struct { - // TODO: the following fields have the form TagTypeID. This name is chosen - // to allow refactoring the public package without conflicting with its - // Base, Script, and Region methods. Once the transition is fully completed - // the ID can be stripped from the name. - - LangID Language - RegionID Region - // TODO: we will soon run out of positions for ScriptID. Idea: instead of - // storing lang, region, and ScriptID codes, store only the compact index and - // have a lookup table from this code to its expansion. This greatly speeds - // up table lookup, speed up common variant cases. - // This will also immediately free up 3 extra bytes. Also, the pVariant - // field can now be moved to the lookup table, as the compact index uniquely - // determines the offset of a possible variant. - ScriptID Script - pVariant byte // offset in str, includes preceding '-' - pExt uint16 // offset of first extension, includes preceding '-' - - // str is the string representation of the Tag. It will only be used if the - // tag has variants or extensions. - str string -} - -// Make is a convenience wrapper for Parse that omits the error. -// In case of an error, a sensible default is returned. -func Make(s string) Tag { - t, _ := Parse(s) - return t -} - -// Raw returns the raw base language, script and region, without making an -// attempt to infer their values. -// TODO: consider removing -func (t Tag) Raw() (b Language, s Script, r Region) { - return t.LangID, t.ScriptID, t.RegionID -} - -// equalTags compares language, script and region subtags only. -func (t Tag) equalTags(a Tag) bool { - return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - if int(t.pVariant) < len(t.str) { - return false - } - return t.equalTags(Und) -} - -// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use -// tag. -func (t Tag) IsPrivateUse() bool { - return t.str != "" && t.pVariant == 0 -} - -// RemakeString is used to update t.str in case lang, script or region changed. -// It is assumed that pExt and pVariant still point to the start of the -// respective parts. -func (t *Tag) RemakeString() { - if t.str == "" { - return - } - extra := t.str[t.pVariant:] - if t.pVariant > 0 { - extra = extra[1:] - } - if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { - t.str = extra - t.pVariant = 0 - t.pExt = 0 - return - } - var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. - b := buf[:t.genCoreBytes(buf[:])] - if extra != "" { - diff := len(b) - int(t.pVariant) - b = append(b, '-') - b = append(b, extra...) - t.pVariant = uint8(int(t.pVariant) + diff) - t.pExt = uint16(int(t.pExt) + diff) - } else { - t.pVariant = uint8(len(b)) - t.pExt = uint16(len(b)) - } - t.str = string(b) -} - -// genCoreBytes writes a string for the base languages, script and region tags -// to the given buffer and returns the number of bytes written. It will never -// write more than maxCoreSize bytes. -func (t *Tag) genCoreBytes(buf []byte) int { - n := t.LangID.StringToBuf(buf[:]) - if t.ScriptID != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.ScriptID.String()) - } - if t.RegionID != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.RegionID.String()) - } - return n -} - -// String returns the canonical string representation of the language tag. -func (t Tag) String() string { - if t.str != "" { - return t.str - } - if t.ScriptID == 0 && t.RegionID == 0 { - return t.LangID.String() - } - buf := [maxCoreSize]byte{} - return string(buf[:t.genCoreBytes(buf[:])]) -} - -// MarshalText implements encoding.TextMarshaler. -func (t Tag) MarshalText() (text []byte, err error) { - if t.str != "" { - text = append(text, t.str...) - } else if t.ScriptID == 0 && t.RegionID == 0 { - text = append(text, t.LangID.String()...) - } else { - buf := [maxCoreSize]byte{} - text = buf[:t.genCoreBytes(buf[:])] - } - return text, nil -} - -// UnmarshalText implements encoding.TextUnmarshaler. -func (t *Tag) UnmarshalText(text []byte) error { - tag, err := Parse(string(text)) - *t = tag - return err -} - -// Variants returns the part of the tag holding all variants or the empty string -// if there are no variants defined. -func (t Tag) Variants() string { - if t.pVariant == 0 { - return "" - } - return t.str[t.pVariant:t.pExt] -} - -// VariantOrPrivateUseTags returns variants or private use tags. -func (t Tag) VariantOrPrivateUseTags() string { - if t.pExt > 0 { - return t.str[t.pVariant:t.pExt] - } - return t.str[t.pVariant:] -} - -// HasString reports whether this tag defines more than just the raw -// components. -func (t Tag) HasString() bool { - return t.str != "" -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -func (t Tag) Parent() Tag { - if t.str != "" { - // Strip the variants and extensions. - b, s, r := t.Raw() - t = Tag{LangID: b, ScriptID: s, RegionID: r} - if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID == t.ScriptID { - return Tag{LangID: t.LangID} - } - } - return t - } - if t.LangID != 0 { - if t.RegionID != 0 { - maxScript := t.ScriptID - if maxScript == 0 { - max, _ := addTags(t) - maxScript = max.ScriptID - } - - for i := range parents { - if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { - for _, r := range parents[i].fromRegion { - if Region(r) == t.RegionID { - return Tag{ - LangID: t.LangID, - ScriptID: Script(parents[i].script), - RegionID: Region(parents[i].toRegion), - } - } - } - } - } - - // Strip the script if it is the default one. - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID != maxScript { - return Tag{LangID: t.LangID, ScriptID: maxScript} - } - return Tag{LangID: t.LangID} - } else if t.ScriptID != 0 { - // The parent for an base-script pair with a non-default script is - // "und" instead of the base language. - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID != t.ScriptID { - return Und - } - return Tag{LangID: t.LangID} - } - } - return Und -} - -// ParseExtension parses s as an extension and returns it on success. -func ParseExtension(s string) (ext string, err error) { - defer func() { - if recover() != nil { - ext = "" - err = ErrSyntax - } - }() - - scan := makeScannerString(s) - var end int - if n := len(scan.token); n != 1 { - return "", ErrSyntax - } - scan.toLower(0, len(scan.b)) - end = parseExtension(&scan) - if end != len(s) { - return "", ErrSyntax - } - return string(scan.b), nil -} - -// HasVariants reports whether t has variants. -func (t Tag) HasVariants() bool { - return uint16(t.pVariant) < t.pExt -} - -// HasExtensions reports whether t has extensions. -func (t Tag) HasExtensions() bool { - return int(t.pExt) < len(t.str) -} - -// Extension returns the extension of type x for tag t. It will return -// false for ok if t does not have the requested extension. The returned -// extension will be invalid in this case. -func (t Tag) Extension(x byte) (ext string, ok bool) { - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - if ext[0] == x { - return ext, true - } - } - return "", false -} - -// Extensions returns all extensions of t. -func (t Tag) Extensions() []string { - e := []string{} - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - e = append(e, ext) - } - return e -} - -// TypeForKey returns the type associated with the given key, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// TypeForKey will traverse the inheritance chain to get the correct value. -// -// If there are multiple types associated with a key, only the first will be -// returned. If there is no type associated with a key, it returns the empty -// string. -func (t Tag) TypeForKey(key string) string { - if _, start, end, _ := t.findTypeForKey(key); end != start { - s := t.str[start:end] - if p := strings.IndexByte(s, '-'); p >= 0 { - s = s[:p] - } - return s - } - return "" -} - -var ( - errPrivateUse = errors.New("cannot set a key on a private use tag") - errInvalidArguments = errors.New("invalid key or type") -) - -// SetTypeForKey returns a new Tag with the key set to type, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// An empty value removes an existing pair with the same key. -func (t Tag) SetTypeForKey(key, value string) (Tag, error) { - if t.IsPrivateUse() { - return t, errPrivateUse - } - if len(key) != 2 { - return t, errInvalidArguments - } - - // Remove the setting if value is "". - if value == "" { - start, sep, end, _ := t.findTypeForKey(key) - if start != sep { - // Remove a possible empty extension. - switch { - case t.str[start-2] != '-': // has previous elements. - case end == len(t.str), // end of string - end+2 < len(t.str) && t.str[end+2] == '-': // end of extension - start -= 2 - } - if start == int(t.pVariant) && end == len(t.str) { - t.str = "" - t.pVariant, t.pExt = 0, 0 - } else { - t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) - } - } - return t, nil - } - - if len(value) < 3 || len(value) > 8 { - return t, errInvalidArguments - } - - var ( - buf [maxCoreSize + maxSimpleUExtensionSize]byte - uStart int // start of the -u extension. - ) - - // Generate the tag string if needed. - if t.str == "" { - uStart = t.genCoreBytes(buf[:]) - buf[uStart] = '-' - uStart++ - } - - // Create new key-type pair and parse it to verify. - b := buf[uStart:] - copy(b, "u-") - copy(b[2:], key) - b[4] = '-' - b = b[:5+copy(b[5:], value)] - scan := makeScanner(b) - if parseExtensions(&scan); scan.err != nil { - return t, scan.err - } - - // Assemble the replacement string. - if t.str == "" { - t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) - t.str = string(buf[:uStart+len(b)]) - } else { - s := t.str - start, sep, end, hasExt := t.findTypeForKey(key) - if start == sep { - if hasExt { - b = b[2:] - } - t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:]) - } else { - t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:]) - } - } - return t, nil -} - -// findTypeForKey returns the start and end position for the type corresponding -// to key or the point at which to insert the key-value pair if the type -// wasn't found. The hasExt return value reports whether an -u extension was present. -// Note: the extensions are typically very small and are likely to contain -// only one key-type pair. -func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) { - p := int(t.pExt) - if len(key) != 2 || p == len(t.str) || p == 0 { - return p, p, p, false - } - s := t.str - - // Find the correct extension. - for p++; s[p] != 'u'; p++ { - if s[p] > 'u' { - p-- - return p, p, p, false - } - if p = nextExtension(s, p); p == len(s) { - return len(s), len(s), len(s), false - } - } - // Proceed to the hyphen following the extension name. - p++ - - // curKey is the key currently being processed. - curKey := "" - - // Iterate over keys until we get the end of a section. - for { - end = p - for p++; p < len(s) && s[p] != '-'; p++ { - } - n := p - end - 1 - if n <= 2 && curKey == key { - if sep < end { - sep++ - } - return start, sep, end, true - } - switch n { - case 0, // invalid string - 1: // next extension - return end, end, end, true - case 2: - // next key - curKey = s[end+1 : p] - if curKey > key { - return end, end, end, true - } - start = end - sep = p - } - } -} - -// ParseBase parses a 2- or 3-letter ISO 639 code. -// It returns a ValueError if s is a well-formed but unknown language identifier -// or another error if another error occurred. -func ParseBase(s string) (l Language, err error) { - defer func() { - if recover() != nil { - l = 0 - err = ErrSyntax - } - }() - - if n := len(s); n < 2 || 3 < n { - return 0, ErrSyntax - } - var buf [3]byte - return getLangID(buf[:copy(buf[:], s)]) -} - -// ParseScript parses a 4-letter ISO 15924 code. -// It returns a ValueError if s is a well-formed but unknown script identifier -// or another error if another error occurred. -func ParseScript(s string) (scr Script, err error) { - defer func() { - if recover() != nil { - scr = 0 - err = ErrSyntax - } - }() - - if len(s) != 4 { - return 0, ErrSyntax - } - var buf [4]byte - return getScriptID(script, buf[:copy(buf[:], s)]) -} - -// EncodeM49 returns the Region for the given UN M.49 code. -// It returns an error if r is not a valid code. -func EncodeM49(r int) (Region, error) { - return getRegionM49(r) -} - -// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. -// It returns a ValueError if s is a well-formed but unknown region identifier -// or another error if another error occurred. -func ParseRegion(s string) (r Region, err error) { - defer func() { - if recover() != nil { - r = 0 - err = ErrSyntax - } - }() - - if n := len(s); n < 2 || 3 < n { - return 0, ErrSyntax - } - var buf [3]byte - return getRegionID(buf[:copy(buf[:], s)]) -} - -// IsCountry returns whether this region is a country or autonomous area. This -// includes non-standard definitions from CLDR. -func (r Region) IsCountry() bool { - if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { - return false - } - return true -} - -// IsGroup returns whether this region defines a collection of regions. This -// includes non-standard definitions from CLDR. -func (r Region) IsGroup() bool { - if r == 0 { - return false - } - return int(regionInclusion[r]) < len(regionContainment) -} - -// Contains returns whether Region c is contained by Region r. It returns true -// if c == r. -func (r Region) Contains(c Region) bool { - if r == c { - return true - } - g := regionInclusion[r] - if g >= nRegionGroups { - return false - } - m := regionContainment[g] - - d := regionInclusion[c] - b := regionInclusionBits[d] - - // A contained country may belong to multiple disjoint groups. Matching any - // of these indicates containment. If the contained region is a group, it - // must strictly be a subset. - if d >= nRegionGroups { - return b&m != 0 - } - return b&^m == 0 -} - -var errNoTLD = errors.New("language: region is not a valid ccTLD") - -// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. -// In all other cases it returns either the region itself or an error. -// -// This method may return an error for a region for which there exists a -// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The -// region will already be canonicalized it was obtained from a Tag that was -// obtained using any of the default methods. -func (r Region) TLD() (Region, error) { - // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the - // difference between ISO 3166-1 and IANA ccTLD. - if r == _GB { - r = _UK - } - if (r.typ() & ccTLD) == 0 { - return 0, errNoTLD - } - return r, nil -} - -// Canonicalize returns the region or a possible replacement if the region is -// deprecated. It will not return a replacement for deprecated regions that -// are split into multiple regions. -func (r Region) Canonicalize() Region { - if cr := normRegion(r); cr != 0 { - return cr - } - return r -} - -// Variant represents a registered variant of a language as defined by BCP 47. -type Variant struct { - ID uint8 - str string -} - -// ParseVariant parses and returns a Variant. An error is returned if s is not -// a valid variant. -func ParseVariant(s string) (v Variant, err error) { - defer func() { - if recover() != nil { - v = Variant{} - err = ErrSyntax - } - }() - - s = strings.ToLower(s) - if id, ok := variantIndex[s]; ok { - return Variant{id, s}, nil - } - return Variant{}, NewValueError([]byte(s)) -} - -// String returns the string representation of the variant. -func (v Variant) String() string { - return v.str -} diff --git a/embed/vendor/golang.org/x/text/internal/language/lookup.go b/embed/vendor/golang.org/x/text/internal/language/lookup.go deleted file mode 100644 index 231b4fbd..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/lookup.go +++ /dev/null @@ -1,412 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "fmt" - "sort" - "strconv" - - "golang.org/x/text/internal/tag" -) - -// findIndex tries to find the given tag in idx and returns a standardized error -// if it could not be found. -func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { - if !tag.FixCase(form, key) { - return 0, ErrSyntax - } - i := idx.Index(key) - if i == -1 { - return 0, NewValueError(key) - } - return i, nil -} - -func searchUint(imap []uint16, key uint16) int { - return sort.Search(len(imap), func(i int) bool { - return imap[i] >= key - }) -} - -type Language uint16 - -// getLangID returns the langID of s if s is a canonical subtag -// or langUnknown if s is not a canonical subtag. -func getLangID(s []byte) (Language, error) { - if len(s) == 2 { - return getLangISO2(s) - } - return getLangISO3(s) -} - -// TODO language normalization as well as the AliasMaps could be moved to the -// higher level package, but it is a bit tricky to separate the generation. - -func (id Language) Canonicalize() (Language, AliasType) { - return normLang(id) -} - -// normLang returns the mapped langID of id according to mapping m. -func normLang(id Language) (Language, AliasType) { - k := sort.Search(len(AliasMap), func(i int) bool { - return AliasMap[i].From >= uint16(id) - }) - if k < len(AliasMap) && AliasMap[k].From == uint16(id) { - return Language(AliasMap[k].To), AliasTypes[k] - } - return id, AliasTypeUnknown -} - -// getLangISO2 returns the langID for the given 2-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO2(s []byte) (Language, error) { - if !tag.FixCase("zz", s) { - return 0, ErrSyntax - } - if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { - return Language(i), nil - } - return 0, NewValueError(s) -} - -const base = 'z' - 'a' + 1 - -func strToInt(s []byte) uint { - v := uint(0) - for i := 0; i < len(s); i++ { - v *= base - v += uint(s[i] - 'a') - } - return v -} - -// converts the given integer to the original ASCII string passed to strToInt. -// len(s) must match the number of characters obtained. -func intToStr(v uint, s []byte) { - for i := len(s) - 1; i >= 0; i-- { - s[i] = byte(v%base) + 'a' - v /= base - } -} - -// getLangISO3 returns the langID for the given 3-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO3(s []byte) (Language, error) { - if tag.FixCase("und", s) { - // first try to match canonical 3-letter entries - for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { - if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { - // We treat "und" as special and always translate it to "unspecified". - // Note that ZZ and Zzzz are private use and are not treated as - // unspecified by default. - id := Language(i) - if id == nonCanonicalUnd { - return 0, nil - } - return id, nil - } - } - if i := altLangISO3.Index(s); i != -1 { - return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil - } - n := strToInt(s) - if langNoIndex[n/8]&(1<<(n%8)) != 0 { - return Language(n) + langNoIndexOffset, nil - } - // Check for non-canonical uses of ISO3. - for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { - if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { - return Language(i), nil - } - } - return 0, NewValueError(s) - } - return 0, ErrSyntax -} - -// StringToBuf writes the string to b and returns the number of bytes -// written. cap(b) must be >= 3. -func (id Language) StringToBuf(b []byte) int { - if id >= langNoIndexOffset { - intToStr(uint(id)-langNoIndexOffset, b[:3]) - return 3 - } else if id == 0 { - return copy(b, "und") - } - l := lang[id<<2:] - if l[3] == 0 { - return copy(b, l[:3]) - } - return copy(b, l[:2]) -} - -// String returns the BCP 47 representation of the langID. -// Use b as variable name, instead of id, to ensure the variable -// used is consistent with that of Base in which this type is embedded. -func (b Language) String() string { - if b == 0 { - return "und" - } else if b >= langNoIndexOffset { - b -= langNoIndexOffset - buf := [3]byte{} - intToStr(uint(b), buf[:]) - return string(buf[:]) - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } - return l[:2] -} - -// ISO3 returns the ISO 639-3 language code. -func (b Language) ISO3() string { - if b == 0 || b >= langNoIndexOffset { - return b.String() - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } else if l[2] == 0 { - return altLangISO3.Elem(int(l[3]))[:3] - } - // This allocation will only happen for 3-letter ISO codes - // that are non-canonical BCP 47 language identifiers. - return l[0:1] + l[2:4] -} - -// IsPrivateUse reports whether this language code is reserved for private use. -func (b Language) IsPrivateUse() bool { - return langPrivateStart <= b && b <= langPrivateEnd -} - -// SuppressScript returns the script marked as SuppressScript in the IANA -// language tag repository, or 0 if there is no such script. -func (b Language) SuppressScript() Script { - if b < langNoIndexOffset { - return Script(suppressScript[b]) - } - return 0 -} - -type Region uint16 - -// getRegionID returns the region id for s if s is a valid 2-letter region code -// or unknownRegion. -func getRegionID(s []byte) (Region, error) { - if len(s) == 3 { - if isAlpha(s[0]) { - return getRegionISO3(s) - } - if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { - return getRegionM49(int(i)) - } - } - return getRegionISO2(s) -} - -// getRegionISO2 returns the regionID for the given 2-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO2(s []byte) (Region, error) { - i, err := findIndex(regionISO, s, "ZZ") - if err != nil { - return 0, err - } - return Region(i) + isoRegionOffset, nil -} - -// getRegionISO3 returns the regionID for the given 3-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO3(s []byte) (Region, error) { - if tag.FixCase("ZZZ", s) { - for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { - if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { - return Region(i) + isoRegionOffset, nil - } - } - for i := 0; i < len(altRegionISO3); i += 3 { - if tag.Compare(altRegionISO3[i:i+3], s) == 0 { - return Region(altRegionIDs[i/3]), nil - } - } - return 0, NewValueError(s) - } - return 0, ErrSyntax -} - -func getRegionM49(n int) (Region, error) { - if 0 < n && n <= 999 { - const ( - searchBits = 7 - regionBits = 9 - regionMask = 1<> searchBits - buf := fromM49[m49Index[idx]:m49Index[idx+1]] - val := uint16(n) << regionBits // we rely on bits shifting out - i := sort.Search(len(buf), func(i int) bool { - return buf[i] >= val - }) - if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { - return Region(r & regionMask), nil - } - } - var e ValueError - fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) - return 0, e -} - -// normRegion returns a region if r is deprecated or 0 otherwise. -// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). -// TODO: consider mapping split up regions to new most populous one (like CLDR). -func normRegion(r Region) Region { - m := regionOldMap - k := sort.Search(len(m), func(i int) bool { - return m[i].From >= uint16(r) - }) - if k < len(m) && m[k].From == uint16(r) { - return Region(m[k].To) - } - return 0 -} - -const ( - iso3166UserAssigned = 1 << iota - ccTLD - bcp47Region -) - -func (r Region) typ() byte { - return regionTypes[r] -} - -// String returns the BCP 47 representation for the region. -// It returns "ZZ" for an unspecified region. -func (r Region) String() string { - if r < isoRegionOffset { - if r == 0 { - return "ZZ" - } - return fmt.Sprintf("%03d", r.M49()) - } - r -= isoRegionOffset - return regionISO.Elem(int(r))[:2] -} - -// ISO3 returns the 3-letter ISO code of r. -// Note that not all regions have a 3-letter ISO code. -// In such cases this method returns "ZZZ". -func (r Region) ISO3() string { - if r < isoRegionOffset { - return "ZZZ" - } - r -= isoRegionOffset - reg := regionISO.Elem(int(r)) - switch reg[2] { - case 0: - return altRegionISO3[reg[3]:][:3] - case ' ': - return "ZZZ" - } - return reg[0:1] + reg[2:4] -} - -// M49 returns the UN M.49 encoding of r, or 0 if this encoding -// is not defined for r. -func (r Region) M49() int { - return int(m49[r]) -} - -// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This -// may include private-use tags that are assigned by CLDR and used in this -// implementation. So IsPrivateUse and IsCountry can be simultaneously true. -func (r Region) IsPrivateUse() bool { - return r.typ()&iso3166UserAssigned != 0 -} - -type Script uint16 - -// getScriptID returns the script id for string s. It assumes that s -// is of the format [A-Z][a-z]{3}. -func getScriptID(idx tag.Index, s []byte) (Script, error) { - i, err := findIndex(idx, s, "Zzzz") - return Script(i), err -} - -// String returns the script code in title case. -// It returns "Zzzz" for an unspecified script. -func (s Script) String() string { - if s == 0 { - return "Zzzz" - } - return script.Elem(int(s)) -} - -// IsPrivateUse reports whether this script code is reserved for private use. -func (s Script) IsPrivateUse() bool { - return _Qaaa <= s && s <= _Qabx -} - -const ( - maxAltTaglen = len("en-US-POSIX") - maxLen = maxAltTaglen -) - -var ( - // grandfatheredMap holds a mapping from legacy and grandfathered tags to - // their base language or index to more elaborate tag. - grandfatheredMap = map[[maxLen]byte]int16{ - [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban - [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami - [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn - [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak - [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon - [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux - [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo - [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn - [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao - [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay - [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu - [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok - [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL - [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE - [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu - [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan - [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang - - // Grandfathered tags with no modern replacement will be converted as - // follows: - [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish - [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed - [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default - [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian - [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min - - // CLDR-specific tag. - [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root - [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" - } - - altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} - - altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" -) - -func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { - if v, ok := grandfatheredMap[s]; ok { - if v < 0 { - return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true - } - t.LangID = Language(v) - return t, true - } - return t, false -} diff --git a/embed/vendor/golang.org/x/text/internal/language/match.go b/embed/vendor/golang.org/x/text/internal/language/match.go deleted file mode 100644 index 75a2dbca..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/match.go +++ /dev/null @@ -1,226 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import "errors" - -type scriptRegionFlags uint8 - -const ( - isList = 1 << iota - scriptInFrom - regionInFrom -) - -func (t *Tag) setUndefinedLang(id Language) { - if t.LangID == 0 { - t.LangID = id - } -} - -func (t *Tag) setUndefinedScript(id Script) { - if t.ScriptID == 0 { - t.ScriptID = id - } -} - -func (t *Tag) setUndefinedRegion(id Region) { - if t.RegionID == 0 || t.RegionID.Contains(id) { - t.RegionID = id - } -} - -// ErrMissingLikelyTagsData indicates no information was available -// to compute likely values of missing tags. -var ErrMissingLikelyTagsData = errors.New("missing likely tags data") - -// addLikelySubtags sets subtags to their most likely value, given the locale. -// In most cases this means setting fields for unknown values, but in some -// cases it may alter a value. It returns an ErrMissingLikelyTagsData error -// if the given locale cannot be expanded. -func (t Tag) addLikelySubtags() (Tag, error) { - id, err := addTags(t) - if err != nil { - return t, err - } else if id.equalTags(t) { - return t, nil - } - id.RemakeString() - return id, nil -} - -// specializeRegion attempts to specialize a group region. -func specializeRegion(t *Tag) bool { - if i := regionInclusion[t.RegionID]; i < nRegionGroups { - x := likelyRegionGroup[i] - if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { - t.RegionID = Region(x.region) - } - return true - } - return false -} - -// Maximize returns a new tag with missing tags filled in. -func (t Tag) Maximize() (Tag, error) { - return addTags(t) -} - -func addTags(t Tag) (Tag, error) { - // We leave private use identifiers alone. - if t.IsPrivateUse() { - return t, nil - } - if t.ScriptID != 0 && t.RegionID != 0 { - if t.LangID != 0 { - // already fully specified - specializeRegion(&t) - return t, nil - } - // Search matches for und-script-region. Note that for these cases - // region will never be a group so there is no need to check for this. - list := likelyRegion[t.RegionID : t.RegionID+1] - if x := list[0]; x.flags&isList != 0 { - list = likelyRegionList[x.lang : x.lang+uint16(x.script)] - } - for _, x := range list { - // Deviating from the spec. See match_test.go for details. - if Script(x.script) == t.ScriptID { - t.setUndefinedLang(Language(x.lang)) - return t, nil - } - } - } - if t.LangID != 0 { - // Search matches for lang-script and lang-region, where lang != und. - if t.LangID < langNoIndexOffset { - x := likelyLang[t.LangID] - if x.flags&isList != 0 { - list := likelyLangList[x.region : x.region+uint16(x.script)] - if t.ScriptID != 0 { - for _, x := range list { - if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { - t.setUndefinedRegion(Region(x.region)) - return t, nil - } - } - } else if t.RegionID != 0 { - count := 0 - goodScript := true - tt := t - for _, x := range list { - // We visit all entries for which the script was not - // defined, including the ones where the region was not - // defined. This allows for proper disambiguation within - // regions. - if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { - tt.RegionID = Region(x.region) - tt.setUndefinedScript(Script(x.script)) - goodScript = goodScript && tt.ScriptID == Script(x.script) - count++ - } - } - if count == 1 { - return tt, nil - } - // Even if we fail to find a unique Region, we might have - // an unambiguous script. - if goodScript { - t.ScriptID = tt.ScriptID - } - } - } - } - } else { - // Search matches for und-script. - if t.ScriptID != 0 { - x := likelyScript[t.ScriptID] - if x.region != 0 { - t.setUndefinedRegion(Region(x.region)) - t.setUndefinedLang(Language(x.lang)) - return t, nil - } - } - // Search matches for und-region. If und-script-region exists, it would - // have been found earlier. - if t.RegionID != 0 { - if i := regionInclusion[t.RegionID]; i < nRegionGroups { - x := likelyRegionGroup[i] - if x.region != 0 { - t.setUndefinedLang(Language(x.lang)) - t.setUndefinedScript(Script(x.script)) - t.RegionID = Region(x.region) - } - } else { - x := likelyRegion[t.RegionID] - if x.flags&isList != 0 { - x = likelyRegionList[x.lang] - } - if x.script != 0 && x.flags != scriptInFrom { - t.setUndefinedLang(Language(x.lang)) - t.setUndefinedScript(Script(x.script)) - return t, nil - } - } - } - } - - // Search matches for lang. - if t.LangID < langNoIndexOffset { - x := likelyLang[t.LangID] - if x.flags&isList != 0 { - x = likelyLangList[x.region] - } - if x.region != 0 { - t.setUndefinedScript(Script(x.script)) - t.setUndefinedRegion(Region(x.region)) - } - specializeRegion(&t) - if t.LangID == 0 { - t.LangID = _en // default language - } - return t, nil - } - return t, ErrMissingLikelyTagsData -} - -func (t *Tag) setTagsFrom(id Tag) { - t.LangID = id.LangID - t.ScriptID = id.ScriptID - t.RegionID = id.RegionID -} - -// minimize removes the region or script subtags from t such that -// t.addLikelySubtags() == t.minimize().addLikelySubtags(). -func (t Tag) minimize() (Tag, error) { - t, err := minimizeTags(t) - if err != nil { - return t, err - } - t.RemakeString() - return t, nil -} - -// minimizeTags mimics the behavior of the ICU 51 C implementation. -func minimizeTags(t Tag) (Tag, error) { - if t.equalTags(Und) { - return t, nil - } - max, err := addTags(t) - if err != nil { - return t, err - } - for _, id := range [...]Tag{ - {LangID: t.LangID}, - {LangID: t.LangID, RegionID: t.RegionID}, - {LangID: t.LangID, ScriptID: t.ScriptID}, - } { - if x, err := addTags(id); err == nil && max.equalTags(x) { - t.setTagsFrom(id) - break - } - } - return t, nil -} diff --git a/embed/vendor/golang.org/x/text/internal/language/parse.go b/embed/vendor/golang.org/x/text/internal/language/parse.go deleted file mode 100644 index aad1e0ac..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/parse.go +++ /dev/null @@ -1,608 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "errors" - "fmt" - "sort" - - "golang.org/x/text/internal/tag" -) - -// isAlpha returns true if the byte is not a digit. -// b must be an ASCII letter or digit. -func isAlpha(b byte) bool { - return b > '9' -} - -// isAlphaNum returns true if the string contains only ASCII letters or digits. -func isAlphaNum(s []byte) bool { - for _, c := range s { - if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { - return false - } - } - return true -} - -// ErrSyntax is returned by any of the parsing functions when the -// input is not well-formed, according to BCP 47. -// TODO: return the position at which the syntax error occurred? -var ErrSyntax = errors.New("language: tag is not well-formed") - -// ErrDuplicateKey is returned when a tag contains the same key twice with -// different values in the -u section. -var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") - -// ValueError is returned by any of the parsing functions when the -// input is well-formed but the respective subtag is not recognized -// as a valid value. -type ValueError struct { - v [8]byte -} - -// NewValueError creates a new ValueError. -func NewValueError(tag []byte) ValueError { - var e ValueError - copy(e.v[:], tag) - return e -} - -func (e ValueError) tag() []byte { - n := bytes.IndexByte(e.v[:], 0) - if n == -1 { - n = 8 - } - return e.v[:n] -} - -// Error implements the error interface. -func (e ValueError) Error() string { - return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) -} - -// Subtag returns the subtag for which the error occurred. -func (e ValueError) Subtag() string { - return string(e.tag()) -} - -// scanner is used to scan BCP 47 tokens, which are separated by _ or -. -type scanner struct { - b []byte - bytes [max99thPercentileSize]byte - token []byte - start int // start position of the current token - end int // end position of the current token - next int // next point for scan - err error - done bool -} - -func makeScannerString(s string) scanner { - scan := scanner{} - if len(s) <= len(scan.bytes) { - scan.b = scan.bytes[:copy(scan.bytes[:], s)] - } else { - scan.b = []byte(s) - } - scan.init() - return scan -} - -// makeScanner returns a scanner using b as the input buffer. -// b is not copied and may be modified by the scanner routines. -func makeScanner(b []byte) scanner { - scan := scanner{b: b} - scan.init() - return scan -} - -func (s *scanner) init() { - for i, c := range s.b { - if c == '_' { - s.b[i] = '-' - } - } - s.scan() -} - -// restToLower converts the string between start and end to lower case. -func (s *scanner) toLower(start, end int) { - for i := start; i < end; i++ { - c := s.b[i] - if 'A' <= c && c <= 'Z' { - s.b[i] += 'a' - 'A' - } - } -} - -func (s *scanner) setError(e error) { - if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { - s.err = e - } -} - -// resizeRange shrinks or grows the array at position oldStart such that -// a new string of size newSize can fit between oldStart and oldEnd. -// Sets the scan point to after the resized range. -func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { - s.start = oldStart - if end := oldStart + newSize; end != oldEnd { - diff := end - oldEnd - var b []byte - if n := len(s.b) + diff; n > cap(s.b) { - b = make([]byte, n) - copy(b, s.b[:oldStart]) - } else { - b = s.b[:n] - } - copy(b[end:], s.b[oldEnd:]) - s.b = b - s.next = end + (s.next - s.end) - s.end = end - } -} - -// replace replaces the current token with repl. -func (s *scanner) replace(repl string) { - s.resizeRange(s.start, s.end, len(repl)) - copy(s.b[s.start:], repl) -} - -// gobble removes the current token from the input. -// Caller must call scan after calling gobble. -func (s *scanner) gobble(e error) { - s.setError(e) - if s.start == 0 { - s.b = s.b[:+copy(s.b, s.b[s.next:])] - s.end = 0 - } else { - s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] - s.end = s.start - 1 - } - s.next = s.start -} - -// deleteRange removes the given range from s.b before the current token. -func (s *scanner) deleteRange(start, end int) { - s.b = s.b[:start+copy(s.b[start:], s.b[end:])] - diff := end - start - s.next -= diff - s.start -= diff - s.end -= diff -} - -// scan parses the next token of a BCP 47 string. Tokens that are larger -// than 8 characters or include non-alphanumeric characters result in an error -// and are gobbled and removed from the output. -// It returns the end position of the last token consumed. -func (s *scanner) scan() (end int) { - end = s.end - s.token = nil - for s.start = s.next; s.next < len(s.b); { - i := bytes.IndexByte(s.b[s.next:], '-') - if i == -1 { - s.end = len(s.b) - s.next = len(s.b) - i = s.end - s.start - } else { - s.end = s.next + i - s.next = s.end + 1 - } - token := s.b[s.start:s.end] - if i < 1 || i > 8 || !isAlphaNum(token) { - s.gobble(ErrSyntax) - continue - } - s.token = token - return end - } - if n := len(s.b); n > 0 && s.b[n-1] == '-' { - s.setError(ErrSyntax) - s.b = s.b[:len(s.b)-1] - } - s.done = true - return end -} - -// acceptMinSize parses multiple tokens of the given size or greater. -// It returns the end position of the last token consumed. -func (s *scanner) acceptMinSize(min int) (end int) { - end = s.end - s.scan() - for ; len(s.token) >= min; s.scan() { - end = s.end - } - return end -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -func Parse(s string) (t Tag, err error) { - // TODO: consider supporting old-style locale key-value pairs. - if s == "" { - return Und, ErrSyntax - } - defer func() { - if recover() != nil { - t = Und - err = ErrSyntax - return - } - }() - if len(s) <= maxAltTaglen { - b := [maxAltTaglen]byte{} - for i, c := range s { - // Generating invalid UTF-8 is okay as it won't match. - if 'A' <= c && c <= 'Z' { - c += 'a' - 'A' - } else if c == '_' { - c = '-' - } - b[i] = byte(c) - } - if t, ok := grandfathered(b); ok { - return t, nil - } - } - scan := makeScannerString(s) - return parse(&scan, s) -} - -func parse(scan *scanner, s string) (t Tag, err error) { - t = Und - var end int - if n := len(scan.token); n <= 1 { - scan.toLower(0, len(scan.b)) - if n == 0 || scan.token[0] != 'x' { - return t, ErrSyntax - } - end = parseExtensions(scan) - } else if n >= 4 { - return Und, ErrSyntax - } else { // the usual case - t, end = parseTag(scan, true) - if n := len(scan.token); n == 1 { - t.pExt = uint16(end) - end = parseExtensions(scan) - } else if end < len(scan.b) { - scan.setError(ErrSyntax) - scan.b = scan.b[:end] - } - } - if int(t.pVariant) < len(scan.b) { - if end < len(s) { - s = s[:end] - } - if len(s) > 0 && tag.Compare(s, scan.b) == 0 { - t.str = s - } else { - t.str = string(scan.b) - } - } else { - t.pVariant, t.pExt = 0, 0 - } - return t, scan.err -} - -// parseTag parses language, script, region and variants. -// It returns a Tag and the end position in the input that was parsed. -// If doNorm is true, then - will be normalized to . -func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { - var e error - // TODO: set an error if an unknown lang, script or region is encountered. - t.LangID, e = getLangID(scan.token) - scan.setError(e) - scan.replace(t.LangID.String()) - langStart := scan.start - end = scan.scan() - for len(scan.token) == 3 && isAlpha(scan.token[0]) { - // From http://tools.ietf.org/html/bcp47, - tags are equivalent - // to a tag of the form . - if doNorm { - lang, e := getLangID(scan.token) - if lang != 0 { - t.LangID = lang - langStr := lang.String() - copy(scan.b[langStart:], langStr) - scan.b[langStart+len(langStr)] = '-' - scan.start = langStart + len(langStr) + 1 - } - scan.gobble(e) - } - end = scan.scan() - } - if len(scan.token) == 4 && isAlpha(scan.token[0]) { - t.ScriptID, e = getScriptID(script, scan.token) - if t.ScriptID == 0 { - scan.gobble(e) - } - end = scan.scan() - } - if n := len(scan.token); n >= 2 && n <= 3 { - t.RegionID, e = getRegionID(scan.token) - if t.RegionID == 0 { - scan.gobble(e) - } else { - scan.replace(t.RegionID.String()) - } - end = scan.scan() - } - scan.toLower(scan.start, len(scan.b)) - t.pVariant = byte(end) - end = parseVariants(scan, end, t) - t.pExt = uint16(end) - return t, end -} - -var separator = []byte{'-'} - -// parseVariants scans tokens as long as each token is a valid variant string. -// Duplicate variants are removed. -func parseVariants(scan *scanner, end int, t Tag) int { - start := scan.start - varIDBuf := [4]uint8{} - variantBuf := [4][]byte{} - varID := varIDBuf[:0] - variant := variantBuf[:0] - last := -1 - needSort := false - for ; len(scan.token) >= 4; scan.scan() { - // TODO: measure the impact of needing this conversion and redesign - // the data structure if there is an issue. - v, ok := variantIndex[string(scan.token)] - if !ok { - // unknown variant - // TODO: allow user-defined variants? - scan.gobble(NewValueError(scan.token)) - continue - } - varID = append(varID, v) - variant = append(variant, scan.token) - if !needSort { - if last < int(v) { - last = int(v) - } else { - needSort = true - // There is no legal combinations of more than 7 variants - // (and this is by no means a useful sequence). - const maxVariants = 8 - if len(varID) > maxVariants { - break - } - } - } - end = scan.end - } - if needSort { - sort.Sort(variantsSort{varID, variant}) - k, l := 0, -1 - for i, v := range varID { - w := int(v) - if l == w { - // Remove duplicates. - continue - } - varID[k] = varID[i] - variant[k] = variant[i] - k++ - l = w - } - if str := bytes.Join(variant[:k], separator); len(str) == 0 { - end = start - 1 - } else { - scan.resizeRange(start, end, len(str)) - copy(scan.b[scan.start:], str) - end = scan.end - } - } - return end -} - -type variantsSort struct { - i []uint8 - v [][]byte -} - -func (s variantsSort) Len() int { - return len(s.i) -} - -func (s variantsSort) Swap(i, j int) { - s.i[i], s.i[j] = s.i[j], s.i[i] - s.v[i], s.v[j] = s.v[j], s.v[i] -} - -func (s variantsSort) Less(i, j int) bool { - return s.i[i] < s.i[j] -} - -type bytesSort struct { - b [][]byte - n int // first n bytes to compare -} - -func (b bytesSort) Len() int { - return len(b.b) -} - -func (b bytesSort) Swap(i, j int) { - b.b[i], b.b[j] = b.b[j], b.b[i] -} - -func (b bytesSort) Less(i, j int) bool { - for k := 0; k < b.n; k++ { - if b.b[i][k] == b.b[j][k] { - continue - } - return b.b[i][k] < b.b[j][k] - } - return false -} - -// parseExtensions parses and normalizes the extensions in the buffer. -// It returns the last position of scan.b that is part of any extension. -// It also trims scan.b to remove excess parts accordingly. -func parseExtensions(scan *scanner) int { - start := scan.start - exts := [][]byte{} - private := []byte{} - end := scan.end - for len(scan.token) == 1 { - extStart := scan.start - ext := scan.token[0] - end = parseExtension(scan) - extension := scan.b[extStart:end] - if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { - scan.setError(ErrSyntax) - end = extStart - continue - } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { - scan.b = scan.b[:end] - return end - } else if ext == 'x' { - private = extension - break - } - exts = append(exts, extension) - } - sort.Sort(bytesSort{exts, 1}) - if len(private) > 0 { - exts = append(exts, private) - } - scan.b = scan.b[:start] - if len(exts) > 0 { - scan.b = append(scan.b, bytes.Join(exts, separator)...) - } else if start > 0 { - // Strip trailing '-'. - scan.b = scan.b[:start-1] - } - return end -} - -// parseExtension parses a single extension and returns the position of -// the extension end. -func parseExtension(scan *scanner) int { - start, end := scan.start, scan.end - switch scan.token[0] { - case 'u': // https://www.ietf.org/rfc/rfc6067.txt - attrStart := end - scan.scan() - for last := []byte{}; len(scan.token) > 2; scan.scan() { - if bytes.Compare(scan.token, last) != -1 { - // Attributes are unsorted. Start over from scratch. - p := attrStart + 1 - scan.next = p - attrs := [][]byte{} - for scan.scan(); len(scan.token) > 2; scan.scan() { - attrs = append(attrs, scan.token) - end = scan.end - } - sort.Sort(bytesSort{attrs, 3}) - copy(scan.b[p:], bytes.Join(attrs, separator)) - break - } - last = scan.token - end = scan.end - } - // Scan key-type sequences. A key is of length 2 and may be followed - // by 0 or more "type" subtags from 3 to the maximum of 8 letters. - var last, key []byte - for attrEnd := end; len(scan.token) == 2; last = key { - key = scan.token - end = scan.end - for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { - end = scan.end - } - // TODO: check key value validity - if bytes.Compare(key, last) != 1 || scan.err != nil { - // We have an invalid key or the keys are not sorted. - // Start scanning keys from scratch and reorder. - p := attrEnd + 1 - scan.next = p - keys := [][]byte{} - for scan.scan(); len(scan.token) == 2; { - keyStart := scan.start - end = scan.end - for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { - end = scan.end - } - keys = append(keys, scan.b[keyStart:end]) - } - sort.Stable(bytesSort{keys, 2}) - if n := len(keys); n > 0 { - k := 0 - for i := 1; i < n; i++ { - if !bytes.Equal(keys[k][:2], keys[i][:2]) { - k++ - keys[k] = keys[i] - } else if !bytes.Equal(keys[k], keys[i]) { - scan.setError(ErrDuplicateKey) - } - } - keys = keys[:k+1] - } - reordered := bytes.Join(keys, separator) - if e := p + len(reordered); e < end { - scan.deleteRange(e, end) - end = e - } - copy(scan.b[p:], reordered) - break - } - } - case 't': // https://www.ietf.org/rfc/rfc6497.txt - scan.scan() - if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { - _, end = parseTag(scan, false) - scan.toLower(start, end) - } - for len(scan.token) == 2 && !isAlpha(scan.token[1]) { - end = scan.acceptMinSize(3) - } - case 'x': - end = scan.acceptMinSize(1) - default: - end = scan.acceptMinSize(2) - } - return end -} - -// getExtension returns the name, body and end position of the extension. -func getExtension(s string, p int) (end int, ext string) { - if s[p] == '-' { - p++ - } - if s[p] == 'x' { - return len(s), s[p:] - } - end = nextExtension(s, p) - return end, s[p:end] -} - -// nextExtension finds the next extension within the string, searching -// for the -- pattern from position p. -// In the fast majority of cases, language tags will have at most -// one extension and extensions tend to be small. -func nextExtension(s string, p int) int { - for n := len(s) - 3; p < n; { - if s[p] == '-' { - if s[p+2] == '-' { - return p - } - p += 3 - } else { - p++ - } - } - return len(s) -} diff --git a/embed/vendor/golang.org/x/text/internal/language/tables.go b/embed/vendor/golang.org/x/text/internal/language/tables.go deleted file mode 100644 index 14167e74..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/tables.go +++ /dev/null @@ -1,3494 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -import "golang.org/x/text/internal/tag" - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "32" - -const NumLanguages = 8798 - -const NumScripts = 261 - -const NumRegions = 358 - -type FromTo struct { - From uint16 - To uint16 -} - -const nonCanonicalUnd = 1201 -const ( - _af = 22 - _am = 39 - _ar = 58 - _az = 88 - _bg = 126 - _bn = 165 - _ca = 215 - _cs = 250 - _da = 257 - _de = 269 - _el = 310 - _en = 313 - _es = 318 - _et = 320 - _fa = 328 - _fi = 337 - _fil = 339 - _fr = 350 - _gu = 420 - _he = 444 - _hi = 446 - _hr = 465 - _hu = 469 - _hy = 471 - _id = 481 - _is = 504 - _it = 505 - _ja = 512 - _ka = 528 - _kk = 578 - _km = 586 - _kn = 593 - _ko = 596 - _ky = 650 - _lo = 696 - _lt = 704 - _lv = 711 - _mk = 767 - _ml = 772 - _mn = 779 - _mo = 784 - _mr = 795 - _ms = 799 - _mul = 806 - _my = 817 - _nb = 839 - _ne = 849 - _nl = 871 - _no = 879 - _pa = 925 - _pl = 947 - _pt = 960 - _ro = 988 - _ru = 994 - _sh = 1031 - _si = 1036 - _sk = 1042 - _sl = 1046 - _sq = 1073 - _sr = 1074 - _sv = 1092 - _sw = 1093 - _ta = 1104 - _te = 1121 - _th = 1131 - _tl = 1146 - _tn = 1152 - _tr = 1162 - _uk = 1198 - _ur = 1204 - _uz = 1212 - _vi = 1219 - _zh = 1321 - _zu = 1327 - _jbo = 515 - _ami = 1650 - _bnn = 2357 - _hak = 438 - _tlh = 14467 - _lb = 661 - _nv = 899 - _pwn = 12055 - _tao = 14188 - _tay = 14198 - _tsu = 14662 - _nn = 874 - _sfb = 13629 - _vgt = 15701 - _sgg = 13660 - _cmn = 3007 - _nan = 835 - _hsn = 467 -) - -const langPrivateStart = 0x2f72 - -const langPrivateEnd = 0x3179 - -// lang holds an alphabetically sorted list of ISO-639 language identifiers. -// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -// For 2-byte language identifiers, the two successive bytes have the following meaning: -// - if the first letter of the 2- and 3-letter ISO codes are the same: -// the second and third letter of the 3-letter ISO code. -// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -// -// For 3-byte language identifiers the 4th byte is 0. -const lang tag.Index = "" + // Size: 5324 bytes - "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + - "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + - "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + - "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + - "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + - "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + - "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + - "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + - "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + - "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + - "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + - "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + - "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + - "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + - "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + - "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + - "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + - "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + - "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + - "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + - "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + - "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + - "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + - "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + - "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + - "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + - "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + - "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + - "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + - "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + - "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + - "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + - "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + - "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + - "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + - "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + - "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + - "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + - "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + - "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + - "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + - "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + - "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + - "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + - "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + - "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + - "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + - "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + - "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + - "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + - "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + - "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + - "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + - "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + - "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + - "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + - "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + - "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + - "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + - "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + - "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + - "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + - "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + - "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + - "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + - "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + - "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + - "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + - "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + - "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + - "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + - "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + - "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + - "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + - "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + - "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + - "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + - "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + - "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + - "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + - "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + - "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + - "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + - "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + - "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + - "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + - "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + - "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + - "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + - "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + - "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + - "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + - "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + - "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + - "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + - "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + - "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + - "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + - "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + - "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + - "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + - "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + - "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + - "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + - "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + - "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + - "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + - "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + - "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + - "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + - "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + - "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + - "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + - "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + - "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + - "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + - "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + - "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + - "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + - "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + - "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + - "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + - "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + - "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" - -const langNoIndexOffset = 1330 - -// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -// in lookup tables. The language ids for these language codes are derived directly -// from the letters and are not consecutive. -// Size: 2197 bytes, 2197 elements -var langNoIndex = [2197]uint8{ - // Entry 0 - 3F - 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, - 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, - 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, - 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, - 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, - 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, - 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, - // Entry 40 - 7F - 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, - 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, - 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, - 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, - 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, - 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, - 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, - 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, - // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, - 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, - 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, - 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, - 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, - 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, - 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, - 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, - // Entry C0 - FF - 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, - 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, - 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, - 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, - 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, - // Entry 100 - 13F - 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, - 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, - 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, - 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, - 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, - 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, - 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, - // Entry 140 - 17F - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, - 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, - 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, - 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, - 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, - // Entry 180 - 1BF - 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, - 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, - 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, - 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, - 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, - // Entry 200 - 23F - 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, - 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, - 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, - 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, - 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, - 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, - // Entry 240 - 27F - 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, - 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, - 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, - 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, - 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, - // Entry 280 - 2BF - 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, - 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, - 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, - 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, - 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, - 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, - 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, - // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, - 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, - 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, - 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, - 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, - 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, - // Entry 300 - 33F - 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, - 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, - 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, - 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, - 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, - 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, - 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, - // Entry 340 - 37F - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, - 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, - 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, - 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, - 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, - 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, - 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, - 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, - // Entry 380 - 3BF - 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, - 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, - 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, - 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, - 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, - 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, - 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, - // Entry 3C0 - 3FF - 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, - 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, - 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, - 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, - 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, - 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, - // Entry 400 - 43F - 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, - 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, - 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, - 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, - 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, - 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, - 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, - 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, - // Entry 440 - 47F - 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, - 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, - 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, - 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, - 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, - 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd, - 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, - 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, - // Entry 480 - 4BF - 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, - 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, - 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, - 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, - // Entry 4C0 - 4FF - 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, - 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, - 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, - 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, - 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, - // Entry 500 - 53F - 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, - 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, - 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, - 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, - 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, - 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, - 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, - // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - // Entry 580 - 5BF - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, - 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, - 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, - 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, - 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, - // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, - 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, - 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, - 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, - 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, - // Entry 600 - 63F - 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, - 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, - 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, - 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, - 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, - 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, - 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, - 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, - // Entry 640 - 67F - 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, - 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, - 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98, - 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, - 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, - 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, - 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, - // Entry 680 - 6BF - 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, - 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, - 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, - 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, - 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, - // Entry 6C0 - 6FF - 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, - 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, - 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, - 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, - 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, - // Entry 700 - 73F - 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, - 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, - 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, - 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 740 - 77F - 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, - 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, - 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, - 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, - 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, - 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, - // Entry 780 - 7BF - 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, - 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, - 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, - 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, - 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, - // Entry 7C0 - 7FF - 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, - 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, - 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, - 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, - 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, - 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, - 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, - // Entry 800 - 83F - 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, - 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, - 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, - 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, - 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, - 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, - 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, - // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, - 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, - 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, - 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, - 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, - 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, - // Entry 880 - 8BF - 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, - 0x0a, 0x00, 0x80, 0x00, 0x00, -} - -// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -// to 2-letter language codes that cannot be derived using the method described above. -// Each 3-letter code is followed by its 1-byte langID. -const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" - -// altLangIndex is used to convert indexes in altLangISO3 to langIDs. -// Size: 12 bytes, 6 elements -var altLangIndex = [6]uint16{ - 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, -} - -// AliasMap maps langIDs to their suggested replacements. -// Size: 772 bytes, 193 elements -var AliasMap = [193]FromTo{ - 0: {From: 0x82, To: 0x88}, - 1: {From: 0x187, To: 0x1ae}, - 2: {From: 0x1f3, To: 0x1e1}, - 3: {From: 0x1fb, To: 0x1bc}, - 4: {From: 0x208, To: 0x512}, - 5: {From: 0x20f, To: 0x20e}, - 6: {From: 0x310, To: 0x3dc}, - 7: {From: 0x347, To: 0x36f}, - 8: {From: 0x407, To: 0x432}, - 9: {From: 0x47a, To: 0x153}, - 10: {From: 0x490, To: 0x451}, - 11: {From: 0x4a2, To: 0x21}, - 12: {From: 0x53e, To: 0x544}, - 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x62b, To: 0x34}, - 15: {From: 0x62f, To: 0x14}, - 16: {From: 0x630, To: 0x1eb1}, - 17: {From: 0x651, To: 0x431}, - 18: {From: 0x662, To: 0x431}, - 19: {From: 0x6ed, To: 0x3a}, - 20: {From: 0x6f8, To: 0x1d7}, - 21: {From: 0x709, To: 0x3625}, - 22: {From: 0x73e, To: 0x21a1}, - 23: {From: 0x7b3, To: 0x56}, - 24: {From: 0x7b9, To: 0x299b}, - 25: {From: 0x7c5, To: 0x58}, - 26: {From: 0x7e6, To: 0x145}, - 27: {From: 0x80c, To: 0x5a}, - 28: {From: 0x815, To: 0x8d}, - 29: {From: 0x87e, To: 0x810}, - 30: {From: 0x8a8, To: 0x8b7}, - 31: {From: 0x8c3, To: 0xee3}, - 32: {From: 0x8fa, To: 0x1dc}, - 33: {From: 0x9ef, To: 0x331}, - 34: {From: 0xa36, To: 0x2c5}, - 35: {From: 0xa3d, To: 0xbf}, - 36: {From: 0xabe, To: 0x3322}, - 37: {From: 0xb38, To: 0x529}, - 38: {From: 0xb75, To: 0x265a}, - 39: {From: 0xb7e, To: 0xbc3}, - 40: {From: 0xb9b, To: 0x44e}, - 41: {From: 0xbbc, To: 0x4229}, - 42: {From: 0xbbf, To: 0x529}, - 43: {From: 0xbfe, To: 0x2da7}, - 44: {From: 0xc2e, To: 0x3181}, - 45: {From: 0xcb9, To: 0xf3}, - 46: {From: 0xd08, To: 0xfa}, - 47: {From: 0xdc8, To: 0x11a}, - 48: {From: 0xdd7, To: 0x32d}, - 49: {From: 0xdf8, To: 0xdfb}, - 50: {From: 0xdfe, To: 0x531}, - 51: {From: 0xe01, To: 0xdf3}, - 52: {From: 0xedf, To: 0x205a}, - 53: {From: 0xee9, To: 0x222e}, - 54: {From: 0xeee, To: 0x2e9a}, - 55: {From: 0xf39, To: 0x367}, - 56: {From: 0x10d0, To: 0x140}, - 57: {From: 0x1104, To: 0x2d0}, - 58: {From: 0x11a0, To: 0x1ec}, - 59: {From: 0x1279, To: 0x21}, - 60: {From: 0x1424, To: 0x15e}, - 61: {From: 0x1470, To: 0x14e}, - 62: {From: 0x151f, To: 0xd9b}, - 63: {From: 0x1523, To: 0x390}, - 64: {From: 0x1532, To: 0x19f}, - 65: {From: 0x1580, To: 0x210}, - 66: {From: 0x1583, To: 0x10d}, - 67: {From: 0x15a3, To: 0x3caf}, - 68: {From: 0x1630, To: 0x222e}, - 69: {From: 0x166a, To: 0x19b}, - 70: {From: 0x16c8, To: 0x136}, - 71: {From: 0x1700, To: 0x29f8}, - 72: {From: 0x1718, To: 0x194}, - 73: {From: 0x1727, To: 0xf3f}, - 74: {From: 0x177a, To: 0x178}, - 75: {From: 0x1809, To: 0x17b6}, - 76: {From: 0x1816, To: 0x18f3}, - 77: {From: 0x188a, To: 0x436}, - 78: {From: 0x1979, To: 0x1d01}, - 79: {From: 0x1a74, To: 0x2bb0}, - 80: {From: 0x1a8a, To: 0x1f8}, - 81: {From: 0x1b5a, To: 0x1fa}, - 82: {From: 0x1b86, To: 0x1515}, - 83: {From: 0x1d64, To: 0x2c9b}, - 84: {From: 0x2038, To: 0x37b1}, - 85: {From: 0x203d, To: 0x20dd}, - 86: {From: 0x2042, To: 0x2e00}, - 87: {From: 0x205a, To: 0x30b}, - 88: {From: 0x20e3, To: 0x274}, - 89: {From: 0x20ee, To: 0x263}, - 90: {From: 0x20f2, To: 0x22d}, - 91: {From: 0x20f9, To: 0x256}, - 92: {From: 0x210f, To: 0x21eb}, - 93: {From: 0x2135, To: 0x27d}, - 94: {From: 0x2160, To: 0x913}, - 95: {From: 0x2199, To: 0x121}, - 96: {From: 0x21ce, To: 0x1561}, - 97: {From: 0x21e6, To: 0x504}, - 98: {From: 0x21f4, To: 0x49f}, - 99: {From: 0x21fb, To: 0x269}, - 100: {From: 0x222d, To: 0x121}, - 101: {From: 0x2237, To: 0x121}, - 102: {From: 0x2248, To: 0x217d}, - 103: {From: 0x2262, To: 0x92a}, - 104: {From: 0x2316, To: 0x3226}, - 105: {From: 0x236a, To: 0x2835}, - 106: {From: 0x2382, To: 0x3365}, - 107: {From: 0x2472, To: 0x2c7}, - 108: {From: 0x24e4, To: 0x2ff}, - 109: {From: 0x24f0, To: 0x2fa}, - 110: {From: 0x24fa, To: 0x31f}, - 111: {From: 0x2550, To: 0xb5b}, - 112: {From: 0x25a9, To: 0xe2}, - 113: {From: 0x263e, To: 0x2d0}, - 114: {From: 0x26c9, To: 0x26b4}, - 115: {From: 0x26f9, To: 0x3c8}, - 116: {From: 0x2727, To: 0x3caf}, - 117: {From: 0x2755, To: 0x6a4}, - 118: {From: 0x2765, To: 0x26b4}, - 119: {From: 0x2789, To: 0x4358}, - 120: {From: 0x27c9, To: 0x2001}, - 121: {From: 0x28ea, To: 0x27b1}, - 122: {From: 0x28ef, To: 0x2837}, - 123: {From: 0x28fe, To: 0xaa5}, - 124: {From: 0x2914, To: 0x351}, - 125: {From: 0x2986, To: 0x2da7}, - 126: {From: 0x29f0, To: 0x96b}, - 127: {From: 0x2b1a, To: 0x38d}, - 128: {From: 0x2bfc, To: 0x395}, - 129: {From: 0x2c3f, To: 0x3caf}, - 130: {From: 0x2ce1, To: 0x2201}, - 131: {From: 0x2cfc, To: 0x3be}, - 132: {From: 0x2d13, To: 0x597}, - 133: {From: 0x2d47, To: 0x148}, - 134: {From: 0x2d48, To: 0x148}, - 135: {From: 0x2dff, To: 0x2f1}, - 136: {From: 0x2e08, To: 0x19cc}, - 137: {From: 0x2e10, To: 0xc45}, - 138: {From: 0x2e1a, To: 0x2d95}, - 139: {From: 0x2e21, To: 0x292}, - 140: {From: 0x2e54, To: 0x7d}, - 141: {From: 0x2e65, To: 0x2282}, - 142: {From: 0x2e97, To: 0x1a4}, - 143: {From: 0x2ea0, To: 0x2e9b}, - 144: {From: 0x2eef, To: 0x2ed7}, - 145: {From: 0x3193, To: 0x3c4}, - 146: {From: 0x3366, To: 0x338e}, - 147: {From: 0x342a, To: 0x3dc}, - 148: {From: 0x34ee, To: 0x18d0}, - 149: {From: 0x35c8, To: 0x2c9b}, - 150: {From: 0x35e6, To: 0x412}, - 151: {From: 0x35f5, To: 0x24b}, - 152: {From: 0x360d, To: 0x1dc}, - 153: {From: 0x3658, To: 0x246}, - 154: {From: 0x3676, To: 0x3f4}, - 155: {From: 0x36fd, To: 0x445}, - 156: {From: 0x3747, To: 0x3b42}, - 157: {From: 0x37c0, To: 0x121}, - 158: {From: 0x3816, To: 0x38f2}, - 159: {From: 0x382a, To: 0x2b48}, - 160: {From: 0x382b, To: 0x2c9b}, - 161: {From: 0x382f, To: 0xa9}, - 162: {From: 0x3832, To: 0x3228}, - 163: {From: 0x386c, To: 0x39a6}, - 164: {From: 0x3892, To: 0x3fc0}, - 165: {From: 0x38a0, To: 0x45f}, - 166: {From: 0x38a5, To: 0x39d7}, - 167: {From: 0x38b4, To: 0x1fa4}, - 168: {From: 0x38b5, To: 0x2e9a}, - 169: {From: 0x38fa, To: 0x38f1}, - 170: {From: 0x395c, To: 0x47e}, - 171: {From: 0x3b4e, To: 0xd91}, - 172: {From: 0x3b78, To: 0x137}, - 173: {From: 0x3c99, To: 0x4bc}, - 174: {From: 0x3fbd, To: 0x100}, - 175: {From: 0x4208, To: 0xa91}, - 176: {From: 0x42be, To: 0x573}, - 177: {From: 0x42f9, To: 0x3f60}, - 178: {From: 0x4378, To: 0x25a}, - 179: {From: 0x43b8, To: 0xe6c}, - 180: {From: 0x43cd, To: 0x10f}, - 181: {From: 0x43d4, To: 0x4848}, - 182: {From: 0x44af, To: 0x3322}, - 183: {From: 0x44e3, To: 0x512}, - 184: {From: 0x45ca, To: 0x2409}, - 185: {From: 0x45dd, To: 0x26dc}, - 186: {From: 0x4610, To: 0x48ae}, - 187: {From: 0x46ae, To: 0x46a0}, - 188: {From: 0x473e, To: 0x4745}, - 189: {From: 0x4817, To: 0x3503}, - 190: {From: 0x483b, To: 0x208b}, - 191: {From: 0x4916, To: 0x31f}, - 192: {From: 0x49a7, To: 0x523}, -} - -// Size: 193 bytes, 193 elements -var AliasTypes = [193]AliasType{ - // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, - 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, - 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, - 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, - // Entry 40 - 7F - 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, - 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, - 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, - // Entry 80 - BF - 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, - 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, - 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, - 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, - // Entry C0 - FF - 1, -} - -const ( - _Latn = 91 - _Hani = 57 - _Hans = 59 - _Hant = 60 - _Qaaa = 149 - _Qaai = 157 - _Qabx = 198 - _Zinh = 255 - _Zyyy = 260 - _Zzzz = 261 -) - -// script is an alphabetically sorted list of ISO 15924 codes. The index -// of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1052 bytes - "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + - "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + - "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + - "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + - "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + - "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + - "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + - "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + - "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + - "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + - "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + - "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + - "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + - "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" - -// suppressScript is an index from langID to the dominant script for that language, -// if it exists. If a script is given, it should be suppressed from the language tag. -// Size: 1330 bytes, 1330 elements -var suppressScript = [1330]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 40 - 7F - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 100 - 13F - 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, - // Entry 140 - 17F - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 180 - 1BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, - // Entry 200 - 23F - 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 280 - 2BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 2C0 - 2FF - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, - // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, - // Entry 3C0 - 3FF - 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 400 - 43F - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, - // Entry 480 - 4BF - 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 4C0 - 4FF - 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 500 - 53F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, -} - -const ( - _001 = 1 - _419 = 31 - _BR = 65 - _CA = 73 - _ES = 111 - _GB = 124 - _MD = 189 - _PT = 239 - _UK = 307 - _US = 310 - _ZZ = 358 - _XA = 324 - _XC = 326 - _XK = 334 -) - -// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -// the UN.M49 codes used for groups.) -const isoRegionOffset = 32 - -// regionTypes defines the status of a region for various standards. -// Size: 359 bytes, 359 elements -var regionTypes = [359]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 40 - 7F - 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, - 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 80 - BF - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry C0 - FF - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - // Entry 100 - 13F - 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - // Entry 140 - 17F - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, -} - -// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -// Each 2-letter codes is followed by two bytes with the following meaning: -// - [A-Z}{2}: the first letter of the 2-letter code plus these two -// letters form the 3-letter ISO code. -// - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1312 bytes - "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + - "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + - "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + - "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + - "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + - "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + - "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + - "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + - "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + - "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + - "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + - "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + - "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + - "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + - "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + - "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + - "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + - "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + - "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" - -// altRegionISO3 holds a list of 3-letter region codes that cannot be -// mapped to 2-letter codes using the default algorithm. This is a short list. -const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" - -// altRegionIDs holds a list of regionIDs the positions of which match those -// of the 3-letter ISO codes in altRegionISO3. -// Size: 22 bytes, 11 elements -var altRegionIDs = [11]uint16{ - 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, - 0x0122, 0x0160, 0x00dd, -} - -// Size: 80 bytes, 20 elements -var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc5}, - 1: {From: 0x59, To: 0xa8}, - 2: {From: 0x60, To: 0x61}, - 3: {From: 0x67, To: 0x3b}, - 4: {From: 0x7a, To: 0x79}, - 5: {From: 0x94, To: 0x37}, - 6: {From: 0xa4, To: 0x134}, - 7: {From: 0xc2, To: 0x134}, - 8: {From: 0xd8, To: 0x140}, - 9: {From: 0xdd, To: 0x2b}, - 10: {From: 0xf0, To: 0x134}, - 11: {From: 0xf3, To: 0xe3}, - 12: {From: 0xfd, To: 0x71}, - 13: {From: 0x104, To: 0x165}, - 14: {From: 0x12b, To: 0x127}, - 15: {From: 0x133, To: 0x7c}, - 16: {From: 0x13b, To: 0x13f}, - 17: {From: 0x142, To: 0x134}, - 18: {From: 0x15e, To: 0x15f}, - 19: {From: 0x164, To: 0x4b}, -} - -// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -// codes indicating collections of regions. -// Size: 718 bytes, 359 elements -var m49 = [359]int16{ - // Entry 0 - 3F - 0, 1, 2, 3, 5, 9, 11, 13, - 14, 15, 17, 18, 19, 21, 29, 30, - 34, 35, 39, 53, 54, 57, 61, 142, - 143, 145, 150, 151, 154, 155, 202, 419, - 958, 0, 20, 784, 4, 28, 660, 8, - 51, 530, 24, 10, 32, 16, 40, 36, - 533, 248, 31, 70, 52, 50, 56, 854, - 100, 48, 108, 204, 652, 60, 96, 68, - // Entry 40 - 7F - 535, 76, 44, 64, 104, 74, 72, 112, - 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 0, 188, - 891, 296, 192, 132, 531, 162, 196, 203, - 278, 276, 0, 262, 208, 212, 214, 204, - 12, 0, 218, 233, 818, 732, 232, 724, - 231, 967, 0, 246, 242, 238, 583, 234, - 0, 250, 249, 266, 826, 308, 268, 254, - // Entry 80 - BF - 831, 288, 292, 304, 270, 324, 312, 226, - 300, 239, 320, 316, 624, 328, 344, 334, - 340, 191, 332, 348, 854, 0, 360, 372, - 376, 833, 356, 86, 368, 364, 352, 380, - 832, 388, 400, 392, 581, 404, 417, 116, - 296, 174, 659, 408, 410, 414, 136, 398, - 418, 422, 662, 438, 144, 430, 426, 440, - 442, 428, 434, 504, 492, 498, 499, 663, - // Entry C0 - FF - 450, 584, 581, 807, 466, 104, 496, 446, - 580, 474, 478, 500, 470, 480, 462, 454, - 484, 458, 508, 516, 540, 562, 574, 566, - 548, 558, 528, 578, 524, 10, 520, 536, - 570, 554, 512, 591, 0, 604, 258, 598, - 608, 586, 616, 666, 612, 630, 275, 620, - 581, 585, 600, 591, 634, 959, 960, 961, - 962, 963, 964, 965, 966, 967, 968, 969, - // Entry 100 - 13F - 970, 971, 972, 638, 716, 642, 688, 643, - 646, 682, 90, 690, 729, 752, 702, 654, - 705, 744, 703, 694, 674, 686, 706, 740, - 728, 678, 810, 222, 534, 760, 748, 0, - 796, 148, 260, 768, 764, 762, 772, 626, - 795, 788, 776, 626, 792, 780, 798, 158, - 834, 804, 800, 826, 581, 0, 840, 858, - 860, 336, 670, 704, 862, 92, 850, 704, - // Entry 140 - 17F - 548, 876, 581, 882, 973, 974, 975, 976, - 977, 978, 979, 980, 981, 982, 983, 984, - 985, 986, 987, 988, 989, 990, 991, 992, - 993, 994, 995, 996, 997, 998, 720, 887, - 175, 891, 710, 894, 180, 716, 999, -} - -// m49Index gives indexes into fromM49 based on the three most significant bits -// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in -// -// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -// -// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -// The region code is stored in the 9 lsb of the indexed value. -// Size: 18 bytes, 9 elements -var m49Index = [9]int16{ - 0, 59, 108, 143, 181, 220, 259, 291, - 333, -} - -// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. -// Size: 666 bytes, 333 elements -var fromM49 = [333]uint16{ - // Entry 0 - 3F - 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, - 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, - 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, - 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, - 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, - 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, - // Entry 40 - 7F - 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, - 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, - 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, - 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, - 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, - 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, - 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, - // Entry 80 - BF - 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, - 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, - 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, - 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, - 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, - 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, - 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, - 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, - // Entry C0 - FF - 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, - 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, - 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, - 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, - 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, - 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, - 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, - 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, - // Entry 100 - 13F - 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, - 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, - 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, - 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, - 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, - 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, - 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, - 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, - // Entry 140 - 17F - 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, - 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, -} - -// Size: 2128 bytes -var variantIndex = map[string]uint8{ - "1606nict": 0x0, - "1694acad": 0x1, - "1901": 0x2, - "1959acad": 0x3, - "1994": 0x67, - "1996": 0x4, - "abl1943": 0x5, - "akuapem": 0x6, - "alalc97": 0x69, - "aluku": 0x7, - "ao1990": 0x8, - "aranes": 0x9, - "arevela": 0xa, - "arevmda": 0xb, - "arkaika": 0xc, - "asante": 0xd, - "auvern": 0xe, - "baku1926": 0xf, - "balanka": 0x10, - "barla": 0x11, - "basiceng": 0x12, - "bauddha": 0x13, - "bciav": 0x14, - "bcizbl": 0x15, - "biscayan": 0x16, - "biske": 0x62, - "bohoric": 0x17, - "boont": 0x18, - "bornholm": 0x19, - "cisaup": 0x1a, - "colb1945": 0x1b, - "cornu": 0x1c, - "creiss": 0x1d, - "dajnko": 0x1e, - "ekavsk": 0x1f, - "emodeng": 0x20, - "fonipa": 0x6a, - "fonkirsh": 0x6b, - "fonnapa": 0x6c, - "fonupa": 0x6d, - "fonxsamp": 0x6e, - "gallo": 0x21, - "gascon": 0x22, - "grclass": 0x23, - "grital": 0x24, - "grmistr": 0x25, - "hepburn": 0x26, - "heploc": 0x68, - "hognorsk": 0x27, - "hsistemo": 0x28, - "ijekavsk": 0x29, - "itihasa": 0x2a, - "ivanchov": 0x2b, - "jauer": 0x2c, - "jyutping": 0x2d, - "kkcor": 0x2e, - "kociewie": 0x2f, - "kscor": 0x30, - "laukika": 0x31, - "lemosin": 0x32, - "lengadoc": 0x33, - "lipaw": 0x63, - "ltg1929": 0x34, - "ltg2007": 0x35, - "luna1918": 0x36, - "metelko": 0x37, - "monoton": 0x38, - "ndyuka": 0x39, - "nedis": 0x3a, - "newfound": 0x3b, - "nicard": 0x3c, - "njiva": 0x64, - "nulik": 0x3d, - "osojs": 0x65, - "oxendict": 0x3e, - "pahawh2": 0x3f, - "pahawh3": 0x40, - "pahawh4": 0x41, - "pamaka": 0x42, - "peano": 0x43, - "petr1708": 0x44, - "pinyin": 0x45, - "polyton": 0x46, - "provenc": 0x47, - "puter": 0x48, - "rigik": 0x49, - "rozaj": 0x4a, - "rumgr": 0x4b, - "scotland": 0x4c, - "scouse": 0x4d, - "simple": 0x6f, - "solba": 0x66, - "sotav": 0x4e, - "spanglis": 0x4f, - "surmiran": 0x50, - "sursilv": 0x51, - "sutsilv": 0x52, - "synnejyl": 0x53, - "tarask": 0x54, - "tongyong": 0x55, - "tunumiit": 0x56, - "uccor": 0x57, - "ucrcor": 0x58, - "ulster": 0x59, - "unifon": 0x5a, - "vaidika": 0x5b, - "valencia": 0x5c, - "vallader": 0x5d, - "vecdruka": 0x5e, - "vivaraup": 0x5f, - "wadegile": 0x60, - "xsistemo": 0x61, -} - -// variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 105 - -// nRegionGroups is the number of region groups. -const nRegionGroups = 33 - -type likelyLangRegion struct { - lang uint16 - region uint16 -} - -// likelyScript is a lookup table, indexed by scriptID, for the most likely -// languages and regions given a script. -// Size: 1052 bytes, 263 elements -var likelyScript = [263]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x85}, - 3: {lang: 0x2a2, region: 0x107}, - 4: {lang: 0x1f, region: 0x9a}, - 5: {lang: 0x3a, region: 0x6c}, - 7: {lang: 0x3b, region: 0x9d}, - 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9d}, - 10: {lang: 0x5b, region: 0x96}, - 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb5}, - 13: {lang: 0x63, region: 0x96}, - 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x9a}, - 17: {lang: 0x529, region: 0x12f}, - 18: {lang: 0x3b1, region: 0x9a}, - 19: {lang: 0x15e, region: 0x79}, - 20: {lang: 0xc2, region: 0x96}, - 21: {lang: 0x9d, region: 0xe8}, - 22: {lang: 0xdb, region: 0x35}, - 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12c}, - 25: {lang: 0xe7, region: 0x13f}, - 26: {lang: 0xe5, region: 0x136}, - 29: {lang: 0xf1, region: 0x6c}, - 31: {lang: 0x1a0, region: 0x5e}, - 32: {lang: 0x3e2, region: 0x107}, - 34: {lang: 0x1be, region: 0x9a}, - 38: {lang: 0x15e, region: 0x79}, - 41: {lang: 0x133, region: 0x6c}, - 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x70}, - 46: {lang: 0x210, region: 0x7e}, - 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x9a}, - 50: {lang: 0x19e, region: 0x131}, - 51: {lang: 0x3e9, region: 0x9a}, - 52: {lang: 0x136, region: 0x88}, - 53: {lang: 0x1a4, region: 0x9a}, - 54: {lang: 0x39d, region: 0x9a}, - 55: {lang: 0x529, region: 0x12f}, - 56: {lang: 0x254, region: 0xac}, - 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe8}, - 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12f}, - 61: {lang: 0x2fd, region: 0x9c}, - 62: {lang: 0x1bc, region: 0x98}, - 63: {lang: 0x200, region: 0xa3}, - 64: {lang: 0x1c5, region: 0x12c}, - 65: {lang: 0x1ca, region: 0xb0}, - 68: {lang: 0x1d5, region: 0x93}, - 70: {lang: 0x142, region: 0x9f}, - 71: {lang: 0x254, region: 0xac}, - 72: {lang: 0x20e, region: 0x96}, - 73: {lang: 0x200, region: 0xa3}, - 75: {lang: 0x135, region: 0xc5}, - 76: {lang: 0x200, region: 0xa3}, - 78: {lang: 0x3bb, region: 0xe9}, - 79: {lang: 0x24a, region: 0xa7}, - 80: {lang: 0x3fa, region: 0x9a}, - 83: {lang: 0x251, region: 0x9a}, - 84: {lang: 0x254, region: 0xac}, - 86: {lang: 0x88, region: 0x9a}, - 87: {lang: 0x370, region: 0x124}, - 88: {lang: 0x2b8, region: 0xb0}, - 93: {lang: 0x29f, region: 0x9a}, - 94: {lang: 0x2a8, region: 0x9a}, - 95: {lang: 0x28f, region: 0x88}, - 96: {lang: 0x1a0, region: 0x88}, - 97: {lang: 0x2ac, region: 0x53}, - 99: {lang: 0x4f4, region: 0x12c}, - 100: {lang: 0x4f5, region: 0x12c}, - 101: {lang: 0x1be, region: 0x9a}, - 103: {lang: 0x337, region: 0x9d}, - 104: {lang: 0x4f7, region: 0x53}, - 105: {lang: 0xa9, region: 0x53}, - 108: {lang: 0x2e8, region: 0x113}, - 109: {lang: 0x4f8, region: 0x10c}, - 110: {lang: 0x4f8, region: 0x10c}, - 111: {lang: 0x304, region: 0x9a}, - 112: {lang: 0x31b, region: 0x9a}, - 113: {lang: 0x30b, region: 0x53}, - 115: {lang: 0x31e, region: 0x35}, - 116: {lang: 0x30e, region: 0x9a}, - 117: {lang: 0x414, region: 0xe9}, - 118: {lang: 0x331, region: 0xc5}, - 121: {lang: 0x4f9, region: 0x109}, - 122: {lang: 0x3b, region: 0xa2}, - 123: {lang: 0x353, region: 0xdc}, - 126: {lang: 0x2d0, region: 0x85}, - 127: {lang: 0x52a, region: 0x53}, - 128: {lang: 0x403, region: 0x97}, - 129: {lang: 0x3ee, region: 0x9a}, - 130: {lang: 0x39b, region: 0xc6}, - 131: {lang: 0x395, region: 0x9a}, - 132: {lang: 0x399, region: 0x136}, - 133: {lang: 0x429, region: 0x116}, - 135: {lang: 0x3b, region: 0x11d}, - 136: {lang: 0xfd, region: 0xc5}, - 139: {lang: 0x27d, region: 0x107}, - 140: {lang: 0x2c9, region: 0x53}, - 141: {lang: 0x39f, region: 0x9d}, - 142: {lang: 0x39f, region: 0x53}, - 144: {lang: 0x3ad, region: 0xb1}, - 146: {lang: 0x1c6, region: 0x53}, - 147: {lang: 0x4fd, region: 0x9d}, - 200: {lang: 0x3cb, region: 0x96}, - 203: {lang: 0x372, region: 0x10d}, - 204: {lang: 0x420, region: 0x98}, - 206: {lang: 0x4ff, region: 0x15f}, - 207: {lang: 0x3f0, region: 0x9a}, - 208: {lang: 0x45, region: 0x136}, - 209: {lang: 0x139, region: 0x7c}, - 210: {lang: 0x3e9, region: 0x9a}, - 212: {lang: 0x3e9, region: 0x9a}, - 213: {lang: 0x3fa, region: 0x9a}, - 214: {lang: 0x40c, region: 0xb4}, - 217: {lang: 0x433, region: 0x9a}, - 218: {lang: 0xef, region: 0xc6}, - 219: {lang: 0x43e, region: 0x96}, - 221: {lang: 0x44d, region: 0x35}, - 222: {lang: 0x44e, region: 0x9c}, - 226: {lang: 0x45a, region: 0xe8}, - 227: {lang: 0x11a, region: 0x9a}, - 228: {lang: 0x45e, region: 0x53}, - 229: {lang: 0x232, region: 0x53}, - 230: {lang: 0x450, region: 0x9a}, - 231: {lang: 0x4a5, region: 0x53}, - 232: {lang: 0x9f, region: 0x13f}, - 233: {lang: 0x461, region: 0x9a}, - 235: {lang: 0x528, region: 0xbb}, - 236: {lang: 0x153, region: 0xe8}, - 237: {lang: 0x128, region: 0xce}, - 238: {lang: 0x46b, region: 0x124}, - 239: {lang: 0xa9, region: 0x53}, - 240: {lang: 0x2ce, region: 0x9a}, - 243: {lang: 0x4ad, region: 0x11d}, - 244: {lang: 0x4be, region: 0xb5}, - 247: {lang: 0x1ce, region: 0x9a}, - 250: {lang: 0x3a9, region: 0x9d}, - 251: {lang: 0x22, region: 0x9c}, - 253: {lang: 0x1ea, region: 0x53}, - 254: {lang: 0xef, region: 0xc6}, -} - -type likelyScriptRegion struct { - region uint16 - script uint16 - flags uint8 -} - -// likelyLang is a lookup table, indexed by langID, for the most likely -// scripts and regions given incomplete information. If more entries exist for a -// given language, region and script are the index and size respectively -// of the list in likelyLangList. -// Size: 7980 bytes, 1330 elements -var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x136, script: 0x5b, flags: 0x0}, - 1: {region: 0x70, script: 0x5b, flags: 0x0}, - 2: {region: 0x166, script: 0x5b, flags: 0x0}, - 3: {region: 0x166, script: 0x5b, flags: 0x0}, - 4: {region: 0x166, script: 0x5b, flags: 0x0}, - 5: {region: 0x7e, script: 0x20, flags: 0x0}, - 6: {region: 0x166, script: 0x5b, flags: 0x0}, - 7: {region: 0x166, script: 0x20, flags: 0x0}, - 8: {region: 0x81, script: 0x5b, flags: 0x0}, - 9: {region: 0x166, script: 0x5b, flags: 0x0}, - 10: {region: 0x166, script: 0x5b, flags: 0x0}, - 11: {region: 0x166, script: 0x5b, flags: 0x0}, - 12: {region: 0x96, script: 0x5b, flags: 0x0}, - 13: {region: 0x132, script: 0x5b, flags: 0x0}, - 14: {region: 0x81, script: 0x5b, flags: 0x0}, - 15: {region: 0x166, script: 0x5b, flags: 0x0}, - 16: {region: 0x166, script: 0x5b, flags: 0x0}, - 17: {region: 0x107, script: 0x20, flags: 0x0}, - 18: {region: 0x166, script: 0x5b, flags: 0x0}, - 19: {region: 0x9d, script: 0x9, flags: 0x0}, - 20: {region: 0x129, script: 0x5, flags: 0x0}, - 21: {region: 0x166, script: 0x5b, flags: 0x0}, - 22: {region: 0x162, script: 0x5b, flags: 0x0}, - 23: {region: 0x166, script: 0x5b, flags: 0x0}, - 24: {region: 0x166, script: 0x5b, flags: 0x0}, - 25: {region: 0x166, script: 0x5b, flags: 0x0}, - 26: {region: 0x166, script: 0x5b, flags: 0x0}, - 27: {region: 0x166, script: 0x5b, flags: 0x0}, - 28: {region: 0x52, script: 0x5b, flags: 0x0}, - 29: {region: 0x166, script: 0x5b, flags: 0x0}, - 30: {region: 0x166, script: 0x5b, flags: 0x0}, - 31: {region: 0x9a, script: 0x4, flags: 0x0}, - 32: {region: 0x166, script: 0x5b, flags: 0x0}, - 33: {region: 0x81, script: 0x5b, flags: 0x0}, - 34: {region: 0x9c, script: 0xfb, flags: 0x0}, - 35: {region: 0x166, script: 0x5b, flags: 0x0}, - 36: {region: 0x166, script: 0x5b, flags: 0x0}, - 37: {region: 0x14e, script: 0x5b, flags: 0x0}, - 38: {region: 0x107, script: 0x20, flags: 0x0}, - 39: {region: 0x70, script: 0x2c, flags: 0x0}, - 40: {region: 0x166, script: 0x5b, flags: 0x0}, - 41: {region: 0x166, script: 0x5b, flags: 0x0}, - 42: {region: 0xd7, script: 0x5b, flags: 0x0}, - 43: {region: 0x166, script: 0x5b, flags: 0x0}, - 45: {region: 0x166, script: 0x5b, flags: 0x0}, - 46: {region: 0x166, script: 0x5b, flags: 0x0}, - 47: {region: 0x166, script: 0x5b, flags: 0x0}, - 48: {region: 0x166, script: 0x5b, flags: 0x0}, - 49: {region: 0x166, script: 0x5b, flags: 0x0}, - 50: {region: 0x166, script: 0x5b, flags: 0x0}, - 51: {region: 0x96, script: 0x5b, flags: 0x0}, - 52: {region: 0x166, script: 0x5, flags: 0x0}, - 53: {region: 0x123, script: 0x5, flags: 0x0}, - 54: {region: 0x166, script: 0x5b, flags: 0x0}, - 55: {region: 0x166, script: 0x5b, flags: 0x0}, - 56: {region: 0x166, script: 0x5b, flags: 0x0}, - 57: {region: 0x166, script: 0x5b, flags: 0x0}, - 58: {region: 0x6c, script: 0x5, flags: 0x0}, - 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x166, script: 0x5b, flags: 0x0}, - 61: {region: 0x51, script: 0x5b, flags: 0x0}, - 62: {region: 0x3f, script: 0x5b, flags: 0x0}, - 63: {region: 0x68, script: 0x5, flags: 0x0}, - 65: {region: 0xbb, script: 0x5, flags: 0x0}, - 66: {region: 0x6c, script: 0x5, flags: 0x0}, - 67: {region: 0x9a, script: 0xe, flags: 0x0}, - 68: {region: 0x130, script: 0x5b, flags: 0x0}, - 69: {region: 0x136, script: 0xd0, flags: 0x0}, - 70: {region: 0x166, script: 0x5b, flags: 0x0}, - 71: {region: 0x166, script: 0x5b, flags: 0x0}, - 72: {region: 0x6f, script: 0x5b, flags: 0x0}, - 73: {region: 0x166, script: 0x5b, flags: 0x0}, - 74: {region: 0x166, script: 0x5b, flags: 0x0}, - 75: {region: 0x49, script: 0x5b, flags: 0x0}, - 76: {region: 0x166, script: 0x5b, flags: 0x0}, - 77: {region: 0x107, script: 0x20, flags: 0x0}, - 78: {region: 0x166, script: 0x5, flags: 0x0}, - 79: {region: 0x166, script: 0x5b, flags: 0x0}, - 80: {region: 0x166, script: 0x5b, flags: 0x0}, - 81: {region: 0x166, script: 0x5b, flags: 0x0}, - 82: {region: 0x9a, script: 0x22, flags: 0x0}, - 83: {region: 0x166, script: 0x5b, flags: 0x0}, - 84: {region: 0x166, script: 0x5b, flags: 0x0}, - 85: {region: 0x166, script: 0x5b, flags: 0x0}, - 86: {region: 0x3f, script: 0x5b, flags: 0x0}, - 87: {region: 0x166, script: 0x5b, flags: 0x0}, - 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x107, script: 0x20, flags: 0x0}, - 90: {region: 0xe9, script: 0x5, flags: 0x0}, - 91: {region: 0x96, script: 0x5b, flags: 0x0}, - 92: {region: 0xdc, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5b, flags: 0x0}, - 94: {region: 0x52, script: 0x5b, flags: 0x0}, - 95: {region: 0x166, script: 0x5b, flags: 0x0}, - 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x166, script: 0x5b, flags: 0x0}, - 98: {region: 0x166, script: 0x5b, flags: 0x0}, - 99: {region: 0x96, script: 0x5b, flags: 0x0}, - 100: {region: 0x166, script: 0x5b, flags: 0x0}, - 101: {region: 0x52, script: 0x5b, flags: 0x0}, - 102: {region: 0x166, script: 0x5b, flags: 0x0}, - 103: {region: 0x166, script: 0x5b, flags: 0x0}, - 104: {region: 0x166, script: 0x5b, flags: 0x0}, - 105: {region: 0x166, script: 0x5b, flags: 0x0}, - 106: {region: 0x4f, script: 0x5b, flags: 0x0}, - 107: {region: 0x166, script: 0x5b, flags: 0x0}, - 108: {region: 0x166, script: 0x5b, flags: 0x0}, - 109: {region: 0x166, script: 0x5b, flags: 0x0}, - 110: {region: 0x166, script: 0x2c, flags: 0x0}, - 111: {region: 0x166, script: 0x5b, flags: 0x0}, - 112: {region: 0x166, script: 0x5b, flags: 0x0}, - 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x166, script: 0x5b, flags: 0x0}, - 115: {region: 0x166, script: 0x5b, flags: 0x0}, - 116: {region: 0x10c, script: 0x5, flags: 0x0}, - 117: {region: 0x163, script: 0x5b, flags: 0x0}, - 118: {region: 0x166, script: 0x5b, flags: 0x0}, - 119: {region: 0x96, script: 0x5b, flags: 0x0}, - 120: {region: 0x166, script: 0x5b, flags: 0x0}, - 121: {region: 0x130, script: 0x5b, flags: 0x0}, - 122: {region: 0x52, script: 0x5b, flags: 0x0}, - 123: {region: 0x9a, script: 0xe6, flags: 0x0}, - 124: {region: 0xe9, script: 0x5, flags: 0x0}, - 125: {region: 0x9a, script: 0x22, flags: 0x0}, - 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x9a, script: 0x22, flags: 0x0}, - 128: {region: 0xe9, script: 0x5, flags: 0x0}, - 129: {region: 0x12c, script: 0x34, flags: 0x0}, - 131: {region: 0x9a, script: 0x22, flags: 0x0}, - 132: {region: 0x166, script: 0x5b, flags: 0x0}, - 133: {region: 0x9a, script: 0x22, flags: 0x0}, - 134: {region: 0xe8, script: 0x5b, flags: 0x0}, - 135: {region: 0x166, script: 0x5b, flags: 0x0}, - 136: {region: 0x9a, script: 0x22, flags: 0x0}, - 137: {region: 0x166, script: 0x5b, flags: 0x0}, - 138: {region: 0x140, script: 0x5b, flags: 0x0}, - 139: {region: 0x166, script: 0x5b, flags: 0x0}, - 140: {region: 0x166, script: 0x5b, flags: 0x0}, - 141: {region: 0xe8, script: 0x5b, flags: 0x0}, - 142: {region: 0x166, script: 0x5b, flags: 0x0}, - 143: {region: 0xd7, script: 0x5b, flags: 0x0}, - 144: {region: 0x166, script: 0x5b, flags: 0x0}, - 145: {region: 0x166, script: 0x5b, flags: 0x0}, - 146: {region: 0x166, script: 0x5b, flags: 0x0}, - 147: {region: 0x166, script: 0x2c, flags: 0x0}, - 148: {region: 0x9a, script: 0x22, flags: 0x0}, - 149: {region: 0x96, script: 0x5b, flags: 0x0}, - 150: {region: 0x166, script: 0x5b, flags: 0x0}, - 151: {region: 0x166, script: 0x5b, flags: 0x0}, - 152: {region: 0x115, script: 0x5b, flags: 0x0}, - 153: {region: 0x166, script: 0x5b, flags: 0x0}, - 154: {region: 0x166, script: 0x5b, flags: 0x0}, - 155: {region: 0x52, script: 0x5b, flags: 0x0}, - 156: {region: 0x166, script: 0x5b, flags: 0x0}, - 157: {region: 0xe8, script: 0x5b, flags: 0x0}, - 158: {region: 0x166, script: 0x5b, flags: 0x0}, - 159: {region: 0x13f, script: 0xe8, flags: 0x0}, - 160: {region: 0xc4, script: 0x5b, flags: 0x0}, - 161: {region: 0x166, script: 0x5b, flags: 0x0}, - 162: {region: 0x166, script: 0x5b, flags: 0x0}, - 163: {region: 0xc4, script: 0x5b, flags: 0x0}, - 164: {region: 0x166, script: 0x5b, flags: 0x0}, - 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x166, script: 0x5b, flags: 0x0}, - 167: {region: 0x166, script: 0x5b, flags: 0x0}, - 168: {region: 0x166, script: 0x5b, flags: 0x0}, - 169: {region: 0x53, script: 0xef, flags: 0x0}, - 170: {region: 0x166, script: 0x5b, flags: 0x0}, - 171: {region: 0x166, script: 0x5b, flags: 0x0}, - 172: {region: 0x166, script: 0x5b, flags: 0x0}, - 173: {region: 0x9a, script: 0xe, flags: 0x0}, - 174: {region: 0x166, script: 0x5b, flags: 0x0}, - 175: {region: 0x9d, script: 0x5, flags: 0x0}, - 176: {region: 0x166, script: 0x5b, flags: 0x0}, - 177: {region: 0x4f, script: 0x5b, flags: 0x0}, - 178: {region: 0x79, script: 0x5b, flags: 0x0}, - 179: {region: 0x9a, script: 0x22, flags: 0x0}, - 180: {region: 0xe9, script: 0x5, flags: 0x0}, - 181: {region: 0x9a, script: 0x22, flags: 0x0}, - 182: {region: 0x166, script: 0x5b, flags: 0x0}, - 183: {region: 0x33, script: 0x5b, flags: 0x0}, - 184: {region: 0x166, script: 0x5b, flags: 0x0}, - 185: {region: 0xb5, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5b, flags: 0x0}, - 187: {region: 0x166, script: 0x2c, flags: 0x0}, - 188: {region: 0xe8, script: 0x5b, flags: 0x0}, - 189: {region: 0x166, script: 0x5b, flags: 0x0}, - 190: {region: 0xe9, script: 0x22, flags: 0x0}, - 191: {region: 0x107, script: 0x20, flags: 0x0}, - 192: {region: 0x160, script: 0x5b, flags: 0x0}, - 193: {region: 0x166, script: 0x5b, flags: 0x0}, - 194: {region: 0x96, script: 0x5b, flags: 0x0}, - 195: {region: 0x166, script: 0x5b, flags: 0x0}, - 196: {region: 0x52, script: 0x5b, flags: 0x0}, - 197: {region: 0x166, script: 0x5b, flags: 0x0}, - 198: {region: 0x166, script: 0x5b, flags: 0x0}, - 199: {region: 0x166, script: 0x5b, flags: 0x0}, - 200: {region: 0x87, script: 0x5b, flags: 0x0}, - 201: {region: 0x166, script: 0x5b, flags: 0x0}, - 202: {region: 0x166, script: 0x5b, flags: 0x0}, - 203: {region: 0x166, script: 0x5b, flags: 0x0}, - 204: {region: 0x166, script: 0x5b, flags: 0x0}, - 205: {region: 0x6e, script: 0x2c, flags: 0x0}, - 206: {region: 0x166, script: 0x5b, flags: 0x0}, - 207: {region: 0x166, script: 0x5b, flags: 0x0}, - 208: {region: 0x52, script: 0x5b, flags: 0x0}, - 209: {region: 0x166, script: 0x5b, flags: 0x0}, - 210: {region: 0x166, script: 0x5b, flags: 0x0}, - 211: {region: 0xc4, script: 0x5b, flags: 0x0}, - 212: {region: 0x166, script: 0x5b, flags: 0x0}, - 213: {region: 0x166, script: 0x5b, flags: 0x0}, - 214: {region: 0x166, script: 0x5b, flags: 0x0}, - 215: {region: 0x6f, script: 0x5b, flags: 0x0}, - 216: {region: 0x166, script: 0x5b, flags: 0x0}, - 217: {region: 0x166, script: 0x5b, flags: 0x0}, - 218: {region: 0xd7, script: 0x5b, flags: 0x0}, - 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x107, script: 0x20, flags: 0x0}, - 221: {region: 0xe8, script: 0x5b, flags: 0x0}, - 222: {region: 0x166, script: 0x5b, flags: 0x0}, - 223: {region: 0x132, script: 0x5b, flags: 0x0}, - 224: {region: 0x8b, script: 0x5b, flags: 0x0}, - 225: {region: 0x76, script: 0x5b, flags: 0x0}, - 226: {region: 0x107, script: 0x20, flags: 0x0}, - 227: {region: 0x136, script: 0x5b, flags: 0x0}, - 228: {region: 0x49, script: 0x5b, flags: 0x0}, - 229: {region: 0x136, script: 0x1a, flags: 0x0}, - 230: {region: 0xa7, script: 0x5, flags: 0x0}, - 231: {region: 0x13f, script: 0x19, flags: 0x0}, - 232: {region: 0x166, script: 0x5b, flags: 0x0}, - 233: {region: 0x9c, script: 0x5, flags: 0x0}, - 234: {region: 0x166, script: 0x5b, flags: 0x0}, - 235: {region: 0x166, script: 0x5b, flags: 0x0}, - 236: {region: 0x166, script: 0x5b, flags: 0x0}, - 237: {region: 0x166, script: 0x5b, flags: 0x0}, - 238: {region: 0x166, script: 0x5b, flags: 0x0}, - 239: {region: 0xc6, script: 0xda, flags: 0x0}, - 240: {region: 0x79, script: 0x5b, flags: 0x0}, - 241: {region: 0x6c, script: 0x1d, flags: 0x0}, - 242: {region: 0xe8, script: 0x5b, flags: 0x0}, - 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x131, script: 0x20, flags: 0x0}, - 245: {region: 0x49, script: 0x17, flags: 0x0}, - 246: {region: 0x49, script: 0x17, flags: 0x0}, - 247: {region: 0x49, script: 0x17, flags: 0x0}, - 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10b, script: 0x5b, flags: 0x0}, - 250: {region: 0x5f, script: 0x5b, flags: 0x0}, - 251: {region: 0xea, script: 0x5b, flags: 0x0}, - 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc5, script: 0x88, flags: 0x0}, - 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x107, script: 0x20, flags: 0x0}, - 256: {region: 0x7c, script: 0x5b, flags: 0x0}, - 257: {region: 0x64, script: 0x5b, flags: 0x0}, - 258: {region: 0x166, script: 0x5b, flags: 0x0}, - 259: {region: 0x166, script: 0x5b, flags: 0x0}, - 260: {region: 0x166, script: 0x5b, flags: 0x0}, - 261: {region: 0x166, script: 0x5b, flags: 0x0}, - 262: {region: 0x136, script: 0x5b, flags: 0x0}, - 263: {region: 0x107, script: 0x20, flags: 0x0}, - 264: {region: 0xa5, script: 0x5b, flags: 0x0}, - 265: {region: 0x166, script: 0x5b, flags: 0x0}, - 266: {region: 0x166, script: 0x5b, flags: 0x0}, - 267: {region: 0x9a, script: 0x5, flags: 0x0}, - 268: {region: 0x166, script: 0x5b, flags: 0x0}, - 269: {region: 0x61, script: 0x5b, flags: 0x0}, - 270: {region: 0x166, script: 0x5b, flags: 0x0}, - 271: {region: 0x49, script: 0x5b, flags: 0x0}, - 272: {region: 0x166, script: 0x5b, flags: 0x0}, - 273: {region: 0x166, script: 0x5b, flags: 0x0}, - 274: {region: 0x166, script: 0x5b, flags: 0x0}, - 275: {region: 0x166, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5b, flags: 0x0}, - 277: {region: 0x166, script: 0x5b, flags: 0x0}, - 278: {region: 0x166, script: 0x5b, flags: 0x0}, - 279: {region: 0xd5, script: 0x5b, flags: 0x0}, - 280: {region: 0x4f, script: 0x5b, flags: 0x0}, - 281: {region: 0x166, script: 0x5b, flags: 0x0}, - 282: {region: 0x9a, script: 0x5, flags: 0x0}, - 283: {region: 0x166, script: 0x5b, flags: 0x0}, - 284: {region: 0x166, script: 0x5b, flags: 0x0}, - 285: {region: 0x166, script: 0x5b, flags: 0x0}, - 286: {region: 0x166, script: 0x2c, flags: 0x0}, - 287: {region: 0x61, script: 0x5b, flags: 0x0}, - 288: {region: 0xc4, script: 0x5b, flags: 0x0}, - 289: {region: 0xd1, script: 0x5b, flags: 0x0}, - 290: {region: 0x166, script: 0x5b, flags: 0x0}, - 291: {region: 0xdc, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5b, flags: 0x0}, - 293: {region: 0x166, script: 0x5b, flags: 0x0}, - 294: {region: 0x166, script: 0x5b, flags: 0x0}, - 295: {region: 0x166, script: 0x5b, flags: 0x0}, - 296: {region: 0xce, script: 0xed, flags: 0x0}, - 297: {region: 0x166, script: 0x5b, flags: 0x0}, - 298: {region: 0x166, script: 0x5b, flags: 0x0}, - 299: {region: 0x115, script: 0x5b, flags: 0x0}, - 300: {region: 0x37, script: 0x5b, flags: 0x0}, - 301: {region: 0x43, script: 0xef, flags: 0x0}, - 302: {region: 0x166, script: 0x5b, flags: 0x0}, - 303: {region: 0xa5, script: 0x5b, flags: 0x0}, - 304: {region: 0x81, script: 0x5b, flags: 0x0}, - 305: {region: 0xd7, script: 0x5b, flags: 0x0}, - 306: {region: 0x9f, script: 0x5b, flags: 0x0}, - 307: {region: 0x6c, script: 0x29, flags: 0x0}, - 308: {region: 0x166, script: 0x5b, flags: 0x0}, - 309: {region: 0xc5, script: 0x4b, flags: 0x0}, - 310: {region: 0x88, script: 0x34, flags: 0x0}, - 311: {region: 0x166, script: 0x5b, flags: 0x0}, - 312: {region: 0x166, script: 0x5b, flags: 0x0}, - 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x166, script: 0x5b, flags: 0x0}, - 315: {region: 0x166, script: 0x5b, flags: 0x0}, - 316: {region: 0x1, script: 0x5b, flags: 0x0}, - 317: {region: 0x166, script: 0x5b, flags: 0x0}, - 318: {region: 0x6f, script: 0x5b, flags: 0x0}, - 319: {region: 0x136, script: 0x5b, flags: 0x0}, - 320: {region: 0x6b, script: 0x5b, flags: 0x0}, - 321: {region: 0x166, script: 0x5b, flags: 0x0}, - 322: {region: 0x9f, script: 0x46, flags: 0x0}, - 323: {region: 0x166, script: 0x5b, flags: 0x0}, - 324: {region: 0x166, script: 0x5b, flags: 0x0}, - 325: {region: 0x6f, script: 0x5b, flags: 0x0}, - 326: {region: 0x52, script: 0x5b, flags: 0x0}, - 327: {region: 0x6f, script: 0x5b, flags: 0x0}, - 328: {region: 0x9d, script: 0x5, flags: 0x0}, - 329: {region: 0x166, script: 0x5b, flags: 0x0}, - 330: {region: 0x166, script: 0x5b, flags: 0x0}, - 331: {region: 0x166, script: 0x5b, flags: 0x0}, - 332: {region: 0x166, script: 0x5b, flags: 0x0}, - 333: {region: 0x87, script: 0x5b, flags: 0x0}, - 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x166, script: 0x5b, flags: 0x0}, - 336: {region: 0xc4, script: 0x5b, flags: 0x0}, - 337: {region: 0x73, script: 0x5b, flags: 0x0}, - 338: {region: 0x10c, script: 0x5, flags: 0x0}, - 339: {region: 0xe8, script: 0x5b, flags: 0x0}, - 340: {region: 0x10d, script: 0x5b, flags: 0x0}, - 341: {region: 0x74, script: 0x5b, flags: 0x0}, - 342: {region: 0x166, script: 0x5b, flags: 0x0}, - 343: {region: 0x166, script: 0x5b, flags: 0x0}, - 344: {region: 0x77, script: 0x5b, flags: 0x0}, - 345: {region: 0x166, script: 0x5b, flags: 0x0}, - 346: {region: 0x3b, script: 0x5b, flags: 0x0}, - 347: {region: 0x166, script: 0x5b, flags: 0x0}, - 348: {region: 0x166, script: 0x5b, flags: 0x0}, - 349: {region: 0x166, script: 0x5b, flags: 0x0}, - 350: {region: 0x79, script: 0x5b, flags: 0x0}, - 351: {region: 0x136, script: 0x5b, flags: 0x0}, - 352: {region: 0x79, script: 0x5b, flags: 0x0}, - 353: {region: 0x61, script: 0x5b, flags: 0x0}, - 354: {region: 0x61, script: 0x5b, flags: 0x0}, - 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x141, script: 0x5b, flags: 0x0}, - 357: {region: 0x166, script: 0x5b, flags: 0x0}, - 358: {region: 0x85, script: 0x5b, flags: 0x0}, - 359: {region: 0x166, script: 0x5b, flags: 0x0}, - 360: {region: 0xd5, script: 0x5b, flags: 0x0}, - 361: {region: 0x9f, script: 0x5b, flags: 0x0}, - 362: {region: 0xd7, script: 0x5b, flags: 0x0}, - 363: {region: 0x166, script: 0x5b, flags: 0x0}, - 364: {region: 0x10c, script: 0x5b, flags: 0x0}, - 365: {region: 0xda, script: 0x5b, flags: 0x0}, - 366: {region: 0x97, script: 0x5b, flags: 0x0}, - 367: {region: 0x81, script: 0x5b, flags: 0x0}, - 368: {region: 0x166, script: 0x5b, flags: 0x0}, - 369: {region: 0xbd, script: 0x5b, flags: 0x0}, - 370: {region: 0x166, script: 0x5b, flags: 0x0}, - 371: {region: 0x166, script: 0x5b, flags: 0x0}, - 372: {region: 0x166, script: 0x5b, flags: 0x0}, - 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x166, script: 0x5b, flags: 0x0}, - 375: {region: 0x96, script: 0x5b, flags: 0x0}, - 376: {region: 0x166, script: 0x5b, flags: 0x0}, - 377: {region: 0x166, script: 0x5b, flags: 0x0}, - 378: {region: 0x9a, script: 0x22, flags: 0x0}, - 379: {region: 0x166, script: 0x5b, flags: 0x0}, - 380: {region: 0x9d, script: 0x5, flags: 0x0}, - 381: {region: 0x7f, script: 0x5b, flags: 0x0}, - 382: {region: 0x7c, script: 0x5b, flags: 0x0}, - 383: {region: 0x166, script: 0x5b, flags: 0x0}, - 384: {region: 0x166, script: 0x5b, flags: 0x0}, - 385: {region: 0x166, script: 0x5b, flags: 0x0}, - 386: {region: 0x166, script: 0x5b, flags: 0x0}, - 387: {region: 0x166, script: 0x5b, flags: 0x0}, - 388: {region: 0x166, script: 0x5b, flags: 0x0}, - 389: {region: 0x70, script: 0x2c, flags: 0x0}, - 390: {region: 0x166, script: 0x5b, flags: 0x0}, - 391: {region: 0xdc, script: 0x22, flags: 0x0}, - 392: {region: 0x166, script: 0x5b, flags: 0x0}, - 393: {region: 0xa8, script: 0x5b, flags: 0x0}, - 394: {region: 0x166, script: 0x5b, flags: 0x0}, - 395: {region: 0xe9, script: 0x5, flags: 0x0}, - 396: {region: 0x166, script: 0x5b, flags: 0x0}, - 397: {region: 0xe9, script: 0x5, flags: 0x0}, - 398: {region: 0x166, script: 0x5b, flags: 0x0}, - 399: {region: 0x166, script: 0x5b, flags: 0x0}, - 400: {region: 0x6f, script: 0x5b, flags: 0x0}, - 401: {region: 0x9d, script: 0x5, flags: 0x0}, - 402: {region: 0x166, script: 0x5b, flags: 0x0}, - 403: {region: 0x166, script: 0x2c, flags: 0x0}, - 404: {region: 0xf2, script: 0x5b, flags: 0x0}, - 405: {region: 0x166, script: 0x5b, flags: 0x0}, - 406: {region: 0x166, script: 0x5b, flags: 0x0}, - 407: {region: 0x166, script: 0x5b, flags: 0x0}, - 408: {region: 0x166, script: 0x2c, flags: 0x0}, - 409: {region: 0x166, script: 0x5b, flags: 0x0}, - 410: {region: 0x9a, script: 0x22, flags: 0x0}, - 411: {region: 0x9a, script: 0xe9, flags: 0x0}, - 412: {region: 0x96, script: 0x5b, flags: 0x0}, - 413: {region: 0xda, script: 0x5b, flags: 0x0}, - 414: {region: 0x131, script: 0x32, flags: 0x0}, - 415: {region: 0x166, script: 0x5b, flags: 0x0}, - 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x9a, script: 0xe, flags: 0x0}, - 418: {region: 0x166, script: 0x5b, flags: 0x0}, - 419: {region: 0x4e, script: 0x5b, flags: 0x0}, - 420: {region: 0x9a, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5b, flags: 0x0}, - 422: {region: 0x54, script: 0x5b, flags: 0x0}, - 423: {region: 0x166, script: 0x5b, flags: 0x0}, - 424: {region: 0x81, script: 0x5b, flags: 0x0}, - 425: {region: 0x166, script: 0x5b, flags: 0x0}, - 426: {region: 0x166, script: 0x5b, flags: 0x0}, - 427: {region: 0xa5, script: 0x5b, flags: 0x0}, - 428: {region: 0x99, script: 0x5b, flags: 0x0}, - 429: {region: 0x166, script: 0x5b, flags: 0x0}, - 430: {region: 0xdc, script: 0x22, flags: 0x0}, - 431: {region: 0x166, script: 0x5b, flags: 0x0}, - 432: {region: 0x166, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5b, flags: 0x0}, - 434: {region: 0x166, script: 0x5, flags: 0x0}, - 435: {region: 0x166, script: 0x5b, flags: 0x0}, - 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x166, script: 0x5b, flags: 0x0}, - 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x166, script: 0x5b, flags: 0x0}, - 440: {region: 0x136, script: 0x5b, flags: 0x0}, - 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x166, script: 0x5b, flags: 0x0}, - 443: {region: 0x166, script: 0x2c, flags: 0x0}, - 444: {region: 0x98, script: 0x3e, flags: 0x0}, - 445: {region: 0x166, script: 0x5b, flags: 0x0}, - 446: {region: 0x9a, script: 0x22, flags: 0x0}, - 447: {region: 0x166, script: 0x5b, flags: 0x0}, - 448: {region: 0x74, script: 0x5b, flags: 0x0}, - 449: {region: 0x166, script: 0x5b, flags: 0x0}, - 450: {region: 0x166, script: 0x5b, flags: 0x0}, - 451: {region: 0xe8, script: 0x5b, flags: 0x0}, - 452: {region: 0x166, script: 0x5b, flags: 0x0}, - 453: {region: 0x12c, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x92, flags: 0x0}, - 455: {region: 0x166, script: 0x5b, flags: 0x0}, - 456: {region: 0xe9, script: 0x5, flags: 0x0}, - 457: {region: 0x9a, script: 0x22, flags: 0x0}, - 458: {region: 0xb0, script: 0x41, flags: 0x0}, - 459: {region: 0xe8, script: 0x5b, flags: 0x0}, - 460: {region: 0xe9, script: 0x5, flags: 0x0}, - 461: {region: 0xe7, script: 0x5b, flags: 0x0}, - 462: {region: 0x9a, script: 0x22, flags: 0x0}, - 463: {region: 0x9a, script: 0x22, flags: 0x0}, - 464: {region: 0x166, script: 0x5b, flags: 0x0}, - 465: {region: 0x91, script: 0x5b, flags: 0x0}, - 466: {region: 0x61, script: 0x5b, flags: 0x0}, - 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x92, script: 0x5b, flags: 0x0}, - 469: {region: 0x93, script: 0x5b, flags: 0x0}, - 470: {region: 0x166, script: 0x5b, flags: 0x0}, - 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd3, script: 0x5b, flags: 0x0}, - 473: {region: 0x79, script: 0x5b, flags: 0x0}, - 474: {region: 0x166, script: 0x5b, flags: 0x0}, - 475: {region: 0x166, script: 0x5b, flags: 0x0}, - 476: {region: 0xd1, script: 0x5b, flags: 0x0}, - 477: {region: 0xd7, script: 0x5b, flags: 0x0}, - 478: {region: 0x166, script: 0x5b, flags: 0x0}, - 479: {region: 0x166, script: 0x5b, flags: 0x0}, - 480: {region: 0x166, script: 0x5b, flags: 0x0}, - 481: {region: 0x96, script: 0x5b, flags: 0x0}, - 482: {region: 0x166, script: 0x5b, flags: 0x0}, - 483: {region: 0x166, script: 0x5b, flags: 0x0}, - 484: {region: 0x166, script: 0x5b, flags: 0x0}, - 486: {region: 0x123, script: 0x5b, flags: 0x0}, - 487: {region: 0xd7, script: 0x5b, flags: 0x0}, - 488: {region: 0x166, script: 0x5b, flags: 0x0}, - 489: {region: 0x166, script: 0x5b, flags: 0x0}, - 490: {region: 0x53, script: 0xfd, flags: 0x0}, - 491: {region: 0x166, script: 0x5b, flags: 0x0}, - 492: {region: 0x136, script: 0x5b, flags: 0x0}, - 493: {region: 0x166, script: 0x5b, flags: 0x0}, - 494: {region: 0x49, script: 0x5b, flags: 0x0}, - 495: {region: 0x166, script: 0x5b, flags: 0x0}, - 496: {region: 0x166, script: 0x5b, flags: 0x0}, - 497: {region: 0xe8, script: 0x5b, flags: 0x0}, - 498: {region: 0x166, script: 0x5b, flags: 0x0}, - 499: {region: 0x96, script: 0x5b, flags: 0x0}, - 500: {region: 0x107, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5b, flags: 0x0}, - 502: {region: 0x166, script: 0x5b, flags: 0x0}, - 503: {region: 0x166, script: 0x5b, flags: 0x0}, - 504: {region: 0x9e, script: 0x5b, flags: 0x0}, - 505: {region: 0x9f, script: 0x5b, flags: 0x0}, - 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x98, script: 0x3e, flags: 0x0}, - 508: {region: 0x166, script: 0x5b, flags: 0x0}, - 509: {region: 0x166, script: 0x5b, flags: 0x0}, - 510: {region: 0x107, script: 0x5b, flags: 0x0}, - 511: {region: 0x166, script: 0x5b, flags: 0x0}, - 512: {region: 0xa3, script: 0x49, flags: 0x0}, - 513: {region: 0x166, script: 0x5b, flags: 0x0}, - 514: {region: 0xa1, script: 0x5b, flags: 0x0}, - 515: {region: 0x1, script: 0x5b, flags: 0x0}, - 516: {region: 0x166, script: 0x5b, flags: 0x0}, - 517: {region: 0x166, script: 0x5b, flags: 0x0}, - 518: {region: 0x166, script: 0x5b, flags: 0x0}, - 519: {region: 0x52, script: 0x5b, flags: 0x0}, - 520: {region: 0x131, script: 0x3e, flags: 0x0}, - 521: {region: 0x166, script: 0x5b, flags: 0x0}, - 522: {region: 0x130, script: 0x5b, flags: 0x0}, - 523: {region: 0xdc, script: 0x22, flags: 0x0}, - 524: {region: 0x166, script: 0x5b, flags: 0x0}, - 525: {region: 0x64, script: 0x5b, flags: 0x0}, - 526: {region: 0x96, script: 0x5b, flags: 0x0}, - 527: {region: 0x96, script: 0x5b, flags: 0x0}, - 528: {region: 0x7e, script: 0x2e, flags: 0x0}, - 529: {region: 0x138, script: 0x20, flags: 0x0}, - 530: {region: 0x68, script: 0x5b, flags: 0x0}, - 531: {region: 0xc5, script: 0x5b, flags: 0x0}, - 532: {region: 0x166, script: 0x5b, flags: 0x0}, - 533: {region: 0x166, script: 0x5b, flags: 0x0}, - 534: {region: 0xd7, script: 0x5b, flags: 0x0}, - 535: {region: 0xa5, script: 0x5b, flags: 0x0}, - 536: {region: 0xc4, script: 0x5b, flags: 0x0}, - 537: {region: 0x107, script: 0x20, flags: 0x0}, - 538: {region: 0x166, script: 0x5b, flags: 0x0}, - 539: {region: 0x166, script: 0x5b, flags: 0x0}, - 540: {region: 0x166, script: 0x5b, flags: 0x0}, - 541: {region: 0x166, script: 0x5b, flags: 0x0}, - 542: {region: 0xd5, script: 0x5, flags: 0x0}, - 543: {region: 0xd7, script: 0x5b, flags: 0x0}, - 544: {region: 0x165, script: 0x5b, flags: 0x0}, - 545: {region: 0x166, script: 0x5b, flags: 0x0}, - 546: {region: 0x166, script: 0x5b, flags: 0x0}, - 547: {region: 0x130, script: 0x5b, flags: 0x0}, - 548: {region: 0x123, script: 0x5, flags: 0x0}, - 549: {region: 0x166, script: 0x5b, flags: 0x0}, - 550: {region: 0x124, script: 0xee, flags: 0x0}, - 551: {region: 0x5b, script: 0x5b, flags: 0x0}, - 552: {region: 0x52, script: 0x5b, flags: 0x0}, - 553: {region: 0x166, script: 0x5b, flags: 0x0}, - 554: {region: 0x4f, script: 0x5b, flags: 0x0}, - 555: {region: 0x9a, script: 0x22, flags: 0x0}, - 556: {region: 0x9a, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5b, flags: 0x0}, - 558: {region: 0x96, script: 0x5b, flags: 0x0}, - 559: {region: 0x166, script: 0x5b, flags: 0x0}, - 560: {region: 0x41, script: 0x5b, flags: 0x0}, - 561: {region: 0x9a, script: 0x5b, flags: 0x0}, - 562: {region: 0x53, script: 0xe5, flags: 0x0}, - 563: {region: 0x9a, script: 0x22, flags: 0x0}, - 564: {region: 0xc4, script: 0x5b, flags: 0x0}, - 565: {region: 0x166, script: 0x5b, flags: 0x0}, - 566: {region: 0x9a, script: 0x76, flags: 0x0}, - 567: {region: 0xe9, script: 0x5, flags: 0x0}, - 568: {region: 0x166, script: 0x5b, flags: 0x0}, - 569: {region: 0xa5, script: 0x5b, flags: 0x0}, - 570: {region: 0x166, script: 0x5b, flags: 0x0}, - 571: {region: 0x12c, script: 0x5b, flags: 0x0}, - 572: {region: 0x166, script: 0x5b, flags: 0x0}, - 573: {region: 0xd3, script: 0x5b, flags: 0x0}, - 574: {region: 0x166, script: 0x5b, flags: 0x0}, - 575: {region: 0xb0, script: 0x58, flags: 0x0}, - 576: {region: 0x166, script: 0x5b, flags: 0x0}, - 577: {region: 0x166, script: 0x5b, flags: 0x0}, - 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x166, script: 0x5b, flags: 0x0}, - 580: {region: 0x52, script: 0x5b, flags: 0x0}, - 581: {region: 0x83, script: 0x5b, flags: 0x0}, - 582: {region: 0xa5, script: 0x5b, flags: 0x0}, - 583: {region: 0x166, script: 0x5b, flags: 0x0}, - 584: {region: 0x166, script: 0x5b, flags: 0x0}, - 585: {region: 0x166, script: 0x5b, flags: 0x0}, - 586: {region: 0xa7, script: 0x4f, flags: 0x0}, - 587: {region: 0x2a, script: 0x5b, flags: 0x0}, - 588: {region: 0x166, script: 0x5b, flags: 0x0}, - 589: {region: 0x166, script: 0x5b, flags: 0x0}, - 590: {region: 0x166, script: 0x5b, flags: 0x0}, - 591: {region: 0x166, script: 0x5b, flags: 0x0}, - 592: {region: 0x166, script: 0x5b, flags: 0x0}, - 593: {region: 0x9a, script: 0x53, flags: 0x0}, - 594: {region: 0x8c, script: 0x5b, flags: 0x0}, - 595: {region: 0x166, script: 0x5b, flags: 0x0}, - 596: {region: 0xac, script: 0x54, flags: 0x0}, - 597: {region: 0x107, script: 0x20, flags: 0x0}, - 598: {region: 0x9a, script: 0x22, flags: 0x0}, - 599: {region: 0x166, script: 0x5b, flags: 0x0}, - 600: {region: 0x76, script: 0x5b, flags: 0x0}, - 601: {region: 0x166, script: 0x5b, flags: 0x0}, - 602: {region: 0xb5, script: 0x5b, flags: 0x0}, - 603: {region: 0x166, script: 0x5b, flags: 0x0}, - 604: {region: 0x166, script: 0x5b, flags: 0x0}, - 605: {region: 0x166, script: 0x5b, flags: 0x0}, - 606: {region: 0x166, script: 0x5b, flags: 0x0}, - 607: {region: 0x166, script: 0x5b, flags: 0x0}, - 608: {region: 0x166, script: 0x5b, flags: 0x0}, - 609: {region: 0x166, script: 0x5b, flags: 0x0}, - 610: {region: 0x166, script: 0x2c, flags: 0x0}, - 611: {region: 0x166, script: 0x5b, flags: 0x0}, - 612: {region: 0x107, script: 0x20, flags: 0x0}, - 613: {region: 0x113, script: 0x5b, flags: 0x0}, - 614: {region: 0xe8, script: 0x5b, flags: 0x0}, - 615: {region: 0x107, script: 0x5b, flags: 0x0}, - 616: {region: 0x166, script: 0x5b, flags: 0x0}, - 617: {region: 0x9a, script: 0x22, flags: 0x0}, - 618: {region: 0x9a, script: 0x5, flags: 0x0}, - 619: {region: 0x130, script: 0x5b, flags: 0x0}, - 620: {region: 0x166, script: 0x5b, flags: 0x0}, - 621: {region: 0x52, script: 0x5b, flags: 0x0}, - 622: {region: 0x61, script: 0x5b, flags: 0x0}, - 623: {region: 0x166, script: 0x5b, flags: 0x0}, - 624: {region: 0x166, script: 0x5b, flags: 0x0}, - 625: {region: 0x166, script: 0x2c, flags: 0x0}, - 626: {region: 0x166, script: 0x5b, flags: 0x0}, - 627: {region: 0x166, script: 0x5b, flags: 0x0}, - 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x166, script: 0x5b, flags: 0x0}, - 630: {region: 0x166, script: 0x5b, flags: 0x0}, - 631: {region: 0x166, script: 0x5b, flags: 0x0}, - 632: {region: 0x166, script: 0x5b, flags: 0x0}, - 633: {region: 0x107, script: 0x20, flags: 0x0}, - 634: {region: 0x166, script: 0x5b, flags: 0x0}, - 635: {region: 0x166, script: 0x5b, flags: 0x0}, - 636: {region: 0x166, script: 0x5b, flags: 0x0}, - 637: {region: 0x107, script: 0x20, flags: 0x0}, - 638: {region: 0x166, script: 0x5b, flags: 0x0}, - 639: {region: 0x96, script: 0x5b, flags: 0x0}, - 640: {region: 0xe9, script: 0x5, flags: 0x0}, - 641: {region: 0x7c, script: 0x5b, flags: 0x0}, - 642: {region: 0x166, script: 0x5b, flags: 0x0}, - 643: {region: 0x166, script: 0x5b, flags: 0x0}, - 644: {region: 0x166, script: 0x5b, flags: 0x0}, - 645: {region: 0x166, script: 0x2c, flags: 0x0}, - 646: {region: 0x124, script: 0xee, flags: 0x0}, - 647: {region: 0xe9, script: 0x5, flags: 0x0}, - 648: {region: 0x166, script: 0x5b, flags: 0x0}, - 649: {region: 0x166, script: 0x5b, flags: 0x0}, - 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x166, script: 0x5b, flags: 0x0}, - 652: {region: 0x166, script: 0x5b, flags: 0x0}, - 653: {region: 0x166, script: 0x5b, flags: 0x0}, - 654: {region: 0x139, script: 0x5b, flags: 0x0}, - 655: {region: 0x88, script: 0x5f, flags: 0x0}, - 656: {region: 0x98, script: 0x3e, flags: 0x0}, - 657: {region: 0x130, script: 0x5b, flags: 0x0}, - 658: {region: 0xe9, script: 0x5, flags: 0x0}, - 659: {region: 0x132, script: 0x5b, flags: 0x0}, - 660: {region: 0x166, script: 0x5b, flags: 0x0}, - 661: {region: 0xb8, script: 0x5b, flags: 0x0}, - 662: {region: 0x107, script: 0x20, flags: 0x0}, - 663: {region: 0x166, script: 0x5b, flags: 0x0}, - 664: {region: 0x96, script: 0x5b, flags: 0x0}, - 665: {region: 0x166, script: 0x5b, flags: 0x0}, - 666: {region: 0x53, script: 0xee, flags: 0x0}, - 667: {region: 0x166, script: 0x5b, flags: 0x0}, - 668: {region: 0x166, script: 0x5b, flags: 0x0}, - 669: {region: 0x166, script: 0x5b, flags: 0x0}, - 670: {region: 0x166, script: 0x5b, flags: 0x0}, - 671: {region: 0x9a, script: 0x5d, flags: 0x0}, - 672: {region: 0x166, script: 0x5b, flags: 0x0}, - 673: {region: 0x166, script: 0x5b, flags: 0x0}, - 674: {region: 0x107, script: 0x20, flags: 0x0}, - 675: {region: 0x132, script: 0x5b, flags: 0x0}, - 676: {region: 0x166, script: 0x5b, flags: 0x0}, - 677: {region: 0xda, script: 0x5b, flags: 0x0}, - 678: {region: 0x166, script: 0x5b, flags: 0x0}, - 679: {region: 0x166, script: 0x5b, flags: 0x0}, - 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x166, script: 0x5b, flags: 0x0}, - 682: {region: 0x166, script: 0x5b, flags: 0x0}, - 683: {region: 0x9f, script: 0x5b, flags: 0x0}, - 684: {region: 0x53, script: 0x61, flags: 0x0}, - 685: {region: 0x96, script: 0x5b, flags: 0x0}, - 686: {region: 0x9d, script: 0x5, flags: 0x0}, - 687: {region: 0x136, script: 0x5b, flags: 0x0}, - 688: {region: 0x166, script: 0x5b, flags: 0x0}, - 689: {region: 0x166, script: 0x5b, flags: 0x0}, - 690: {region: 0x9a, script: 0xe9, flags: 0x0}, - 691: {region: 0x9f, script: 0x5b, flags: 0x0}, - 692: {region: 0x166, script: 0x5b, flags: 0x0}, - 693: {region: 0x4b, script: 0x5b, flags: 0x0}, - 694: {region: 0x166, script: 0x5b, flags: 0x0}, - 695: {region: 0x166, script: 0x5b, flags: 0x0}, - 696: {region: 0xb0, script: 0x58, flags: 0x0}, - 697: {region: 0x166, script: 0x5b, flags: 0x0}, - 698: {region: 0x166, script: 0x5b, flags: 0x0}, - 699: {region: 0x4b, script: 0x5b, flags: 0x0}, - 700: {region: 0x166, script: 0x5b, flags: 0x0}, - 701: {region: 0x166, script: 0x5b, flags: 0x0}, - 702: {region: 0x163, script: 0x5b, flags: 0x0}, - 703: {region: 0x9d, script: 0x5, flags: 0x0}, - 704: {region: 0xb7, script: 0x5b, flags: 0x0}, - 705: {region: 0xb9, script: 0x5b, flags: 0x0}, - 706: {region: 0x4b, script: 0x5b, flags: 0x0}, - 707: {region: 0x4b, script: 0x5b, flags: 0x0}, - 708: {region: 0xa5, script: 0x5b, flags: 0x0}, - 709: {region: 0xa5, script: 0x5b, flags: 0x0}, - 710: {region: 0x9d, script: 0x5, flags: 0x0}, - 711: {region: 0xb9, script: 0x5b, flags: 0x0}, - 712: {region: 0x124, script: 0xee, flags: 0x0}, - 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12c, script: 0x5b, flags: 0x0}, - 715: {region: 0x96, script: 0x5b, flags: 0x0}, - 716: {region: 0x52, script: 0x5b, flags: 0x0}, - 717: {region: 0x9a, script: 0x22, flags: 0x0}, - 718: {region: 0x9a, script: 0x22, flags: 0x0}, - 719: {region: 0x96, script: 0x5b, flags: 0x0}, - 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa5, script: 0x5b, flags: 0x0}, - 722: {region: 0x166, script: 0x5b, flags: 0x0}, - 723: {region: 0xd0, script: 0x5b, flags: 0x0}, - 724: {region: 0x166, script: 0x5b, flags: 0x0}, - 725: {region: 0x166, script: 0x5b, flags: 0x0}, - 726: {region: 0x166, script: 0x5b, flags: 0x0}, - 727: {region: 0x166, script: 0x5b, flags: 0x0}, - 728: {region: 0x166, script: 0x5b, flags: 0x0}, - 729: {region: 0x166, script: 0x5b, flags: 0x0}, - 730: {region: 0x166, script: 0x5b, flags: 0x0}, - 731: {region: 0x166, script: 0x5b, flags: 0x0}, - 732: {region: 0x166, script: 0x5b, flags: 0x0}, - 733: {region: 0x166, script: 0x5b, flags: 0x0}, - 734: {region: 0x166, script: 0x5b, flags: 0x0}, - 735: {region: 0x166, script: 0x5, flags: 0x0}, - 736: {region: 0x107, script: 0x20, flags: 0x0}, - 737: {region: 0xe8, script: 0x5b, flags: 0x0}, - 738: {region: 0x166, script: 0x5b, flags: 0x0}, - 739: {region: 0x96, script: 0x5b, flags: 0x0}, - 740: {region: 0x166, script: 0x2c, flags: 0x0}, - 741: {region: 0x166, script: 0x5b, flags: 0x0}, - 742: {region: 0x166, script: 0x5b, flags: 0x0}, - 743: {region: 0x166, script: 0x5b, flags: 0x0}, - 744: {region: 0x113, script: 0x5b, flags: 0x0}, - 745: {region: 0xa5, script: 0x5b, flags: 0x0}, - 746: {region: 0x166, script: 0x5b, flags: 0x0}, - 747: {region: 0x166, script: 0x5b, flags: 0x0}, - 748: {region: 0x124, script: 0x5, flags: 0x0}, - 749: {region: 0xcd, script: 0x5b, flags: 0x0}, - 750: {region: 0x166, script: 0x5b, flags: 0x0}, - 751: {region: 0x166, script: 0x5b, flags: 0x0}, - 752: {region: 0x166, script: 0x5b, flags: 0x0}, - 753: {region: 0xc0, script: 0x5b, flags: 0x0}, - 754: {region: 0xd2, script: 0x5b, flags: 0x0}, - 755: {region: 0x166, script: 0x5b, flags: 0x0}, - 756: {region: 0x52, script: 0x5b, flags: 0x0}, - 757: {region: 0xdc, script: 0x22, flags: 0x0}, - 758: {region: 0x130, script: 0x5b, flags: 0x0}, - 759: {region: 0xc1, script: 0x5b, flags: 0x0}, - 760: {region: 0x166, script: 0x5b, flags: 0x0}, - 761: {region: 0x166, script: 0x5b, flags: 0x0}, - 762: {region: 0xe1, script: 0x5b, flags: 0x0}, - 763: {region: 0x166, script: 0x5b, flags: 0x0}, - 764: {region: 0x96, script: 0x5b, flags: 0x0}, - 765: {region: 0x9c, script: 0x3d, flags: 0x0}, - 766: {region: 0x166, script: 0x5b, flags: 0x0}, - 767: {region: 0xc3, script: 0x20, flags: 0x0}, - 768: {region: 0x166, script: 0x5, flags: 0x0}, - 769: {region: 0x166, script: 0x5b, flags: 0x0}, - 770: {region: 0x166, script: 0x5b, flags: 0x0}, - 771: {region: 0x166, script: 0x5b, flags: 0x0}, - 772: {region: 0x9a, script: 0x6f, flags: 0x0}, - 773: {region: 0x166, script: 0x5b, flags: 0x0}, - 774: {region: 0x166, script: 0x5b, flags: 0x0}, - 775: {region: 0x10c, script: 0x5b, flags: 0x0}, - 776: {region: 0x166, script: 0x5b, flags: 0x0}, - 777: {region: 0x166, script: 0x5b, flags: 0x0}, - 778: {region: 0x166, script: 0x5b, flags: 0x0}, - 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x166, script: 0x5b, flags: 0x0}, - 781: {region: 0x166, script: 0x5b, flags: 0x0}, - 782: {region: 0x9a, script: 0xe, flags: 0x0}, - 783: {region: 0xc5, script: 0x76, flags: 0x0}, - 785: {region: 0x166, script: 0x5b, flags: 0x0}, - 786: {region: 0x49, script: 0x5b, flags: 0x0}, - 787: {region: 0x49, script: 0x5b, flags: 0x0}, - 788: {region: 0x37, script: 0x5b, flags: 0x0}, - 789: {region: 0x166, script: 0x5b, flags: 0x0}, - 790: {region: 0x166, script: 0x5b, flags: 0x0}, - 791: {region: 0x166, script: 0x5b, flags: 0x0}, - 792: {region: 0x166, script: 0x5b, flags: 0x0}, - 793: {region: 0x166, script: 0x5b, flags: 0x0}, - 794: {region: 0x166, script: 0x5b, flags: 0x0}, - 795: {region: 0x9a, script: 0x22, flags: 0x0}, - 796: {region: 0xdc, script: 0x22, flags: 0x0}, - 797: {region: 0x107, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x73, flags: 0x0}, - 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcc, script: 0x5b, flags: 0x0}, - 801: {region: 0x166, script: 0x5b, flags: 0x0}, - 802: {region: 0x166, script: 0x5b, flags: 0x0}, - 803: {region: 0x166, script: 0x5b, flags: 0x0}, - 804: {region: 0x9a, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5b, flags: 0x0}, - 807: {region: 0x166, script: 0x5b, flags: 0x0}, - 808: {region: 0x136, script: 0x5b, flags: 0x0}, - 809: {region: 0x166, script: 0x5b, flags: 0x0}, - 810: {region: 0x166, script: 0x5b, flags: 0x0}, - 811: {region: 0xe9, script: 0x5, flags: 0x0}, - 812: {region: 0xc4, script: 0x5b, flags: 0x0}, - 813: {region: 0x9a, script: 0x22, flags: 0x0}, - 814: {region: 0x96, script: 0x5b, flags: 0x0}, - 815: {region: 0x165, script: 0x5b, flags: 0x0}, - 816: {region: 0x166, script: 0x5b, flags: 0x0}, - 817: {region: 0xc5, script: 0x76, flags: 0x0}, - 818: {region: 0x166, script: 0x5b, flags: 0x0}, - 819: {region: 0x166, script: 0x2c, flags: 0x0}, - 820: {region: 0x107, script: 0x20, flags: 0x0}, - 821: {region: 0x166, script: 0x5b, flags: 0x0}, - 822: {region: 0x132, script: 0x5b, flags: 0x0}, - 823: {region: 0x9d, script: 0x67, flags: 0x0}, - 824: {region: 0x166, script: 0x5b, flags: 0x0}, - 825: {region: 0x166, script: 0x5b, flags: 0x0}, - 826: {region: 0x9d, script: 0x5, flags: 0x0}, - 827: {region: 0x166, script: 0x5b, flags: 0x0}, - 828: {region: 0x166, script: 0x5b, flags: 0x0}, - 829: {region: 0x166, script: 0x5b, flags: 0x0}, - 830: {region: 0xde, script: 0x5b, flags: 0x0}, - 831: {region: 0x166, script: 0x5b, flags: 0x0}, - 832: {region: 0x166, script: 0x5b, flags: 0x0}, - 834: {region: 0x166, script: 0x5b, flags: 0x0}, - 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9f, script: 0x5b, flags: 0x0}, - 837: {region: 0xd3, script: 0x5b, flags: 0x0}, - 838: {region: 0x166, script: 0x5b, flags: 0x0}, - 839: {region: 0xdb, script: 0x5b, flags: 0x0}, - 840: {region: 0x166, script: 0x5b, flags: 0x0}, - 841: {region: 0x166, script: 0x5b, flags: 0x0}, - 842: {region: 0x166, script: 0x5b, flags: 0x0}, - 843: {region: 0xd0, script: 0x5b, flags: 0x0}, - 844: {region: 0x166, script: 0x5b, flags: 0x0}, - 845: {region: 0x166, script: 0x5b, flags: 0x0}, - 846: {region: 0x165, script: 0x5b, flags: 0x0}, - 847: {region: 0xd2, script: 0x5b, flags: 0x0}, - 848: {region: 0x61, script: 0x5b, flags: 0x0}, - 849: {region: 0xdc, script: 0x22, flags: 0x0}, - 850: {region: 0x166, script: 0x5b, flags: 0x0}, - 851: {region: 0xdc, script: 0x22, flags: 0x0}, - 852: {region: 0x166, script: 0x5b, flags: 0x0}, - 853: {region: 0x166, script: 0x5b, flags: 0x0}, - 854: {region: 0xd3, script: 0x5b, flags: 0x0}, - 855: {region: 0x166, script: 0x5b, flags: 0x0}, - 856: {region: 0x166, script: 0x5b, flags: 0x0}, - 857: {region: 0xd2, script: 0x5b, flags: 0x0}, - 858: {region: 0x166, script: 0x5b, flags: 0x0}, - 859: {region: 0xd0, script: 0x5b, flags: 0x0}, - 860: {region: 0xd0, script: 0x5b, flags: 0x0}, - 861: {region: 0x166, script: 0x5b, flags: 0x0}, - 862: {region: 0x166, script: 0x5b, flags: 0x0}, - 863: {region: 0x96, script: 0x5b, flags: 0x0}, - 864: {region: 0x166, script: 0x5b, flags: 0x0}, - 865: {region: 0xe0, script: 0x5b, flags: 0x0}, - 866: {region: 0x166, script: 0x5b, flags: 0x0}, - 867: {region: 0x166, script: 0x5b, flags: 0x0}, - 868: {region: 0x9a, script: 0x5b, flags: 0x0}, - 869: {region: 0x166, script: 0x5b, flags: 0x0}, - 870: {region: 0x166, script: 0x5b, flags: 0x0}, - 871: {region: 0xda, script: 0x5b, flags: 0x0}, - 872: {region: 0x52, script: 0x5b, flags: 0x0}, - 873: {region: 0x166, script: 0x5b, flags: 0x0}, - 874: {region: 0xdb, script: 0x5b, flags: 0x0}, - 875: {region: 0x166, script: 0x5b, flags: 0x0}, - 876: {region: 0x52, script: 0x5b, flags: 0x0}, - 877: {region: 0x166, script: 0x5b, flags: 0x0}, - 878: {region: 0x166, script: 0x5b, flags: 0x0}, - 879: {region: 0xdb, script: 0x5b, flags: 0x0}, - 880: {region: 0x124, script: 0x57, flags: 0x0}, - 881: {region: 0x9a, script: 0x22, flags: 0x0}, - 882: {region: 0x10d, script: 0xcb, flags: 0x0}, - 883: {region: 0x166, script: 0x5b, flags: 0x0}, - 884: {region: 0x166, script: 0x5b, flags: 0x0}, - 885: {region: 0x85, script: 0x7e, flags: 0x0}, - 886: {region: 0x162, script: 0x5b, flags: 0x0}, - 887: {region: 0x166, script: 0x5b, flags: 0x0}, - 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x166, script: 0x5b, flags: 0x0}, - 890: {region: 0x162, script: 0x5b, flags: 0x0}, - 891: {region: 0x166, script: 0x5b, flags: 0x0}, - 892: {region: 0x166, script: 0x5b, flags: 0x0}, - 893: {region: 0x166, script: 0x5b, flags: 0x0}, - 894: {region: 0x166, script: 0x5b, flags: 0x0}, - 895: {region: 0x166, script: 0x5b, flags: 0x0}, - 896: {region: 0x118, script: 0x5b, flags: 0x0}, - 897: {region: 0x166, script: 0x5b, flags: 0x0}, - 898: {region: 0x166, script: 0x5b, flags: 0x0}, - 899: {region: 0x136, script: 0x5b, flags: 0x0}, - 900: {region: 0x166, script: 0x5b, flags: 0x0}, - 901: {region: 0x53, script: 0x5b, flags: 0x0}, - 902: {region: 0x166, script: 0x5b, flags: 0x0}, - 903: {region: 0xcf, script: 0x5b, flags: 0x0}, - 904: {region: 0x130, script: 0x5b, flags: 0x0}, - 905: {region: 0x132, script: 0x5b, flags: 0x0}, - 906: {region: 0x81, script: 0x5b, flags: 0x0}, - 907: {region: 0x79, script: 0x5b, flags: 0x0}, - 908: {region: 0x166, script: 0x5b, flags: 0x0}, - 910: {region: 0x166, script: 0x5b, flags: 0x0}, - 911: {region: 0x166, script: 0x5b, flags: 0x0}, - 912: {region: 0x70, script: 0x5b, flags: 0x0}, - 913: {region: 0x166, script: 0x5b, flags: 0x0}, - 914: {region: 0x166, script: 0x5b, flags: 0x0}, - 915: {region: 0x166, script: 0x5b, flags: 0x0}, - 916: {region: 0x166, script: 0x5b, flags: 0x0}, - 917: {region: 0x9a, script: 0x83, flags: 0x0}, - 918: {region: 0x166, script: 0x5b, flags: 0x0}, - 919: {region: 0x166, script: 0x5, flags: 0x0}, - 920: {region: 0x7e, script: 0x20, flags: 0x0}, - 921: {region: 0x136, script: 0x84, flags: 0x0}, - 922: {region: 0x166, script: 0x5, flags: 0x0}, - 923: {region: 0xc6, script: 0x82, flags: 0x0}, - 924: {region: 0x166, script: 0x5b, flags: 0x0}, - 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe8, script: 0x5b, flags: 0x0}, - 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe8, script: 0x5b, flags: 0x0}, - 929: {region: 0x30, script: 0x5b, flags: 0x0}, - 930: {region: 0xf1, script: 0x5b, flags: 0x0}, - 931: {region: 0x166, script: 0x5b, flags: 0x0}, - 932: {region: 0x79, script: 0x5b, flags: 0x0}, - 933: {region: 0xd7, script: 0x5b, flags: 0x0}, - 934: {region: 0x136, script: 0x5b, flags: 0x0}, - 935: {region: 0x49, script: 0x5b, flags: 0x0}, - 936: {region: 0x166, script: 0x5b, flags: 0x0}, - 937: {region: 0x9d, script: 0xfa, flags: 0x0}, - 938: {region: 0x166, script: 0x5b, flags: 0x0}, - 939: {region: 0x61, script: 0x5b, flags: 0x0}, - 940: {region: 0x166, script: 0x5, flags: 0x0}, - 941: {region: 0xb1, script: 0x90, flags: 0x0}, - 943: {region: 0x166, script: 0x5b, flags: 0x0}, - 944: {region: 0x166, script: 0x5b, flags: 0x0}, - 945: {region: 0x9a, script: 0x12, flags: 0x0}, - 946: {region: 0xa5, script: 0x5b, flags: 0x0}, - 947: {region: 0xea, script: 0x5b, flags: 0x0}, - 948: {region: 0x166, script: 0x5b, flags: 0x0}, - 949: {region: 0x9f, script: 0x5b, flags: 0x0}, - 950: {region: 0x166, script: 0x5b, flags: 0x0}, - 951: {region: 0x166, script: 0x5b, flags: 0x0}, - 952: {region: 0x88, script: 0x34, flags: 0x0}, - 953: {region: 0x76, script: 0x5b, flags: 0x0}, - 954: {region: 0x166, script: 0x5b, flags: 0x0}, - 955: {region: 0xe9, script: 0x4e, flags: 0x0}, - 956: {region: 0x9d, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5b, flags: 0x0}, - 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x166, script: 0x5b, flags: 0x0}, - 960: {region: 0x41, script: 0x5b, flags: 0x0}, - 961: {region: 0x166, script: 0x5b, flags: 0x0}, - 962: {region: 0x7b, script: 0x5b, flags: 0x0}, - 963: {region: 0x166, script: 0x5b, flags: 0x0}, - 964: {region: 0xe5, script: 0x5b, flags: 0x0}, - 965: {region: 0x8a, script: 0x5b, flags: 0x0}, - 966: {region: 0x6a, script: 0x5b, flags: 0x0}, - 967: {region: 0x166, script: 0x5b, flags: 0x0}, - 968: {region: 0x9a, script: 0x22, flags: 0x0}, - 969: {region: 0x166, script: 0x5b, flags: 0x0}, - 970: {region: 0x103, script: 0x5b, flags: 0x0}, - 971: {region: 0x96, script: 0x5b, flags: 0x0}, - 972: {region: 0x166, script: 0x5b, flags: 0x0}, - 973: {region: 0x166, script: 0x5b, flags: 0x0}, - 974: {region: 0x9f, script: 0x5b, flags: 0x0}, - 975: {region: 0x166, script: 0x5, flags: 0x0}, - 976: {region: 0x9a, script: 0x5b, flags: 0x0}, - 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdc, script: 0x22, flags: 0x0}, - 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5b, flags: 0x0}, - 981: {region: 0x73, script: 0x5b, flags: 0x0}, - 982: {region: 0x4e, script: 0x5b, flags: 0x0}, - 983: {region: 0x9d, script: 0x5, flags: 0x0}, - 984: {region: 0x10d, script: 0x5b, flags: 0x0}, - 985: {region: 0x3a, script: 0x5b, flags: 0x0}, - 986: {region: 0x166, script: 0x5b, flags: 0x0}, - 987: {region: 0xd2, script: 0x5b, flags: 0x0}, - 988: {region: 0x105, script: 0x5b, flags: 0x0}, - 989: {region: 0x96, script: 0x5b, flags: 0x0}, - 990: {region: 0x130, script: 0x5b, flags: 0x0}, - 991: {region: 0x166, script: 0x5b, flags: 0x0}, - 992: {region: 0x166, script: 0x5b, flags: 0x0}, - 993: {region: 0x74, script: 0x5b, flags: 0x0}, - 994: {region: 0x107, script: 0x20, flags: 0x0}, - 995: {region: 0x131, script: 0x20, flags: 0x0}, - 996: {region: 0x10a, script: 0x5b, flags: 0x0}, - 997: {region: 0x108, script: 0x5b, flags: 0x0}, - 998: {region: 0x130, script: 0x5b, flags: 0x0}, - 999: {region: 0x166, script: 0x5b, flags: 0x0}, - 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, - 1001: {region: 0x9a, script: 0x22, flags: 0x0}, - 1002: {region: 0x81, script: 0x5b, flags: 0x0}, - 1003: {region: 0x107, script: 0x20, flags: 0x0}, - 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, - 1005: {region: 0x96, script: 0x5b, flags: 0x0}, - 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, - 1007: {region: 0x115, script: 0x5b, flags: 0x0}, - 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, - 1009: {region: 0x166, script: 0x5b, flags: 0x0}, - 1010: {region: 0x166, script: 0x5b, flags: 0x0}, - 1011: {region: 0x130, script: 0x5b, flags: 0x0}, - 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, - 1013: {region: 0x9a, script: 0x22, flags: 0x0}, - 1014: {region: 0x166, script: 0x5, flags: 0x0}, - 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, - 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, - 1017: {region: 0x49, script: 0x5b, flags: 0x0}, - 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, - 1020: {region: 0x9d, script: 0x5, flags: 0x0}, - 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, - 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, - 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, - 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, - 1027: {region: 0x97, script: 0x80, flags: 0x0}, - 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, - 1029: {region: 0x166, script: 0x2c, flags: 0x0}, - 1030: {region: 0x166, script: 0x5b, flags: 0x0}, - 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, - 1033: {region: 0x166, script: 0x5b, flags: 0x0}, - 1034: {region: 0xc5, script: 0x76, flags: 0x0}, - 1035: {region: 0x166, script: 0x5, flags: 0x0}, - 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, - 1037: {region: 0x70, script: 0x5b, flags: 0x0}, - 1038: {region: 0x166, script: 0x5b, flags: 0x0}, - 1039: {region: 0x166, script: 0x5b, flags: 0x0}, - 1040: {region: 0x166, script: 0x5b, flags: 0x0}, - 1041: {region: 0x166, script: 0x5b, flags: 0x0}, - 1042: {region: 0x112, script: 0x5b, flags: 0x0}, - 1043: {region: 0x166, script: 0x5b, flags: 0x0}, - 1044: {region: 0xe9, script: 0x5, flags: 0x0}, - 1045: {region: 0x166, script: 0x5b, flags: 0x0}, - 1046: {region: 0x110, script: 0x5b, flags: 0x0}, - 1047: {region: 0x166, script: 0x5b, flags: 0x0}, - 1048: {region: 0xea, script: 0x5b, flags: 0x0}, - 1049: {region: 0x166, script: 0x5b, flags: 0x0}, - 1050: {region: 0x96, script: 0x5b, flags: 0x0}, - 1051: {region: 0x143, script: 0x5b, flags: 0x0}, - 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, - 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, - 1055: {region: 0x73, script: 0x5b, flags: 0x0}, - 1056: {region: 0x98, script: 0xcc, flags: 0x0}, - 1057: {region: 0x166, script: 0x5b, flags: 0x0}, - 1058: {region: 0x73, script: 0x5b, flags: 0x0}, - 1059: {region: 0x165, script: 0x5b, flags: 0x0}, - 1060: {region: 0x166, script: 0x5b, flags: 0x0}, - 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, - 1062: {region: 0x166, script: 0x5b, flags: 0x0}, - 1063: {region: 0x166, script: 0x5b, flags: 0x0}, - 1064: {region: 0x166, script: 0x5b, flags: 0x0}, - 1065: {region: 0x116, script: 0x5b, flags: 0x0}, - 1066: {region: 0x166, script: 0x5b, flags: 0x0}, - 1067: {region: 0x166, script: 0x5b, flags: 0x0}, - 1068: {region: 0x124, script: 0xee, flags: 0x0}, - 1069: {region: 0x166, script: 0x5b, flags: 0x0}, - 1070: {region: 0x166, script: 0x5b, flags: 0x0}, - 1071: {region: 0x166, script: 0x5b, flags: 0x0}, - 1072: {region: 0x166, script: 0x5b, flags: 0x0}, - 1073: {region: 0x27, script: 0x5b, flags: 0x0}, - 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, - 1076: {region: 0x117, script: 0x5b, flags: 0x0}, - 1077: {region: 0x115, script: 0x5b, flags: 0x0}, - 1078: {region: 0x9a, script: 0x22, flags: 0x0}, - 1079: {region: 0x162, script: 0x5b, flags: 0x0}, - 1080: {region: 0x166, script: 0x5b, flags: 0x0}, - 1081: {region: 0x166, script: 0x5b, flags: 0x0}, - 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, - 1083: {region: 0x162, script: 0x5b, flags: 0x0}, - 1084: {region: 0x166, script: 0x5b, flags: 0x0}, - 1085: {region: 0x61, script: 0x5b, flags: 0x0}, - 1086: {region: 0x96, script: 0x5b, flags: 0x0}, - 1087: {region: 0x166, script: 0x5b, flags: 0x0}, - 1088: {region: 0x166, script: 0x5b, flags: 0x0}, - 1089: {region: 0x130, script: 0x5b, flags: 0x0}, - 1090: {region: 0x166, script: 0x5b, flags: 0x0}, - 1091: {region: 0x85, script: 0x5b, flags: 0x0}, - 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, - 1093: {region: 0x130, script: 0x5b, flags: 0x0}, - 1094: {region: 0x160, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, - 1096: {region: 0x61, script: 0x5b, flags: 0x0}, - 1097: {region: 0x166, script: 0x5b, flags: 0x0}, - 1098: {region: 0x9a, script: 0x22, flags: 0x0}, - 1099: {region: 0x96, script: 0x5b, flags: 0x0}, - 1100: {region: 0x166, script: 0x5b, flags: 0x0}, - 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9c, script: 0xde, flags: 0x0}, - 1103: {region: 0xea, script: 0x5b, flags: 0x0}, - 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, - 1105: {region: 0xdc, script: 0x22, flags: 0x0}, - 1106: {region: 0x166, script: 0x5b, flags: 0x0}, - 1107: {region: 0x166, script: 0x5b, flags: 0x0}, - 1108: {region: 0x166, script: 0x5b, flags: 0x0}, - 1109: {region: 0x166, script: 0x5b, flags: 0x0}, - 1110: {region: 0x166, script: 0x5b, flags: 0x0}, - 1111: {region: 0x166, script: 0x5b, flags: 0x0}, - 1112: {region: 0x166, script: 0x5b, flags: 0x0}, - 1113: {region: 0x166, script: 0x5b, flags: 0x0}, - 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, - 1115: {region: 0x166, script: 0x5b, flags: 0x0}, - 1116: {region: 0x166, script: 0x5b, flags: 0x0}, - 1117: {region: 0x9a, script: 0x53, flags: 0x0}, - 1118: {region: 0x53, script: 0xe4, flags: 0x0}, - 1119: {region: 0xdc, script: 0x22, flags: 0x0}, - 1120: {region: 0xdc, script: 0x22, flags: 0x0}, - 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, - 1122: {region: 0x166, script: 0x5b, flags: 0x0}, - 1123: {region: 0x113, script: 0x5b, flags: 0x0}, - 1124: {region: 0x132, script: 0x5b, flags: 0x0}, - 1125: {region: 0x127, script: 0x5b, flags: 0x0}, - 1126: {region: 0x166, script: 0x5b, flags: 0x0}, - 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x166, script: 0x5b, flags: 0x0}, - 1129: {region: 0x166, script: 0x5b, flags: 0x0}, - 1130: {region: 0x166, script: 0x5b, flags: 0x0}, - 1131: {region: 0x124, script: 0xee, flags: 0x0}, - 1132: {region: 0xdc, script: 0x22, flags: 0x0}, - 1133: {region: 0xdc, script: 0x22, flags: 0x0}, - 1134: {region: 0xdc, script: 0x22, flags: 0x0}, - 1135: {region: 0x70, script: 0x2c, flags: 0x0}, - 1136: {region: 0x166, script: 0x5b, flags: 0x0}, - 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, - 1138: {region: 0x166, script: 0x5b, flags: 0x0}, - 1139: {region: 0x166, script: 0x5b, flags: 0x0}, - 1140: {region: 0x166, script: 0x5b, flags: 0x0}, - 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, - 1142: {region: 0x128, script: 0x5b, flags: 0x0}, - 1143: {region: 0x126, script: 0x5b, flags: 0x0}, - 1144: {region: 0x32, script: 0x5b, flags: 0x0}, - 1145: {region: 0xdc, script: 0x22, flags: 0x0}, - 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, - 1147: {region: 0x166, script: 0x5b, flags: 0x0}, - 1148: {region: 0x166, script: 0x5b, flags: 0x0}, - 1149: {region: 0x32, script: 0x5b, flags: 0x0}, - 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, - 1151: {region: 0x166, script: 0x5b, flags: 0x0}, - 1152: {region: 0x162, script: 0x5b, flags: 0x0}, - 1153: {region: 0x166, script: 0x5b, flags: 0x0}, - 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, - 1155: {region: 0x166, script: 0x5b, flags: 0x0}, - 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, - 1157: {region: 0x166, script: 0x5b, flags: 0x0}, - 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, - 1159: {region: 0x166, script: 0x5b, flags: 0x0}, - 1160: {region: 0x166, script: 0x5b, flags: 0x0}, - 1161: {region: 0x166, script: 0x5b, flags: 0x0}, - 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, - 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, - 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, - 1165: {region: 0x166, script: 0x5, flags: 0x0}, - 1166: {region: 0x162, script: 0x5b, flags: 0x0}, - 1167: {region: 0x88, script: 0x34, flags: 0x0}, - 1168: {region: 0xdc, script: 0x22, flags: 0x0}, - 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, - 1170: {region: 0x43, script: 0xef, flags: 0x0}, - 1171: {region: 0x166, script: 0x5b, flags: 0x0}, - 1172: {region: 0x107, script: 0x20, flags: 0x0}, - 1173: {region: 0x166, script: 0x5b, flags: 0x0}, - 1174: {region: 0x166, script: 0x5b, flags: 0x0}, - 1175: {region: 0x132, script: 0x5b, flags: 0x0}, - 1176: {region: 0x166, script: 0x5b, flags: 0x0}, - 1177: {region: 0x124, script: 0xee, flags: 0x0}, - 1178: {region: 0x32, script: 0x5b, flags: 0x0}, - 1179: {region: 0x166, script: 0x5b, flags: 0x0}, - 1180: {region: 0x166, script: 0x5b, flags: 0x0}, - 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, - 1182: {region: 0x166, script: 0x5b, flags: 0x0}, - 1183: {region: 0x166, script: 0x5b, flags: 0x0}, - 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, - 1185: {region: 0x166, script: 0x5b, flags: 0x0}, - 1187: {region: 0x166, script: 0x5b, flags: 0x0}, - 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, - 1189: {region: 0x53, script: 0xe7, flags: 0x0}, - 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, - 1191: {region: 0x166, script: 0x5b, flags: 0x0}, - 1192: {region: 0x107, script: 0x20, flags: 0x0}, - 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, - 1194: {region: 0x166, script: 0x5b, flags: 0x0}, - 1195: {region: 0x107, script: 0x20, flags: 0x0}, - 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, - 1198: {region: 0x131, script: 0x20, flags: 0x0}, - 1199: {region: 0x76, script: 0x5b, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, - 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x9a, script: 0xe, flags: 0x0}, - 1204: {region: 0xe9, script: 0x5, flags: 0x0}, - 1205: {region: 0x166, script: 0x5b, flags: 0x0}, - 1206: {region: 0x166, script: 0x5b, flags: 0x0}, - 1207: {region: 0x166, script: 0x5b, flags: 0x0}, - 1208: {region: 0x166, script: 0x5b, flags: 0x0}, - 1209: {region: 0x166, script: 0x5b, flags: 0x0}, - 1210: {region: 0x166, script: 0x5b, flags: 0x0}, - 1211: {region: 0x166, script: 0x5b, flags: 0x0}, - 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x166, script: 0x5b, flags: 0x0}, - 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, - 1215: {region: 0x166, script: 0x5b, flags: 0x0}, - 1216: {region: 0x162, script: 0x5b, flags: 0x0}, - 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, - 1218: {region: 0x107, script: 0x5b, flags: 0x0}, - 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, - 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, - 1221: {region: 0x166, script: 0x5b, flags: 0x0}, - 1222: {region: 0x36, script: 0x5b, flags: 0x0}, - 1223: {region: 0x61, script: 0x5b, flags: 0x0}, - 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, - 1225: {region: 0x1, script: 0x5b, flags: 0x0}, - 1226: {region: 0x107, script: 0x5b, flags: 0x0}, - 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, - 1228: {region: 0x130, script: 0x5b, flags: 0x0}, - 1229: {region: 0x166, script: 0x5b, flags: 0x0}, - 1230: {region: 0x36, script: 0x5b, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, - 1232: {region: 0x166, script: 0x5b, flags: 0x0}, - 1233: {region: 0x70, script: 0x2c, flags: 0x0}, - 1234: {region: 0x166, script: 0x5b, flags: 0x0}, - 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, - 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, - 1238: {region: 0x9a, script: 0x22, flags: 0x0}, - 1239: {region: 0x166, script: 0x5b, flags: 0x0}, - 1240: {region: 0x166, script: 0x5b, flags: 0x0}, - 1241: {region: 0x166, script: 0x5b, flags: 0x0}, - 1242: {region: 0x166, script: 0x5b, flags: 0x0}, - 1243: {region: 0x166, script: 0x5b, flags: 0x0}, - 1244: {region: 0x166, script: 0x5b, flags: 0x0}, - 1245: {region: 0x166, script: 0x5b, flags: 0x0}, - 1246: {region: 0x166, script: 0x5b, flags: 0x0}, - 1247: {region: 0x166, script: 0x5b, flags: 0x0}, - 1248: {region: 0x141, script: 0x5b, flags: 0x0}, - 1249: {region: 0x166, script: 0x5b, flags: 0x0}, - 1250: {region: 0x166, script: 0x5b, flags: 0x0}, - 1251: {region: 0xa9, script: 0x5, flags: 0x0}, - 1252: {region: 0x166, script: 0x5b, flags: 0x0}, - 1253: {region: 0x115, script: 0x5b, flags: 0x0}, - 1254: {region: 0x166, script: 0x5b, flags: 0x0}, - 1255: {region: 0x166, script: 0x5b, flags: 0x0}, - 1256: {region: 0x166, script: 0x5b, flags: 0x0}, - 1257: {region: 0x166, script: 0x5b, flags: 0x0}, - 1258: {region: 0x9a, script: 0x22, flags: 0x0}, - 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x166, script: 0x5b, flags: 0x0}, - 1261: {region: 0x166, script: 0x5b, flags: 0x0}, - 1262: {region: 0x41, script: 0x5b, flags: 0x0}, - 1263: {region: 0x166, script: 0x5b, flags: 0x0}, - 1264: {region: 0x12c, script: 0x18, flags: 0x0}, - 1265: {region: 0x166, script: 0x5b, flags: 0x0}, - 1266: {region: 0x162, script: 0x5b, flags: 0x0}, - 1267: {region: 0x166, script: 0x5b, flags: 0x0}, - 1268: {region: 0x12c, script: 0x63, flags: 0x0}, - 1269: {region: 0x12c, script: 0x64, flags: 0x0}, - 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x68, flags: 0x0}, - 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, - 1273: {region: 0x109, script: 0x79, flags: 0x0}, - 1274: {region: 0x9a, script: 0x22, flags: 0x0}, - 1275: {region: 0x132, script: 0x5b, flags: 0x0}, - 1276: {region: 0x166, script: 0x5b, flags: 0x0}, - 1277: {region: 0x9d, script: 0x93, flags: 0x0}, - 1278: {region: 0x166, script: 0x5b, flags: 0x0}, - 1279: {region: 0x15f, script: 0xce, flags: 0x0}, - 1280: {region: 0x166, script: 0x5b, flags: 0x0}, - 1281: {region: 0x166, script: 0x5b, flags: 0x0}, - 1282: {region: 0xdc, script: 0x22, flags: 0x0}, - 1283: {region: 0x166, script: 0x5b, flags: 0x0}, - 1284: {region: 0x166, script: 0x5b, flags: 0x0}, - 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, - 1286: {region: 0x76, script: 0x5b, flags: 0x0}, - 1287: {region: 0x166, script: 0x5b, flags: 0x0}, - 1288: {region: 0x166, script: 0x5b, flags: 0x0}, - 1289: {region: 0x52, script: 0x5b, flags: 0x0}, - 1290: {region: 0x166, script: 0x5b, flags: 0x0}, - 1291: {region: 0x166, script: 0x5b, flags: 0x0}, - 1292: {region: 0x166, script: 0x5b, flags: 0x0}, - 1293: {region: 0x52, script: 0x5b, flags: 0x0}, - 1294: {region: 0x166, script: 0x5b, flags: 0x0}, - 1295: {region: 0x166, script: 0x5b, flags: 0x0}, - 1296: {region: 0x166, script: 0x5b, flags: 0x0}, - 1297: {region: 0x166, script: 0x5b, flags: 0x0}, - 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x166, script: 0x5b, flags: 0x0}, - 1300: {region: 0x166, script: 0x5b, flags: 0x0}, - 1301: {region: 0x166, script: 0x5b, flags: 0x0}, - 1302: {region: 0x166, script: 0x5b, flags: 0x0}, - 1303: {region: 0x166, script: 0x5b, flags: 0x0}, - 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, - 1305: {region: 0x166, script: 0x5b, flags: 0x0}, - 1306: {region: 0x166, script: 0x5b, flags: 0x0}, - 1307: {region: 0x166, script: 0x5b, flags: 0x0}, - 1308: {region: 0x41, script: 0x5b, flags: 0x0}, - 1309: {region: 0x166, script: 0x5b, flags: 0x0}, - 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, - 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x166, script: 0x5b, flags: 0x0}, - 1313: {region: 0x166, script: 0x5b, flags: 0x0}, - 1314: {region: 0x166, script: 0x5b, flags: 0x0}, - 1315: {region: 0x53, script: 0x5b, flags: 0x0}, - 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, - 1318: {region: 0xa9, script: 0x5, flags: 0x0}, - 1319: {region: 0xda, script: 0x5b, flags: 0x0}, - 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, - 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7f, flags: 0x0}, - 1323: {region: 0x166, script: 0x5b, flags: 0x0}, - 1324: {region: 0x123, script: 0x5b, flags: 0x0}, - 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, - 1326: {region: 0x166, script: 0x5b, flags: 0x0}, - 1327: {region: 0x162, script: 0x5b, flags: 0x0}, - 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, -} - -// likelyLangList holds lists info associated with likelyLang. -// Size: 582 bytes, 97 elements -var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9d, script: 0x7, flags: 0x0}, - 1: {region: 0xa2, script: 0x7a, flags: 0x2}, - 2: {region: 0x11d, script: 0x87, flags: 0x2}, - 3: {region: 0x32, script: 0x5b, flags: 0x0}, - 4: {region: 0x9c, script: 0x5, flags: 0x4}, - 5: {region: 0x9d, script: 0x5, flags: 0x4}, - 6: {region: 0x107, script: 0x20, flags: 0x4}, - 7: {region: 0x9d, script: 0x5, flags: 0x2}, - 8: {region: 0x107, script: 0x20, flags: 0x0}, - 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x136, script: 0x5b, flags: 0x0}, - 11: {region: 0x7c, script: 0xd1, flags: 0x2}, - 12: {region: 0x115, script: 0x5b, flags: 0x0}, - 13: {region: 0x85, script: 0x1, flags: 0x2}, - 14: {region: 0x5e, script: 0x1f, flags: 0x0}, - 15: {region: 0x88, script: 0x60, flags: 0x2}, - 16: {region: 0xd7, script: 0x5b, flags: 0x0}, - 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10c, script: 0x5, flags: 0x4}, - 19: {region: 0xaf, script: 0x20, flags: 0x0}, - 20: {region: 0x24, script: 0x5, flags: 0x4}, - 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9d, script: 0x5, flags: 0x4}, - 23: {region: 0xc6, script: 0x5, flags: 0x4}, - 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12c, script: 0x5b, flags: 0x0}, - 26: {region: 0xb1, script: 0x5, flags: 0x4}, - 27: {region: 0x9c, script: 0x5, flags: 0x2}, - 28: {region: 0xa6, script: 0x20, flags: 0x0}, - 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12c, script: 0x5b, flags: 0x4}, - 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12c, script: 0x5b, flags: 0x2}, - 33: {region: 0xdc, script: 0x22, flags: 0x0}, - 34: {region: 0x9a, script: 0x5e, flags: 0x2}, - 35: {region: 0x84, script: 0x5b, flags: 0x0}, - 36: {region: 0x85, script: 0x7e, flags: 0x4}, - 37: {region: 0x85, script: 0x7e, flags: 0x2}, - 38: {region: 0xc6, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x71, flags: 0x4}, - 40: {region: 0x53, script: 0x71, flags: 0x2}, - 41: {region: 0xd1, script: 0x5b, flags: 0x0}, - 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x96, script: 0x5, flags: 0x4}, - 44: {region: 0x9a, script: 0x36, flags: 0x0}, - 45: {region: 0xe9, script: 0x5, flags: 0x4}, - 46: {region: 0xe9, script: 0x5, flags: 0x2}, - 47: {region: 0x9d, script: 0x8d, flags: 0x0}, - 48: {region: 0x53, script: 0x8e, flags: 0x2}, - 49: {region: 0xbb, script: 0xeb, flags: 0x0}, - 50: {region: 0xda, script: 0x5b, flags: 0x4}, - 51: {region: 0xe9, script: 0x5, flags: 0x0}, - 52: {region: 0x9a, script: 0x22, flags: 0x2}, - 53: {region: 0x9a, script: 0x50, flags: 0x2}, - 54: {region: 0x9a, script: 0xd5, flags: 0x2}, - 55: {region: 0x106, script: 0x20, flags: 0x0}, - 56: {region: 0xbe, script: 0x5b, flags: 0x4}, - 57: {region: 0x105, script: 0x5b, flags: 0x4}, - 58: {region: 0x107, script: 0x5b, flags: 0x4}, - 59: {region: 0x12c, script: 0x5b, flags: 0x4}, - 60: {region: 0x125, script: 0x20, flags: 0x0}, - 61: {region: 0xe9, script: 0x5, flags: 0x4}, - 62: {region: 0xe9, script: 0x5, flags: 0x2}, - 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xaf, script: 0x20, flags: 0x4}, - 65: {region: 0xc6, script: 0x20, flags: 0x4}, - 66: {region: 0xaf, script: 0x20, flags: 0x2}, - 67: {region: 0x9a, script: 0xe, flags: 0x0}, - 68: {region: 0xdc, script: 0x22, flags: 0x4}, - 69: {region: 0xdc, script: 0x22, flags: 0x2}, - 70: {region: 0x138, script: 0x5b, flags: 0x0}, - 71: {region: 0x24, script: 0x5, flags: 0x4}, - 72: {region: 0x53, script: 0x20, flags: 0x4}, - 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8e, script: 0x3c, flags: 0x0}, - 75: {region: 0x53, script: 0x3b, flags: 0x4}, - 76: {region: 0x53, script: 0x3b, flags: 0x2}, - 77: {region: 0x53, script: 0x3b, flags: 0x0}, - 78: {region: 0x2f, script: 0x3c, flags: 0x4}, - 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7c, script: 0x3c, flags: 0x4}, - 81: {region: 0x7f, script: 0x3c, flags: 0x4}, - 82: {region: 0x8e, script: 0x3c, flags: 0x4}, - 83: {region: 0x96, script: 0x3c, flags: 0x4}, - 84: {region: 0xc7, script: 0x3c, flags: 0x4}, - 85: {region: 0xd1, script: 0x3c, flags: 0x4}, - 86: {region: 0xe3, script: 0x3c, flags: 0x4}, - 87: {region: 0xe6, script: 0x3c, flags: 0x4}, - 88: {region: 0xe8, script: 0x3c, flags: 0x4}, - 89: {region: 0x117, script: 0x3c, flags: 0x4}, - 90: {region: 0x124, script: 0x3c, flags: 0x4}, - 91: {region: 0x12f, script: 0x3c, flags: 0x4}, - 92: {region: 0x136, script: 0x3c, flags: 0x4}, - 93: {region: 0x13f, script: 0x3c, flags: 0x4}, - 94: {region: 0x12f, script: 0x11, flags: 0x2}, - 95: {region: 0x12f, script: 0x37, flags: 0x2}, - 96: {region: 0x12f, script: 0x3c, flags: 0x2}, -} - -type likelyLangScript struct { - lang uint16 - script uint16 - flags uint8 -} - -// likelyRegion is a lookup table, indexed by regionID, for the most likely -// languages and scripts given incomplete information. If more entries exist -// for a given regionID, lang and script are the index and size respectively -// of the list in likelyRegionList. -// TODO: exclude containers and user-definable regions from the list. -// Size: 2154 bytes, 359 elements -var likelyRegion = [359]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, - 35: {lang: 0x3a, script: 0x5, flags: 0x0}, - 36: {lang: 0x0, script: 0x2, flags: 0x1}, - 39: {lang: 0x2, script: 0x2, flags: 0x1}, - 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 43: {lang: 0x0, script: 0x5b, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, - 48: {lang: 0x367, script: 0x5b, flags: 0x0}, - 49: {lang: 0x444, script: 0x5b, flags: 0x0}, - 50: {lang: 0x58, script: 0x5b, flags: 0x0}, - 51: {lang: 0x6, script: 0x2, flags: 0x1}, - 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5b, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 56: {lang: 0x7e, script: 0x20, flags: 0x0}, - 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5b, flags: 0x0}, - 71: {lang: 0x71, script: 0x20, flags: 0x0}, - 73: {lang: 0x512, script: 0x3e, flags: 0x2}, - 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5b, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 85: {lang: 0x0, script: 0x5b, flags: 0x0}, - 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, - 94: {lang: 0xe, script: 0x2, flags: 0x1}, - 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, - 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, - 99: {lang: 0x1, script: 0x5b, flags: 0x0}, - 100: {lang: 0x101, script: 0x5b, flags: 0x0}, - 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 104: {lang: 0x10, script: 0x2, flags: 0x1}, - 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 107: {lang: 0x140, script: 0x5b, flags: 0x0}, - 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x3a, script: 0x5, flags: 0x0}, - 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 112: {lang: 0x12, script: 0x2, flags: 0x1}, - 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, - 115: {lang: 0x151, script: 0x5b, flags: 0x0}, - 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 119: {lang: 0x158, script: 0x5b, flags: 0x0}, - 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 124: {lang: 0x14, script: 0x2, flags: 0x1}, - 126: {lang: 0x16, script: 0x3, flags: 0x1}, - 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 129: {lang: 0x21, script: 0x5b, flags: 0x0}, - 131: {lang: 0x245, script: 0x5b, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 136: {lang: 0x19, script: 0x2, flags: 0x1}, - 137: {lang: 0x0, script: 0x5b, flags: 0x0}, - 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 142: {lang: 0x529, script: 0x3c, flags: 0x0}, - 143: {lang: 0x0, script: 0x5b, flags: 0x0}, - 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, - 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, - 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, - 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 150: {lang: 0x1b, script: 0x2, flags: 0x1}, - 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 154: {lang: 0x1d, script: 0x3, flags: 0x1}, - 156: {lang: 0x3a, script: 0x5, flags: 0x0}, - 157: {lang: 0x20, script: 0x2, flags: 0x1}, - 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, - 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, - 162: {lang: 0x3a, script: 0x5, flags: 0x0}, - 163: {lang: 0x200, script: 0x49, flags: 0x0}, - 165: {lang: 0x445, script: 0x5b, flags: 0x0}, - 166: {lang: 0x28a, script: 0x20, flags: 0x0}, - 167: {lang: 0x22, script: 0x3, flags: 0x1}, - 169: {lang: 0x25, script: 0x2, flags: 0x1}, - 171: {lang: 0x254, script: 0x54, flags: 0x0}, - 172: {lang: 0x254, script: 0x54, flags: 0x0}, - 173: {lang: 0x3a, script: 0x5, flags: 0x0}, - 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 176: {lang: 0x27, script: 0x2, flags: 0x1}, - 177: {lang: 0x3a, script: 0x5, flags: 0x0}, - 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, - 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, - 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, - 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, - 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, - 186: {lang: 0x3a, script: 0x5, flags: 0x0}, - 187: {lang: 0x29, script: 0x2, flags: 0x1}, - 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 189: {lang: 0x2b, script: 0x2, flags: 0x1}, - 190: {lang: 0x432, script: 0x5b, flags: 0x0}, - 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, - 195: {lang: 0x2d, script: 0x2, flags: 0x1}, - 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, - 197: {lang: 0x2f, script: 0x2, flags: 0x1}, - 198: {lang: 0x31, script: 0x2, flags: 0x1}, - 199: {lang: 0x33, script: 0x2, flags: 0x1}, - 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 202: {lang: 0x35, script: 0x2, flags: 0x1}, - 204: {lang: 0x320, script: 0x5b, flags: 0x0}, - 205: {lang: 0x37, script: 0x3, flags: 0x1}, - 206: {lang: 0x128, script: 0xed, flags: 0x0}, - 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, - 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 211: {lang: 0x16, script: 0x5b, flags: 0x0}, - 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, - 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 218: {lang: 0x367, script: 0x5b, flags: 0x0}, - 219: {lang: 0x347, script: 0x5b, flags: 0x0}, - 220: {lang: 0x351, script: 0x22, flags: 0x0}, - 226: {lang: 0x3a, script: 0x5, flags: 0x0}, - 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 231: {lang: 0x486, script: 0x5b, flags: 0x0}, - 232: {lang: 0x153, script: 0x5b, flags: 0x0}, - 233: {lang: 0x3a, script: 0x3, flags: 0x1}, - 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, - 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 238: {lang: 0x3a, script: 0x5, flags: 0x0}, - 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, - 242: {lang: 0x194, script: 0x5b, flags: 0x0}, - 244: {lang: 0x3a, script: 0x5, flags: 0x0}, - 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 261: {lang: 0x3d, script: 0x2, flags: 0x1}, - 262: {lang: 0x432, script: 0x20, flags: 0x0}, - 263: {lang: 0x3f, script: 0x2, flags: 0x1}, - 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, - 265: {lang: 0x3a, script: 0x5, flags: 0x0}, - 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 268: {lang: 0x3a, script: 0x5, flags: 0x0}, - 269: {lang: 0x41, script: 0x2, flags: 0x1}, - 272: {lang: 0x416, script: 0x5b, flags: 0x0}, - 273: {lang: 0x347, script: 0x5b, flags: 0x0}, - 274: {lang: 0x43, script: 0x2, flags: 0x1}, - 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, - 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 278: {lang: 0x429, script: 0x5b, flags: 0x0}, - 279: {lang: 0x367, script: 0x5b, flags: 0x0}, - 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 285: {lang: 0x45, script: 0x2, flags: 0x1}, - 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 291: {lang: 0x47, script: 0x2, flags: 0x1}, - 292: {lang: 0x49, script: 0x3, flags: 0x1}, - 293: {lang: 0x4c, script: 0x2, flags: 0x1}, - 294: {lang: 0x477, script: 0x5b, flags: 0x0}, - 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 296: {lang: 0x476, script: 0x5b, flags: 0x0}, - 297: {lang: 0x4e, script: 0x2, flags: 0x1}, - 298: {lang: 0x482, script: 0x5b, flags: 0x0}, - 300: {lang: 0x50, script: 0x4, flags: 0x1}, - 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, - 303: {lang: 0x54, script: 0x2, flags: 0x1}, - 304: {lang: 0x445, script: 0x5b, flags: 0x0}, - 305: {lang: 0x56, script: 0x3, flags: 0x1}, - 306: {lang: 0x445, script: 0x5b, flags: 0x0}, - 310: {lang: 0x512, script: 0x3e, flags: 0x2}, - 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, - 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, - 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, - 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, - 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, - 334: {lang: 0x59, script: 0x2, flags: 0x1}, - 351: {lang: 0x3a, script: 0x5, flags: 0x0}, - 352: {lang: 0x5b, script: 0x2, flags: 0x1}, - 357: {lang: 0x423, script: 0x5b, flags: 0x0}, -} - -// likelyRegionList holds lists info associated with likelyRegion. -// Size: 558 bytes, 93 elements -var likelyRegionList = [93]likelyLangScript{ - 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5b, flags: 0x0}, - 2: {lang: 0x431, script: 0x5b, flags: 0x0}, - 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5b, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, - 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xef, flags: 0x0}, - 9: {lang: 0x351, script: 0x22, flags: 0x0}, - 10: {lang: 0x529, script: 0x3b, flags: 0x0}, - 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5b, flags: 0x0}, - 13: {lang: 0x29a, script: 0xee, flags: 0x0}, - 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, - 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5b, flags: 0x0}, - 20: {lang: 0x26a, script: 0x5, flags: 0x2}, - 21: {lang: 0x512, script: 0x3e, flags: 0x2}, - 22: {lang: 0x210, script: 0x2e, flags: 0x0}, - 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5b, flags: 0x0}, - 25: {lang: 0x136, script: 0x34, flags: 0x0}, - 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, - 28: {lang: 0x31f, script: 0x5, flags: 0x0}, - 29: {lang: 0x1be, script: 0x22, flags: 0x0}, - 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x76, flags: 0x0}, - 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5b, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, - 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xee, flags: 0x0}, - 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, - 40: {lang: 0x226, script: 0xee, flags: 0x0}, - 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, - 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, - 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5b, flags: 0x0}, - 47: {lang: 0x331, script: 0x76, flags: 0x0}, - 48: {lang: 0x213, script: 0x5b, flags: 0x0}, - 49: {lang: 0x30b, script: 0x20, flags: 0x0}, - 50: {lang: 0x242, script: 0x5, flags: 0x0}, - 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, - 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 57: {lang: 0x88, script: 0x22, flags: 0x0}, - 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, - 62: {lang: 0x7e, script: 0x20, flags: 0x0}, - 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5b, flags: 0x0}, - 65: {lang: 0x444, script: 0x5b, flags: 0x0}, - 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5b, flags: 0x0}, - 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, - 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xee, flags: 0x0}, - 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x76, flags: 0x0}, - 76: {lang: 0x467, script: 0x20, flags: 0x0}, - 77: {lang: 0x148, script: 0x5, flags: 0x0}, - 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, - 81: {lang: 0x58, script: 0x5, flags: 0x0}, - 82: {lang: 0x219, script: 0x20, flags: 0x0}, - 83: {lang: 0x81, script: 0x34, flags: 0x0}, - 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, - 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, - 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, - 89: {lang: 0x431, script: 0x5b, flags: 0x0}, - 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 92: {lang: 0x446, script: 0x5, flags: 0x0}, -} - -type likelyTag struct { - lang uint16 - region uint16 - script uint16 -} - -// Size: 198 bytes, 33 elements -var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd7, script: 0x5b}, - 2: {lang: 0x139, region: 0x136, script: 0x5b}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, - 4: {lang: 0x139, region: 0x2f, script: 0x5b}, - 5: {lang: 0x139, region: 0xd7, script: 0x5b}, - 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, - 7: {lang: 0x445, region: 0x130, script: 0x5b}, - 8: {lang: 0x3a, region: 0x6c, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5b}, - 10: {lang: 0x139, region: 0x162, script: 0x5b}, - 11: {lang: 0x139, region: 0x136, script: 0x5b}, - 12: {lang: 0x139, region: 0x136, script: 0x5b}, - 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, - 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x9a, script: 0x22}, - 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, - 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, - 18: {lang: 0x139, region: 0x2f, script: 0x5b}, - 19: {lang: 0x139, region: 0xe7, script: 0x5b}, - 20: {lang: 0x139, region: 0x8b, script: 0x5b}, - 21: {lang: 0x41b, region: 0x143, script: 0x5b}, - 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, - 24: {lang: 0x3a, region: 0x109, script: 0x5}, - 25: {lang: 0x3e2, region: 0x107, script: 0x20}, - 26: {lang: 0x3e2, region: 0x107, script: 0x20}, - 27: {lang: 0x139, region: 0x7c, script: 0x5b}, - 28: {lang: 0x10d, region: 0x61, script: 0x5b}, - 29: {lang: 0x139, region: 0xd7, script: 0x5b}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, - 31: {lang: 0x139, region: 0x9b, script: 0x5b}, - 32: {lang: 0x139, region: 0x7c, script: 0x5b}, -} - -// Size: 264 bytes, 33 elements -var regionContainment = [33]uint64{ - // Entry 0 - 1F - 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, - 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, - 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, - 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, - 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, - 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, - 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, - // Entry 20 - 3F - 0x0000000100000000, -} - -// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -// where each set holds all groupings that are directly connected in a region -// containment graph. -// Size: 359 bytes, 359 elements -var regionInclusion = [359]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, - 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, - 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, - 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, - 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, - 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, - 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, - 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, - // Entry 40 - 7F - 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, - 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, - 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, - 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, - 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, - 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, - 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, - // Entry 80 - BF - 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, - 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, - 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, - 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, - 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, - 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, - 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, - 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, - // Entry C0 - FF - 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, - 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, - 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, - 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, - 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, - 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, - 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - // Entry 100 - 13F - 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, - 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, - 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, - 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, - 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, - 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, - 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, - 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, - // Entry 140 - 17F - 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, - 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, -} - -// regionInclusionBits is an array of bit vectors where every vector represents -// a set of region groupings. These sets are used to compute the distance -// between two regions for the purpose of language matching. -// Size: 584 bytes, 73 elements -var regionInclusionBits = [73]uint64{ - // Entry 0 - 1F - 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, - 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, - 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, - 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, - 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, - 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, - 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, - 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, - // Entry 20 - 3F - 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, - 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, - 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, - 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, - 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, - 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, - 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, - // Entry 40 - 5F - 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, - 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, - 0x0000000102020001, -} - -// regionInclusionNext marks, for each entry in regionInclusionBits, the set of -// all groups that are reachable from the groups set in the respective entry. -// Size: 73 bytes, 73 elements -var regionInclusionNext = [73]uint8{ - // Entry 0 - 3F - 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, - 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, - 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, - 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, - 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, - 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, - 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, - 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, - // Entry 40 - 7F - 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, - 0x43, -} - -type parentRel struct { - lang uint16 - script uint16 - maxScript uint16 - toRegion uint16 - fromRegion []uint16 -} - -// Size: 414 bytes, 5 elements -var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, -} - -// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/embed/vendor/golang.org/x/text/internal/language/tags.go b/embed/vendor/golang.org/x/text/internal/language/tags.go deleted file mode 100644 index e7afd318..00000000 --- a/embed/vendor/golang.org/x/text/internal/language/tags.go +++ /dev/null @@ -1,48 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func MustParse(s string) Tag { - t, err := Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. -// It simplifies safe initialization of Base values. -func MustParseBase(s string) Language { - b, err := ParseBase(s) - if err != nil { - panic(err) - } - return b -} - -// MustParseScript is like ParseScript, but panics if the given script cannot be -// parsed. It simplifies safe initialization of Script values. -func MustParseScript(s string) Script { - scr, err := ParseScript(s) - if err != nil { - panic(err) - } - return scr -} - -// MustParseRegion is like ParseRegion, but panics if the given region cannot be -// parsed. It simplifies safe initialization of Region values. -func MustParseRegion(s string) Region { - r, err := ParseRegion(s) - if err != nil { - panic(err) - } - return r -} - -// Und is the root language. -var Und Tag diff --git a/embed/vendor/golang.org/x/text/internal/match.go b/embed/vendor/golang.org/x/text/internal/match.go deleted file mode 100644 index 1cc004a6..00000000 --- a/embed/vendor/golang.org/x/text/internal/match.go +++ /dev/null @@ -1,67 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package internal - -// This file contains matchers that implement CLDR inheritance. -// -// See https://unicode.org/reports/tr35/#Locale_Inheritance. -// -// Some of the inheritance described in this document is already handled by -// the cldr package. - -import ( - "golang.org/x/text/language" -) - -// TODO: consider if (some of the) matching algorithm needs to be public after -// getting some feel about what is generic and what is specific. - -// NewInheritanceMatcher returns a matcher that matches based on the inheritance -// chain. -// -// The matcher uses canonicalization and the parent relationship to find a -// match. The resulting match will always be either Und or a language with the -// same language and script as the requested language. It will not match -// languages for which there is understood to be mutual or one-directional -// intelligibility. -// -// A Match will indicate an Exact match if the language matches after -// canonicalization and High if the matched tag is a parent. -func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { - tags := &InheritanceMatcher{make(map[language.Tag]int)} - for i, tag := range t { - ct, err := language.All.Canonicalize(tag) - if err != nil { - ct = tag - } - tags.index[ct] = i - } - return tags -} - -type InheritanceMatcher struct { - index map[language.Tag]int -} - -func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { - for _, t := range want { - ct, err := language.All.Canonicalize(t) - if err != nil { - ct = t - } - conf := language.Exact - for { - if index, ok := m.index[ct]; ok { - return ct, index, conf - } - if ct == language.Und { - break - } - ct = ct.Parent() - conf = language.High - } - } - return language.Und, 0, language.No -} diff --git a/embed/vendor/golang.org/x/text/internal/tag/tag.go b/embed/vendor/golang.org/x/text/internal/tag/tag.go deleted file mode 100644 index b5d34889..00000000 --- a/embed/vendor/golang.org/x/text/internal/tag/tag.go +++ /dev/null @@ -1,100 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package tag contains functionality handling tags and related data. -package tag // import "golang.org/x/text/internal/tag" - -import "sort" - -// An Index converts tags to a compact numeric value. -// -// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can -// be used to store additional information about the tag. -type Index string - -// Elem returns the element data at the given index. -func (s Index) Elem(x int) string { - return string(s[x*4 : x*4+4]) -} - -// Index reports the index of the given key or -1 if it could not be found. -// Only the first len(key) bytes from the start of the 4-byte entries will be -// considered for the search and the first match in Index will be returned. -func (s Index) Index(key []byte) int { - n := len(key) - // search the index of the first entry with an equal or higher value than - // key in s. - index := sort.Search(len(s)/4, func(i int) bool { - return cmp(s[i*4:i*4+n], key) != -1 - }) - i := index * 4 - if cmp(s[i:i+len(key)], key) != 0 { - return -1 - } - return index -} - -// Next finds the next occurrence of key after index x, which must have been -// obtained from a call to Index using the same key. It returns x+1 or -1. -func (s Index) Next(key []byte, x int) int { - if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { - return x - } - return -1 -} - -// cmp returns an integer comparing a and b lexicographically. -func cmp(a Index, b []byte) int { - n := len(a) - if len(b) < n { - n = len(b) - } - for i, c := range b[:n] { - switch { - case a[i] > c: - return 1 - case a[i] < c: - return -1 - } - } - switch { - case len(a) < len(b): - return -1 - case len(a) > len(b): - return 1 - } - return 0 -} - -// Compare returns an integer comparing a and b lexicographically. -func Compare(a string, b []byte) int { - return cmp(Index(a), b) -} - -// FixCase reformats b to the same pattern of cases as form. -// If returns false if string b is malformed. -func FixCase(form string, b []byte) bool { - if len(form) != len(b) { - return false - } - for i, c := range b { - if form[i] <= 'Z' { - if c >= 'a' { - c -= 'z' - 'Z' - } - if c < 'A' || 'Z' < c { - return false - } - } else { - if c <= 'Z' { - c += 'z' - 'Z' - } - if c < 'a' || 'z' < c { - return false - } - } - b[i] = c - } - return true -} diff --git a/embed/vendor/golang.org/x/text/language/coverage.go b/embed/vendor/golang.org/x/text/language/coverage.go deleted file mode 100644 index a24fd1a4..00000000 --- a/embed/vendor/golang.org/x/text/language/coverage.go +++ /dev/null @@ -1,187 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "fmt" - "sort" - - "golang.org/x/text/internal/language" -) - -// The Coverage interface is used to define the level of coverage of an -// internationalization service. Note that not all types are supported by all -// services. As lists may be generated on the fly, it is recommended that users -// of a Coverage cache the results. -type Coverage interface { - // Tags returns the list of supported tags. - Tags() []Tag - - // BaseLanguages returns the list of supported base languages. - BaseLanguages() []Base - - // Scripts returns the list of supported scripts. - Scripts() []Script - - // Regions returns the list of supported regions. - Regions() []Region -} - -var ( - // Supported defines a Coverage that lists all supported subtags. Tags - // always returns nil. - Supported Coverage = allSubtags{} -) - -// TODO: -// - Support Variants, numbering systems. -// - CLDR coverage levels. -// - Set of common tags defined in this package. - -type allSubtags struct{} - -// Regions returns the list of supported regions. As all regions are in a -// consecutive range, it simply returns a slice of numbers in increasing order. -// The "undefined" region is not returned. -func (s allSubtags) Regions() []Region { - reg := make([]Region, language.NumRegions) - for i := range reg { - reg[i] = Region{language.Region(i + 1)} - } - return reg -} - -// Scripts returns the list of supported scripts. As all scripts are in a -// consecutive range, it simply returns a slice of numbers in increasing order. -// The "undefined" script is not returned. -func (s allSubtags) Scripts() []Script { - scr := make([]Script, language.NumScripts) - for i := range scr { - scr[i] = Script{language.Script(i + 1)} - } - return scr -} - -// BaseLanguages returns the list of all supported base languages. It generates -// the list by traversing the internal structures. -func (s allSubtags) BaseLanguages() []Base { - bs := language.BaseLanguages() - base := make([]Base, len(bs)) - for i, b := range bs { - base[i] = Base{b} - } - return base -} - -// Tags always returns nil. -func (s allSubtags) Tags() []Tag { - return nil -} - -// coverage is used by NewCoverage which is used as a convenient way for -// creating Coverage implementations for partially defined data. Very often a -// package will only need to define a subset of slices. coverage provides a -// convenient way to do this. Moreover, packages using NewCoverage, instead of -// their own implementation, will not break if later new slice types are added. -type coverage struct { - tags func() []Tag - bases func() []Base - scripts func() []Script - regions func() []Region -} - -func (s *coverage) Tags() []Tag { - if s.tags == nil { - return nil - } - return s.tags() -} - -// bases implements sort.Interface and is used to sort base languages. -type bases []Base - -func (b bases) Len() int { - return len(b) -} - -func (b bases) Swap(i, j int) { - b[i], b[j] = b[j], b[i] -} - -func (b bases) Less(i, j int) bool { - return b[i].langID < b[j].langID -} - -// BaseLanguages returns the result from calling s.bases if it is specified or -// otherwise derives the set of supported base languages from tags. -func (s *coverage) BaseLanguages() []Base { - if s.bases == nil { - tags := s.Tags() - if len(tags) == 0 { - return nil - } - a := make([]Base, len(tags)) - for i, t := range tags { - a[i] = Base{language.Language(t.lang())} - } - sort.Sort(bases(a)) - k := 0 - for i := 1; i < len(a); i++ { - if a[k] != a[i] { - k++ - a[k] = a[i] - } - } - return a[:k+1] - } - return s.bases() -} - -func (s *coverage) Scripts() []Script { - if s.scripts == nil { - return nil - } - return s.scripts() -} - -func (s *coverage) Regions() []Region { - if s.regions == nil { - return nil - } - return s.regions() -} - -// NewCoverage returns a Coverage for the given lists. It is typically used by -// packages providing internationalization services to define their level of -// coverage. A list may be of type []T or func() []T, where T is either Tag, -// Base, Script or Region. The returned Coverage derives the value for Bases -// from Tags if no func or slice for []Base is specified. For other unspecified -// types the returned Coverage will return nil for the respective methods. -func NewCoverage(list ...interface{}) Coverage { - s := &coverage{} - for _, x := range list { - switch v := x.(type) { - case func() []Base: - s.bases = v - case func() []Script: - s.scripts = v - case func() []Region: - s.regions = v - case func() []Tag: - s.tags = v - case []Base: - s.bases = func() []Base { return v } - case []Script: - s.scripts = func() []Script { return v } - case []Region: - s.regions = func() []Region { return v } - case []Tag: - s.tags = func() []Tag { return v } - default: - panic(fmt.Sprintf("language: unsupported set type %T", v)) - } - } - return s -} diff --git a/embed/vendor/golang.org/x/text/language/doc.go b/embed/vendor/golang.org/x/text/language/doc.go deleted file mode 100644 index 212b77c9..00000000 --- a/embed/vendor/golang.org/x/text/language/doc.go +++ /dev/null @@ -1,98 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package language implements BCP 47 language tags and related functionality. -// -// The most important function of package language is to match a list of -// user-preferred languages to a list of supported languages. -// It alleviates the developer of dealing with the complexity of this process -// and provides the user with the best experience -// (see https://blog.golang.org/matchlang). -// -// # Matching preferred against supported languages -// -// A Matcher for an application that supports English, Australian English, -// Danish, and standard Mandarin can be created as follows: -// -// var matcher = language.NewMatcher([]language.Tag{ -// language.English, // The first language is used as fallback. -// language.MustParse("en-AU"), -// language.Danish, -// language.Chinese, -// }) -// -// This list of supported languages is typically implied by the languages for -// which there exists translations of the user interface. -// -// User-preferred languages usually come as a comma-separated list of BCP 47 -// language tags. -// The MatchString finds best matches for such strings: -// -// handler(w http.ResponseWriter, r *http.Request) { -// lang, _ := r.Cookie("lang") -// accept := r.Header.Get("Accept-Language") -// tag, _ := language.MatchStrings(matcher, lang.String(), accept) -// -// // tag should now be used for the initialization of any -// // locale-specific service. -// } -// -// The Matcher's Match method can be used to match Tags directly. -// -// Matchers are aware of the intricacies of equivalence between languages, such -// as deprecated subtags, legacy tags, macro languages, mutual -// intelligibility between scripts and languages, and transparently passing -// BCP 47 user configuration. -// For instance, it will know that a reader of Bokmål Danish can read Norwegian -// and will know that Cantonese ("yue") is a good match for "zh-HK". -// -// # Using match results -// -// To guarantee a consistent user experience to the user it is important to -// use the same language tag for the selection of any locale-specific services. -// For example, it is utterly confusing to substitute spelled-out numbers -// or dates in one language in text of another language. -// More subtly confusing is using the wrong sorting order or casing -// algorithm for a certain language. -// -// All the packages in x/text that provide locale-specific services -// (e.g. collate, cases) should be initialized with the tag that was -// obtained at the start of an interaction with the user. -// -// Note that Tag that is returned by Match and MatchString may differ from any -// of the supported languages, as it may contain carried over settings from -// the user tags. -// This may be inconvenient when your application has some additional -// locale-specific data for your supported languages. -// Match and MatchString both return the index of the matched supported tag -// to simplify associating such data with the matched tag. -// -// # Canonicalization -// -// If one uses the Matcher to compare languages one does not need to -// worry about canonicalization. -// -// The meaning of a Tag varies per application. The language package -// therefore delays canonicalization and preserves information as much -// as possible. The Matcher, however, will always take into account that -// two different tags may represent the same language. -// -// By default, only legacy and deprecated tags are converted into their -// canonical equivalent. All other information is preserved. This approach makes -// the confidence scores more accurate and allows matchers to distinguish -// between variants that are otherwise lost. -// -// As a consequence, two tags that should be treated as identical according to -// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The -// Matcher handles such distinctions, though, and is aware of the -// equivalence relations. The CanonType type can be used to alter the -// canonicalization form. -// -// # References -// -// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 -package language // import "golang.org/x/text/language" - -// TODO: explanation on how to match languages for your own locale-specific -// service. diff --git a/embed/vendor/golang.org/x/text/language/language.go b/embed/vendor/golang.org/x/text/language/language.go deleted file mode 100644 index 4d9c6612..00000000 --- a/embed/vendor/golang.org/x/text/language/language.go +++ /dev/null @@ -1,605 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go -output tables.go - -package language - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "strings" - - "golang.org/x/text/internal/language" - "golang.org/x/text/internal/language/compact" -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. -type Tag compact.Tag - -func makeTag(t language.Tag) (tag Tag) { - return Tag(compact.Make(t)) -} - -func (t *Tag) tag() language.Tag { - return (*compact.Tag)(t).Tag() -} - -func (t *Tag) isCompact() bool { - return (*compact.Tag)(t).IsCompact() -} - -// TODO: improve performance. -func (t *Tag) lang() language.Language { return t.tag().LangID } -func (t *Tag) region() language.Region { return t.tag().RegionID } -func (t *Tag) script() language.Script { return t.tag().ScriptID } - -// Make is a convenience wrapper for Parse that omits the error. -// In case of an error, a sensible default is returned. -func Make(s string) Tag { - return Default.Make(s) -} - -// Make is a convenience wrapper for c.Parse that omits the error. -// In case of an error, a sensible default is returned. -func (c CanonType) Make(s string) Tag { - t, _ := c.Parse(s) - return t -} - -// Raw returns the raw base language, script and region, without making an -// attempt to infer their values. -func (t Tag) Raw() (b Base, s Script, r Region) { - tt := t.tag() - return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - return compact.Tag(t).IsRoot() -} - -// CanonType can be used to enable or disable various types of canonicalization. -type CanonType int - -const ( - // Replace deprecated base languages with their preferred replacements. - DeprecatedBase CanonType = 1 << iota - // Replace deprecated scripts with their preferred replacements. - DeprecatedScript - // Replace deprecated regions with their preferred replacements. - DeprecatedRegion - // Remove redundant scripts. - SuppressScript - // Normalize legacy encodings. This includes legacy languages defined in - // CLDR as well as bibliographic codes defined in ISO-639. - Legacy - // Map the dominant language of a macro language group to the macro language - // subtag. For example cmn -> zh. - Macro - // The CLDR flag should be used if full compatibility with CLDR is required. - // There are a few cases where language.Tag may differ from CLDR. To follow all - // of CLDR's suggestions, use All|CLDR. - CLDR - - // Raw can be used to Compose or Parse without Canonicalization. - Raw CanonType = 0 - - // Replace all deprecated tags with their preferred replacements. - Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion - - // All canonicalizations recommended by BCP 47. - BCP47 = Deprecated | SuppressScript - - // All canonicalizations. - All = BCP47 | Legacy | Macro - - // Default is the canonicalization used by Parse, Make and Compose. To - // preserve as much information as possible, canonicalizations that remove - // potentially valuable information are not included. The Matcher is - // designed to recognize similar tags that would be the same if - // they were canonicalized using All. - Default = Deprecated | Legacy - - canonLang = DeprecatedBase | Legacy | Macro - - // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. -) - -// canonicalize returns the canonicalized equivalent of the tag and -// whether there was any change. -func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { - if c == Raw { - return t, false - } - changed := false - if c&SuppressScript != 0 { - if t.LangID.SuppressScript() == t.ScriptID { - t.ScriptID = 0 - changed = true - } - } - if c&canonLang != 0 { - for { - if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { - switch aliasType { - case language.Legacy: - if c&Legacy != 0 { - if t.LangID == _sh && t.ScriptID == 0 { - t.ScriptID = _Latn - } - t.LangID = l - changed = true - } - case language.Macro: - if c&Macro != 0 { - // We deviate here from CLDR. The mapping "nb" -> "no" - // qualifies as a typical Macro language mapping. However, - // for legacy reasons, CLDR maps "no", the macro language - // code for Norwegian, to the dominant variant "nb". This - // change is currently under consideration for CLDR as well. - // See https://unicode.org/cldr/trac/ticket/2698 and also - // https://unicode.org/cldr/trac/ticket/1790 for some of the - // practical implications. TODO: this check could be removed - // if CLDR adopts this change. - if c&CLDR == 0 || t.LangID != _nb { - changed = true - t.LangID = l - } - } - case language.Deprecated: - if c&DeprecatedBase != 0 { - if t.LangID == _mo && t.RegionID == 0 { - t.RegionID = _MD - } - t.LangID = l - changed = true - // Other canonicalization types may still apply. - continue - } - } - } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { - t.LangID = _nb - changed = true - } - break - } - } - if c&DeprecatedScript != 0 { - if t.ScriptID == _Qaai { - changed = true - t.ScriptID = _Zinh - } - } - if c&DeprecatedRegion != 0 { - if r := t.RegionID.Canonicalize(); r != t.RegionID { - changed = true - t.RegionID = r - } - } - return t, changed -} - -// Canonicalize returns the canonicalized equivalent of the tag. -func (c CanonType) Canonicalize(t Tag) (Tag, error) { - // First try fast path. - if t.isCompact() { - if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { - return t, nil - } - } - // It is unlikely that one will canonicalize a tag after matching. So do - // a slow but simple approach here. - if tag, changed := canonicalize(c, t.tag()); changed { - tag.RemakeString() - return makeTag(tag), nil - } - return t, nil - -} - -// Confidence indicates the level of certainty for a given return value. -// For example, Serbian may be written in Cyrillic or Latin script. -// The confidence level indicates whether a value was explicitly specified, -// whether it is typically the only possible value, or whether there is -// an ambiguity. -type Confidence int - -const ( - No Confidence = iota // full confidence that there was no match - Low // most likely value picked out of a set of alternatives - High // value is generally assumed to be the correct match - Exact // exact match or explicitly specified value -) - -var confName = []string{"No", "Low", "High", "Exact"} - -func (c Confidence) String() string { - return confName[c] -} - -// String returns the canonical string representation of the language tag. -func (t Tag) String() string { - return t.tag().String() -} - -// MarshalText implements encoding.TextMarshaler. -func (t Tag) MarshalText() (text []byte, err error) { - return t.tag().MarshalText() -} - -// UnmarshalText implements encoding.TextUnmarshaler. -func (t *Tag) UnmarshalText(text []byte) error { - var tag language.Tag - err := tag.UnmarshalText(text) - *t = makeTag(tag) - return err -} - -// Base returns the base language of the language tag. If the base language is -// unspecified, an attempt will be made to infer it from the context. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Base() (Base, Confidence) { - if b := t.lang(); b != 0 { - return Base{b}, Exact - } - tt := t.tag() - c := High - if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { - c = Low - } - if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { - return Base{tag.LangID}, c - } - return Base{0}, No -} - -// Script infers the script for the language tag. If it was not explicitly given, it will infer -// a most likely candidate. -// If more than one script is commonly used for a language, the most likely one -// is returned with a low confidence indication. For example, it returns (Cyrl, Low) -// for Serbian. -// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) -// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks -// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. -// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for -// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. -// Note that an inferred script is never guaranteed to be the correct one. Latin is -// almost exclusively used for Afrikaans, but Arabic has been used for some texts -// in the past. Also, the script that is commonly used may change over time. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Script() (Script, Confidence) { - if scr := t.script(); scr != 0 { - return Script{scr}, Exact - } - tt := t.tag() - sc, c := language.Script(_Zzzz), No - if scr := tt.LangID.SuppressScript(); scr != 0 { - // Note: it is not always the case that a language with a suppress - // script value is only written in one script (e.g. kk, ms, pa). - if tt.RegionID == 0 { - return Script{scr}, High - } - sc, c = scr, High - } - if tag, err := tt.Maximize(); err == nil { - if tag.ScriptID != sc { - sc, c = tag.ScriptID, Low - } - } else { - tt, _ = canonicalize(Deprecated|Macro, tt) - if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { - sc, c = tag.ScriptID, Low - } - } - return Script{sc}, c -} - -// Region returns the region for the language tag. If it was not explicitly given, it will -// infer a most likely candidate from the context. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Region() (Region, Confidence) { - if r := t.region(); r != 0 { - return Region{r}, Exact - } - tt := t.tag() - if tt, err := tt.Maximize(); err == nil { - return Region{tt.RegionID}, Low // TODO: differentiate between high and low. - } - tt, _ = canonicalize(Deprecated|Macro, tt) - if tag, err := tt.Maximize(); err == nil { - return Region{tag.RegionID}, Low - } - return Region{_ZZ}, No // TODO: return world instead of undetermined? -} - -// Variants returns the variants specified explicitly for this language tag. -// or nil if no variant was specified. -func (t Tag) Variants() []Variant { - if !compact.Tag(t).MayHaveVariants() { - return nil - } - v := []Variant{} - x, str := "", t.tag().Variants() - for str != "" { - x, str = nextToken(str) - v = append(v, Variant{x}) - } - return v -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -// -// Parent returns a tag for a less specific language that is mutually -// intelligible or Und if there is no such language. This may not be the same as -// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" -// is "zh-Hant", and the parent of "zh-Hant" is "und". -func (t Tag) Parent() Tag { - return Tag(compact.Tag(t).Parent()) -} - -// nextToken returns token t and the rest of the string. -func nextToken(s string) (t, tail string) { - p := strings.Index(s[1:], "-") - if p == -1 { - return s[1:], "" - } - p++ - return s[1:p], s[p:] -} - -// Extension is a single BCP 47 extension. -type Extension struct { - s string -} - -// String returns the string representation of the extension, including the -// type tag. -func (e Extension) String() string { - return e.s -} - -// ParseExtension parses s as an extension and returns it on success. -func ParseExtension(s string) (e Extension, err error) { - ext, err := language.ParseExtension(s) - return Extension{ext}, err -} - -// Type returns the one-byte extension type of e. It returns 0 for the zero -// exception. -func (e Extension) Type() byte { - if e.s == "" { - return 0 - } - return e.s[0] -} - -// Tokens returns the list of tokens of e. -func (e Extension) Tokens() []string { - return strings.Split(e.s, "-") -} - -// Extension returns the extension of type x for tag t. It will return -// false for ok if t does not have the requested extension. The returned -// extension will be invalid in this case. -func (t Tag) Extension(x byte) (ext Extension, ok bool) { - if !compact.Tag(t).MayHaveExtensions() { - return Extension{}, false - } - e, ok := t.tag().Extension(x) - return Extension{e}, ok -} - -// Extensions returns all extensions of t. -func (t Tag) Extensions() []Extension { - if !compact.Tag(t).MayHaveExtensions() { - return nil - } - e := []Extension{} - for _, ext := range t.tag().Extensions() { - e = append(e, Extension{ext}) - } - return e -} - -// TypeForKey returns the type associated with the given key, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// TypeForKey will traverse the inheritance chain to get the correct value. -// -// If there are multiple types associated with a key, only the first will be -// returned. If there is no type associated with a key, it returns the empty -// string. -func (t Tag) TypeForKey(key string) string { - if !compact.Tag(t).MayHaveExtensions() { - if key != "rg" && key != "va" { - return "" - } - } - return t.tag().TypeForKey(key) -} - -// SetTypeForKey returns a new Tag with the key set to type, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// An empty value removes an existing pair with the same key. -func (t Tag) SetTypeForKey(key, value string) (Tag, error) { - tt, err := t.tag().SetTypeForKey(key, value) - return makeTag(tt), err -} - -// NumCompactTags is the number of compact tags. The maximum tag is -// NumCompactTags-1. -const NumCompactTags = compact.NumCompactTags - -// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags -// for which data exists in the text repository.The index will change over time -// and should not be stored in persistent storage. If t does not match a compact -// index, exact will be false and the compact index will be returned for the -// first match after repeatedly taking the Parent of t. -func CompactIndex(t Tag) (index int, exact bool) { - id, exact := compact.LanguageID(compact.Tag(t)) - return int(id), exact -} - -var root = language.Tag{} - -// Base is an ISO 639 language code, used for encoding the base language -// of a language tag. -type Base struct { - langID language.Language -} - -// ParseBase parses a 2- or 3-letter ISO 639 code. -// It returns a ValueError if s is a well-formed but unknown language identifier -// or another error if another error occurred. -func ParseBase(s string) (Base, error) { - l, err := language.ParseBase(s) - return Base{l}, err -} - -// String returns the BCP 47 representation of the base language. -func (b Base) String() string { - return b.langID.String() -} - -// ISO3 returns the ISO 639-3 language code. -func (b Base) ISO3() string { - return b.langID.ISO3() -} - -// IsPrivateUse reports whether this language code is reserved for private use. -func (b Base) IsPrivateUse() bool { - return b.langID.IsPrivateUse() -} - -// Script is a 4-letter ISO 15924 code for representing scripts. -// It is idiomatically represented in title case. -type Script struct { - scriptID language.Script -} - -// ParseScript parses a 4-letter ISO 15924 code. -// It returns a ValueError if s is a well-formed but unknown script identifier -// or another error if another error occurred. -func ParseScript(s string) (Script, error) { - sc, err := language.ParseScript(s) - return Script{sc}, err -} - -// String returns the script code in title case. -// It returns "Zzzz" for an unspecified script. -func (s Script) String() string { - return s.scriptID.String() -} - -// IsPrivateUse reports whether this script code is reserved for private use. -func (s Script) IsPrivateUse() bool { - return s.scriptID.IsPrivateUse() -} - -// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. -type Region struct { - regionID language.Region -} - -// EncodeM49 returns the Region for the given UN M.49 code. -// It returns an error if r is not a valid code. -func EncodeM49(r int) (Region, error) { - rid, err := language.EncodeM49(r) - return Region{rid}, err -} - -// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. -// It returns a ValueError if s is a well-formed but unknown region identifier -// or another error if another error occurred. -func ParseRegion(s string) (Region, error) { - r, err := language.ParseRegion(s) - return Region{r}, err -} - -// String returns the BCP 47 representation for the region. -// It returns "ZZ" for an unspecified region. -func (r Region) String() string { - return r.regionID.String() -} - -// ISO3 returns the 3-letter ISO code of r. -// Note that not all regions have a 3-letter ISO code. -// In such cases this method returns "ZZZ". -func (r Region) ISO3() string { - return r.regionID.ISO3() -} - -// M49 returns the UN M.49 encoding of r, or 0 if this encoding -// is not defined for r. -func (r Region) M49() int { - return r.regionID.M49() -} - -// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This -// may include private-use tags that are assigned by CLDR and used in this -// implementation. So IsPrivateUse and IsCountry can be simultaneously true. -func (r Region) IsPrivateUse() bool { - return r.regionID.IsPrivateUse() -} - -// IsCountry returns whether this region is a country or autonomous area. This -// includes non-standard definitions from CLDR. -func (r Region) IsCountry() bool { - return r.regionID.IsCountry() -} - -// IsGroup returns whether this region defines a collection of regions. This -// includes non-standard definitions from CLDR. -func (r Region) IsGroup() bool { - return r.regionID.IsGroup() -} - -// Contains returns whether Region c is contained by Region r. It returns true -// if c == r. -func (r Region) Contains(c Region) bool { - return r.regionID.Contains(c.regionID) -} - -// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. -// In all other cases it returns either the region itself or an error. -// -// This method may return an error for a region for which there exists a -// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The -// region will already be canonicalized it was obtained from a Tag that was -// obtained using any of the default methods. -func (r Region) TLD() (Region, error) { - tld, err := r.regionID.TLD() - return Region{tld}, err -} - -// Canonicalize returns the region or a possible replacement if the region is -// deprecated. It will not return a replacement for deprecated regions that -// are split into multiple regions. -func (r Region) Canonicalize() Region { - return Region{r.regionID.Canonicalize()} -} - -// Variant represents a registered variant of a language as defined by BCP 47. -type Variant struct { - variant string -} - -// ParseVariant parses and returns a Variant. An error is returned if s is not -// a valid variant. -func ParseVariant(s string) (Variant, error) { - v, err := language.ParseVariant(s) - return Variant{v.String()}, err -} - -// String returns the string representation of the variant. -func (v Variant) String() string { - return v.variant -} diff --git a/embed/vendor/golang.org/x/text/language/match.go b/embed/vendor/golang.org/x/text/language/match.go deleted file mode 100644 index 1153baf2..00000000 --- a/embed/vendor/golang.org/x/text/language/match.go +++ /dev/null @@ -1,735 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "errors" - "strings" - - "golang.org/x/text/internal/language" -) - -// A MatchOption configures a Matcher. -type MatchOption func(*matcher) - -// PreferSameScript will, in the absence of a match, result in the first -// preferred tag with the same script as a supported tag to match this supported -// tag. The default is currently true, but this may change in the future. -func PreferSameScript(preferSame bool) MatchOption { - return func(m *matcher) { m.preferSameScript = preferSame } -} - -// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. -// There doesn't seem to be too much need for multiple types. -// Making it a concrete type allows MatchStrings to be a method, which will -// improve its discoverability. - -// MatchStrings parses and matches the given strings until one of them matches -// the language in the Matcher. A string may be an Accept-Language header as -// handled by ParseAcceptLanguage. The default language is returned if no -// other language matched. -func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { - for _, accept := range lang { - desired, _, err := ParseAcceptLanguage(accept) - if err != nil { - continue - } - if tag, index, conf := m.Match(desired...); conf != No { - return tag, index - } - } - tag, index, _ = m.Match() - return -} - -// Matcher is the interface that wraps the Match method. -// -// Match returns the best match for any of the given tags, along with -// a unique index associated with the returned tag and a confidence -// score. -type Matcher interface { - Match(t ...Tag) (tag Tag, index int, c Confidence) -} - -// Comprehends reports the confidence score for a speaker of a given language -// to being able to comprehend the written form of an alternative language. -func Comprehends(speaker, alternative Tag) Confidence { - _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) - return c -} - -// NewMatcher returns a Matcher that matches an ordered list of preferred tags -// against a list of supported tags based on written intelligibility, closeness -// of dialect, equivalence of subtags and various other rules. It is initialized -// with the list of supported tags. The first element is used as the default -// value in case no match is found. -// -// Its Match method matches the first of the given Tags to reach a certain -// confidence threshold. The tags passed to Match should therefore be specified -// in order of preference. Extensions are ignored for matching. -// -// The index returned by the Match method corresponds to the index of the -// matched tag in t, but is augmented with the Unicode extension ('u')of the -// corresponding preferred tag. This allows user locale options to be passed -// transparently. -func NewMatcher(t []Tag, options ...MatchOption) Matcher { - return newMatcher(t, options) -} - -func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { - var tt language.Tag - match, w, c := m.getBest(want...) - if match != nil { - tt, index = match.tag, match.index - } else { - // TODO: this should be an option - tt = m.default_.tag - if m.preferSameScript { - outer: - for _, w := range want { - script, _ := w.Script() - if script.scriptID == 0 { - // Don't do anything if there is no script, such as with - // private subtags. - continue - } - for i, h := range m.supported { - if script.scriptID == h.maxScript { - tt, index = h.tag, i - break outer - } - } - } - } - // TODO: select first language tag based on script. - } - if w.RegionID != tt.RegionID && w.RegionID != 0 { - if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { - tt.RegionID = w.RegionID - tt.RemakeString() - } else if r := w.RegionID.String(); len(r) == 2 { - // TODO: also filter macro and deprecated. - tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") - } - } - // Copy options from the user-provided tag into the result tag. This is hard - // to do after the fact, so we do it here. - // TODO: add in alternative variants to -u-va-. - // TODO: add preferred region to -u-rg-. - if e := w.Extensions(); len(e) > 0 { - b := language.Builder{} - b.SetTag(tt) - for _, e := range e { - b.AddExt(e) - } - tt = b.Make() - } - return makeTag(tt), index, c -} - -// ErrMissingLikelyTagsData indicates no information was available -// to compute likely values of missing tags. -var ErrMissingLikelyTagsData = errors.New("missing likely tags data") - -// func (t *Tag) setTagsFrom(id Tag) { -// t.LangID = id.LangID -// t.ScriptID = id.ScriptID -// t.RegionID = id.RegionID -// } - -// Tag Matching -// CLDR defines an algorithm for finding the best match between two sets of language -// tags. The basic algorithm defines how to score a possible match and then find -// the match with the best score -// (see https://www.unicode.org/reports/tr35/#LanguageMatching). -// Using scoring has several disadvantages. The scoring obfuscates the importance of -// the various factors considered, making the algorithm harder to understand. Using -// scoring also requires the full score to be computed for each pair of tags. -// -// We will use a different algorithm which aims to have the following properties: -// - clarity on the precedence of the various selection factors, and -// - improved performance by allowing early termination of a comparison. -// -// Matching algorithm (overview) -// Input: -// - supported: a set of supported tags -// - default: the default tag to return in case there is no match -// - desired: list of desired tags, ordered by preference, starting with -// the most-preferred. -// -// Algorithm: -// 1) Set the best match to the lowest confidence level -// 2) For each tag in "desired": -// a) For each tag in "supported": -// 1) compute the match between the two tags. -// 2) if the match is better than the previous best match, replace it -// with the new match. (see next section) -// b) if the current best match is Exact and pin is true the result will be -// frozen to the language found thusfar, although better matches may -// still be found for the same language. -// 3) If the best match so far is below a certain threshold, return "default". -// -// Ranking: -// We use two phases to determine whether one pair of tags are a better match -// than another pair of tags. First, we determine a rough confidence level. If the -// levels are different, the one with the highest confidence wins. -// Second, if the rough confidence levels are identical, we use a set of tie-breaker -// rules. -// -// The confidence level of matching a pair of tags is determined by finding the -// lowest confidence level of any matches of the corresponding subtags (the -// result is deemed as good as its weakest link). -// We define the following levels: -// Exact - An exact match of a subtag, before adding likely subtags. -// MaxExact - An exact match of a subtag, after adding likely subtags. -// [See Note 2]. -// High - High level of mutual intelligibility between different subtag -// variants. -// Low - Low level of mutual intelligibility between different subtag -// variants. -// No - No mutual intelligibility. -// -// The following levels can occur for each type of subtag: -// Base: Exact, MaxExact, High, Low, No -// Script: Exact, MaxExact [see Note 3], Low, No -// Region: Exact, MaxExact, High -// Variant: Exact, High -// Private: Exact, No -// -// Any result with a confidence level of Low or higher is deemed a possible match. -// Once a desired tag matches any of the supported tags with a level of MaxExact -// or higher, the next desired tag is not considered (see Step 2.b). -// Note that CLDR provides languageMatching data that defines close equivalence -// classes for base languages, scripts and regions. -// -// Tie-breaking -// If we get the same confidence level for two matches, we apply a sequence of -// tie-breaking rules. The first that succeeds defines the result. The rules are -// applied in the following order. -// 1) Original language was defined and was identical. -// 2) Original region was defined and was identical. -// 3) Distance between two maximized regions was the smallest. -// 4) Original script was defined and was identical. -// 5) Distance from want tag to have tag using the parent relation [see Note 5.] -// If there is still no winner after these rules are applied, the first match -// found wins. -// -// Notes: -// [2] In practice, as matching of Exact is done in a separate phase from -// matching the other levels, we reuse the Exact level to mean MaxExact in -// the second phase. As a consequence, we only need the levels defined by -// the Confidence type. The MaxExact confidence level is mapped to High in -// the public API. -// [3] We do not differentiate between maximized script values that were derived -// from suppressScript versus most likely tag data. We determined that in -// ranking the two, one ranks just after the other. Moreover, the two cannot -// occur concurrently. As a consequence, they are identical for practical -// purposes. -// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign -// the MaxExact level to allow iw vs he to still be a closer match than -// en-AU vs en-US, for example. -// [5] In CLDR a locale inherits fields that are unspecified for this locale -// from its parent. Therefore, if a locale is a parent of another locale, -// it is a strong measure for closeness, especially when no other tie -// breaker rule applies. One could also argue it is inconsistent, for -// example, when pt-AO matches pt (which CLDR equates with pt-BR), even -// though its parent is pt-PT according to the inheritance rules. -// -// Implementation Details: -// There are several performance considerations worth pointing out. Most notably, -// we preprocess as much as possible (within reason) at the time of creation of a -// matcher. This includes: -// - creating a per-language map, which includes data for the raw base language -// and its canonicalized variant (if applicable), -// - expanding entries for the equivalence classes defined in CLDR's -// languageMatch data. -// The per-language map ensures that typically only a very small number of tags -// need to be considered. The pre-expansion of canonicalized subtags and -// equivalence classes reduces the amount of map lookups that need to be done at -// runtime. - -// matcher keeps a set of supported language tags, indexed by language. -type matcher struct { - default_ *haveTag - supported []*haveTag - index map[language.Language]*matchHeader - passSettings bool - preferSameScript bool -} - -// matchHeader has the lists of tags for exact matches and matches based on -// maximized and canonicalized tags for a given language. -type matchHeader struct { - haveTags []*haveTag - original bool -} - -// haveTag holds a supported Tag and its maximized script and region. The maximized -// or canonicalized language is not stored as it is not needed during matching. -type haveTag struct { - tag language.Tag - - // index of this tag in the original list of supported tags. - index int - - // conf is the maximum confidence that can result from matching this haveTag. - // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. - conf Confidence - - // Maximized region and script. - maxRegion language.Region - maxScript language.Script - - // altScript may be checked as an alternative match to maxScript. If altScript - // matches, the confidence level for this match is Low. Theoretically there - // could be multiple alternative scripts. This does not occur in practice. - altScript language.Script - - // nextMax is the index of the next haveTag with the same maximized tags. - nextMax uint16 -} - -func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { - max := tag - if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { - max, _ = canonicalize(All, max) - max, _ = max.Maximize() - max.RemakeString() - } - return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID -} - -// altScript returns an alternative script that may match the given script with -// a low confidence. At the moment, the langMatch data allows for at most one -// script to map to another and we rely on this to keep the code simple. -func altScript(l language.Language, s language.Script) language.Script { - for _, alt := range matchScript { - // TODO: also match cases where language is not the same. - if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && - language.Script(alt.haveScript) == s { - return language.Script(alt.wantScript) - } - } - return 0 -} - -// addIfNew adds a haveTag to the list of tags only if it is a unique tag. -// Tags that have the same maximized values are linked by index. -func (h *matchHeader) addIfNew(n haveTag, exact bool) { - h.original = h.original || exact - // Don't add new exact matches. - for _, v := range h.haveTags { - if equalsRest(v.tag, n.tag) { - return - } - } - // Allow duplicate maximized tags, but create a linked list to allow quickly - // comparing the equivalents and bail out. - for i, v := range h.haveTags { - if v.maxScript == n.maxScript && - v.maxRegion == n.maxRegion && - v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { - for h.haveTags[i].nextMax != 0 { - i = int(h.haveTags[i].nextMax) - } - h.haveTags[i].nextMax = uint16(len(h.haveTags)) - break - } - } - h.haveTags = append(h.haveTags, &n) -} - -// header returns the matchHeader for the given language. It creates one if -// it doesn't already exist. -func (m *matcher) header(l language.Language) *matchHeader { - if h := m.index[l]; h != nil { - return h - } - h := &matchHeader{} - m.index[l] = h - return h -} - -func toConf(d uint8) Confidence { - if d <= 10 { - return High - } - if d < 30 { - return Low - } - return No -} - -// newMatcher builds an index for the given supported tags and returns it as -// a matcher. It also expands the index by considering various equivalence classes -// for a given tag. -func newMatcher(supported []Tag, options []MatchOption) *matcher { - m := &matcher{ - index: make(map[language.Language]*matchHeader), - preferSameScript: true, - } - for _, o := range options { - o(m) - } - if len(supported) == 0 { - m.default_ = &haveTag{} - return m - } - // Add supported languages to the index. Add exact matches first to give - // them precedence. - for i, tag := range supported { - tt := tag.tag() - pair, _ := makeHaveTag(tt, i) - m.header(tt.LangID).addIfNew(pair, true) - m.supported = append(m.supported, &pair) - } - m.default_ = m.header(supported[0].lang()).haveTags[0] - // Keep these in two different loops to support the case that two equivalent - // languages are distinguished, such as iw and he. - for i, tag := range supported { - tt := tag.tag() - pair, max := makeHaveTag(tt, i) - if max != tt.LangID { - m.header(max).addIfNew(pair, true) - } - } - - // update is used to add indexes in the map for equivalent languages. - // update will only add entries to original indexes, thus not computing any - // transitive relations. - update := func(want, have uint16, conf Confidence) { - if hh := m.index[language.Language(have)]; hh != nil { - if !hh.original { - return - } - hw := m.header(language.Language(want)) - for _, ht := range hh.haveTags { - v := *ht - if conf < v.conf { - v.conf = conf - } - v.nextMax = 0 // this value needs to be recomputed - if v.altScript != 0 { - v.altScript = altScript(language.Language(want), v.maxScript) - } - hw.addIfNew(v, conf == Exact && hh.original) - } - } - } - - // Add entries for languages with mutual intelligibility as defined by CLDR's - // languageMatch data. - for _, ml := range matchLang { - update(ml.want, ml.have, toConf(ml.distance)) - if !ml.oneway { - update(ml.have, ml.want, toConf(ml.distance)) - } - } - - // Add entries for possible canonicalizations. This is an optimization to - // ensure that only one map lookup needs to be done at runtime per desired tag. - // First we match deprecated equivalents. If they are perfect equivalents - // (their canonicalization simply substitutes a different language code, but - // nothing else), the match confidence is Exact, otherwise it is High. - for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script - // or region, we consider it an exact match. - conf := Exact - if language.AliasTypes[i] != language.Macro { - if !isExactEquivalent(language.Language(lm.From)) { - conf = High - } - update(lm.To, lm.From, conf) - } - update(lm.From, lm.To, conf) - } - return m -} - -// getBest gets the best matching tag in m for any of the given tags, taking into -// account the order of preference of the given tags. -func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { - best := bestMatch{} - for i, ww := range want { - w := ww.tag() - var max language.Tag - // Check for exact match first. - h := m.index[w.LangID] - if w.LangID != 0 { - if h == nil { - continue - } - // Base language is defined. - max, _ = canonicalize(Legacy|Deprecated|Macro, w) - // A region that is added through canonicalization is stronger than - // a maximized region: set it in the original (e.g. mo -> ro-MD). - if w.RegionID != max.RegionID { - w.RegionID = max.RegionID - } - // TODO: should we do the same for scripts? - // See test case: en, sr, nl ; sh ; sr - max, _ = max.Maximize() - } else { - // Base language is not defined. - if h != nil { - for i := range h.haveTags { - have := h.haveTags[i] - if equalsRest(have.tag, w) { - return have, w, Exact - } - } - } - if w.ScriptID == 0 && w.RegionID == 0 { - // We skip all tags matching und for approximate matching, including - // private tags. - continue - } - max, _ = w.Maximize() - if h = m.index[max.LangID]; h == nil { - continue - } - } - pin := true - for _, t := range want[i+1:] { - if w.LangID == t.lang() { - pin = false - break - } - } - // Check for match based on maximized tag. - for i := range h.haveTags { - have := h.haveTags[i] - best.update(have, w, max.ScriptID, max.RegionID, pin) - if best.conf == Exact { - for have.nextMax != 0 { - have = h.haveTags[have.nextMax] - best.update(have, w, max.ScriptID, max.RegionID, pin) - } - return best.have, best.want, best.conf - } - } - } - if best.conf <= No { - if len(want) != 0 { - return nil, want[0].tag(), No - } - return nil, language.Tag{}, No - } - return best.have, best.want, best.conf -} - -// bestMatch accumulates the best match so far. -type bestMatch struct { - have *haveTag - want language.Tag - conf Confidence - pinnedRegion language.Region - pinLanguage bool - sameRegionGroup bool - // Cached results from applying tie-breaking rules. - origLang bool - origReg bool - paradigmReg bool - regGroupDist uint8 - origScript bool -} - -// update updates the existing best match if the new pair is considered to be a -// better match. To determine if the given pair is a better match, it first -// computes the rough confidence level. If this surpasses the current match, it -// will replace it and update the tie-breaker rule cache. If there is a tie, it -// proceeds with applying a series of tie-breaker rules. If there is no -// conclusive winner after applying the tie-breaker rules, it leaves the current -// match as the preferred match. -// -// If pin is true and have and tag are a strong match, it will henceforth only -// consider matches for this language. This corresponds to the idea that most -// users have a strong preference for the first defined language. A user can -// still prefer a second language over a dialect of the preferred language by -// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should -// be false. -func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { - // Bail if the maximum attainable confidence is below that of the current best match. - c := have.conf - if c < m.conf { - return - } - // Don't change the language once we already have found an exact match. - if m.pinLanguage && tag.LangID != m.want.LangID { - return - } - // Pin the region group if we are comparing tags for the same language. - if tag.LangID == m.want.LangID && m.sameRegionGroup { - _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) - if !sameGroup { - return - } - } - if c == Exact && have.maxScript == maxScript { - // If there is another language and then another entry of this language, - // don't pin anything, otherwise pin the language. - m.pinLanguage = pin - } - if equalsRest(have.tag, tag) { - } else if have.maxScript != maxScript { - // There is usually very little comprehension between different scripts. - // In a few cases there may still be Low comprehension. This possibility - // is pre-computed and stored in have.altScript. - if Low < m.conf || have.altScript != maxScript { - return - } - c = Low - } else if have.maxRegion != maxRegion { - if High < c { - // There is usually a small difference between languages across regions. - c = High - } - } - - // We store the results of the computations of the tie-breaker rules along - // with the best match. There is no need to do the checks once we determine - // we have a winner, but we do still need to do the tie-breaker computations. - // We use "beaten" to keep track if we still need to do the checks. - beaten := false // true if the new pair defeats the current one. - if c != m.conf { - if c < m.conf { - return - } - beaten = true - } - - // Tie-breaker rules: - // We prefer if the pre-maximized language was specified and identical. - origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 - if !beaten && m.origLang != origLang { - if m.origLang { - return - } - beaten = true - } - - // We prefer if the pre-maximized region was specified and identical. - origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 - if !beaten && m.origReg != origReg { - if m.origReg { - return - } - beaten = true - } - - regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) - if !beaten && m.regGroupDist != regGroupDist { - if regGroupDist > m.regGroupDist { - return - } - beaten = true - } - - paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) - if !beaten && m.paradigmReg != paradigmReg { - if !paradigmReg { - return - } - beaten = true - } - - // Next we prefer if the pre-maximized script was specified and identical. - origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 - if !beaten && m.origScript != origScript { - if m.origScript { - return - } - beaten = true - } - - // Update m to the newly found best match. - if beaten { - m.have = have - m.want = tag - m.conf = c - m.pinnedRegion = maxRegion - m.sameRegionGroup = sameGroup - m.origLang = origLang - m.origReg = origReg - m.paradigmReg = paradigmReg - m.origScript = origScript - m.regGroupDist = regGroupDist - } -} - -func isParadigmLocale(lang language.Language, r language.Region) bool { - for _, e := range paradigmLocales { - if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { - return true - } - } - return false -} - -// regionGroupDist computes the distance between two regions based on their -// CLDR grouping. -func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { - const defaultDistance = 4 - - aGroup := uint(regionToGroups[a]) << 1 - bGroup := uint(regionToGroups[b]) << 1 - for _, ri := range matchRegion { - if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { - group := uint(1 << (ri.group &^ 0x80)) - if 0x80&ri.group == 0 { - if aGroup&bGroup&group != 0 { // Both regions are in the group. - return ri.distance, ri.distance == defaultDistance - } - } else { - if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. - return ri.distance, ri.distance == defaultDistance - } - } - } - } - return defaultDistance, true -} - -// equalsRest compares everything except the language. -func equalsRest(a, b language.Tag) bool { - // TODO: don't include extensions in this comparison. To do this efficiently, - // though, we should handle private tags separately. - return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() -} - -// isExactEquivalent returns true if canonicalizing the language will not alter -// the script or region of a tag. -func isExactEquivalent(l language.Language) bool { - for _, o := range notEquivalent { - if o == l { - return false - } - } - return true -} - -var notEquivalent []language.Language - -func init() { - // Create a list of all languages for which canonicalization may alter the - // script or region. - for _, lm := range language.AliasMap { - tag := language.Tag{LangID: language.Language(lm.From)} - if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { - notEquivalent = append(notEquivalent, language.Language(lm.From)) - } - } - // Maximize undefined regions of paradigm locales. - for i, v := range paradigmLocales { - t := language.Tag{LangID: language.Language(v[0])} - max, _ := t.Maximize() - if v[1] == 0 { - paradigmLocales[i][1] = uint16(max.RegionID) - } - if v[2] == 0 { - paradigmLocales[i][2] = uint16(max.RegionID) - } - } -} diff --git a/embed/vendor/golang.org/x/text/language/parse.go b/embed/vendor/golang.org/x/text/language/parse.go deleted file mode 100644 index 053336e2..00000000 --- a/embed/vendor/golang.org/x/text/language/parse.go +++ /dev/null @@ -1,256 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "errors" - "sort" - "strconv" - "strings" - - "golang.org/x/text/internal/language" -) - -// ValueError is returned by any of the parsing functions when the -// input is well-formed but the respective subtag is not recognized -// as a valid value. -type ValueError interface { - error - - // Subtag returns the subtag for which the error occurred. - Subtag() string -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// The resulting tag is canonicalized using the default canonicalization type. -func Parse(s string) (t Tag, err error) { - return Default.Parse(s) -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// The resulting tag is canonicalized using the canonicalization type c. -func (c CanonType) Parse(s string) (t Tag, err error) { - defer func() { - if recover() != nil { - t = Tag{} - err = language.ErrSyntax - } - }() - - tt, err := language.Parse(s) - if err != nil { - return makeTag(tt), err - } - tt, changed := canonicalize(c, tt) - if changed { - tt.RemakeString() - } - return makeTag(tt), nil -} - -// Compose creates a Tag from individual parts, which may be of type Tag, Base, -// Script, Region, Variant, []Variant, Extension, []Extension or error. If a -// Base, Script or Region or slice of type Variant or Extension is passed more -// than once, the latter will overwrite the former. Variants and Extensions are -// accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. For -u extensions, though, the key-type pairs are -// added, where later values overwrite older ones. A Tag overwrites all former -// values and typically only makes sense as the first argument. The resulting -// tag is returned after canonicalizing using the Default CanonType. If one or -// more errors are encountered, one of the errors is returned. -func Compose(part ...interface{}) (t Tag, err error) { - return Default.Compose(part...) -} - -// Compose creates a Tag from individual parts, which may be of type Tag, Base, -// Script, Region, Variant, []Variant, Extension, []Extension or error. If a -// Base, Script or Region or slice of type Variant or Extension is passed more -// than once, the latter will overwrite the former. Variants and Extensions are -// accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. For -u extensions, though, the key-type pairs are -// added, where later values overwrite older ones. A Tag overwrites all former -// values and typically only makes sense as the first argument. The resulting -// tag is returned after canonicalizing using CanonType c. If one or more errors -// are encountered, one of the errors is returned. -func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { - defer func() { - if recover() != nil { - t = Tag{} - err = language.ErrSyntax - } - }() - - var b language.Builder - if err = update(&b, part...); err != nil { - return und, err - } - b.Tag, _ = canonicalize(c, b.Tag) - return makeTag(b.Make()), err -} - -var errInvalidArgument = errors.New("invalid Extension or Variant") - -func update(b *language.Builder, part ...interface{}) (err error) { - for _, x := range part { - switch v := x.(type) { - case Tag: - b.SetTag(v.tag()) - case Base: - b.Tag.LangID = v.langID - case Script: - b.Tag.ScriptID = v.scriptID - case Region: - b.Tag.RegionID = v.regionID - case Variant: - if v.variant == "" { - err = errInvalidArgument - break - } - b.AddVariant(v.variant) - case Extension: - if v.s == "" { - err = errInvalidArgument - break - } - b.SetExt(v.s) - case []Variant: - b.ClearVariants() - for _, v := range v { - b.AddVariant(v.variant) - } - case []Extension: - b.ClearExtensions() - for _, e := range v { - b.SetExt(e.s) - } - // TODO: support parsing of raw strings based on morphology or just extensions? - case error: - if v != nil { - err = v - } - } - } - return -} - -var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") -var errTagListTooLarge = errors.New("tag list exceeds max length") - -// ParseAcceptLanguage parses the contents of an Accept-Language header as -// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and -// a list of corresponding quality weights. It is more permissive than RFC 2616 -// and may return non-nil slices even if the input is not valid. -// The Tags will be sorted by highest weight first and then by first occurrence. -// Tags with a weight of zero will be dropped. An error will be returned if the -// input could not be parsed. -func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { - defer func() { - if recover() != nil { - tag = nil - q = nil - err = language.ErrSyntax - } - }() - - if strings.Count(s, "-") > 1000 { - return nil, nil, errTagListTooLarge - } - - var entry string - for s != "" { - if entry, s = split(s, ','); entry == "" { - continue - } - - entry, weight := split(entry, ';') - - // Scan the language. - t, err := Parse(entry) - if err != nil { - id, ok := acceptFallback[entry] - if !ok { - return nil, nil, err - } - t = makeTag(language.Tag{LangID: id}) - } - - // Scan the optional weight. - w := 1.0 - if weight != "" { - weight = consume(weight, 'q') - weight = consume(weight, '=') - // consume returns the empty string when a token could not be - // consumed, resulting in an error for ParseFloat. - if w, err = strconv.ParseFloat(weight, 32); err != nil { - return nil, nil, errInvalidWeight - } - // Drop tags with a quality weight of 0. - if w <= 0 { - continue - } - } - - tag = append(tag, t) - q = append(q, float32(w)) - } - sort.Stable(&tagSort{tag, q}) - return tag, q, nil -} - -// consume removes a leading token c from s and returns the result or the empty -// string if there is no such token. -func consume(s string, c byte) string { - if s == "" || s[0] != c { - return "" - } - return strings.TrimSpace(s[1:]) -} - -func split(s string, c byte) (head, tail string) { - if i := strings.IndexByte(s, c); i >= 0 { - return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) - } - return strings.TrimSpace(s), "" -} - -// Add hack mapping to deal with a small number of cases that occur -// in Accept-Language (with reasonable frequency). -var acceptFallback = map[string]language.Language{ - "english": _en, - "deutsch": _de, - "italian": _it, - "french": _fr, - "*": _mul, // defined in the spec to match all languages. -} - -type tagSort struct { - tag []Tag - q []float32 -} - -func (s *tagSort) Len() int { - return len(s.q) -} - -func (s *tagSort) Less(i, j int) bool { - return s.q[i] > s.q[j] -} - -func (s *tagSort) Swap(i, j int) { - s.tag[i], s.tag[j] = s.tag[j], s.tag[i] - s.q[i], s.q[j] = s.q[j], s.q[i] -} diff --git a/embed/vendor/golang.org/x/text/language/tables.go b/embed/vendor/golang.org/x/text/language/tables.go deleted file mode 100644 index a6573dcb..00000000 --- a/embed/vendor/golang.org/x/text/language/tables.go +++ /dev/null @@ -1,298 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "32" - -const ( - _de = 269 - _en = 313 - _fr = 350 - _it = 505 - _mo = 784 - _no = 879 - _nb = 839 - _pt = 960 - _sh = 1031 - _mul = 806 - _und = 0 -) -const ( - _001 = 1 - _419 = 31 - _BR = 65 - _CA = 73 - _ES = 111 - _GB = 124 - _MD = 189 - _PT = 239 - _UK = 307 - _US = 310 - _ZZ = 358 - _XA = 324 - _XC = 326 - _XK = 334 -) -const ( - _Latn = 91 - _Hani = 57 - _Hans = 59 - _Hant = 60 - _Qaaa = 149 - _Qaai = 157 - _Qabx = 198 - _Zinh = 255 - _Zyyy = 260 - _Zzzz = 261 -) - -var regionToGroups = []uint8{ // 359 elements - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, - // Entry 40 - 7F - 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, - 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, - // Entry 80 - BF - 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, - 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, - // Entry C0 - FF - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, - 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 100 - 13F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, - // Entry 140 - 17F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 383 bytes - -var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7c}, - 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xef}, -} // Size: 42 bytes - -type mutualIntelligibility struct { - want uint16 - have uint16 - distance uint8 - oneway bool -} -type scriptIntelligibility struct { - wantLang uint16 - haveLang uint16 - wantScript uint8 - haveScript uint8 - distance uint8 -} -type regionIntelligibility struct { - lang uint16 - script uint8 - group uint8 - distance uint8 -} - -// matchLang holds pairs of langIDs of base languages that are typically -// mutually intelligible. Each pair is associated with a confidence and -// whether the intelligibility goes one or both ways. -var matchLang = []mutualIntelligibility{ // 113 elements - 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, - 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, - 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, - 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, - 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, - 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, - 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, - 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, - 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, - 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, - 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, - 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, - 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, - 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, - 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, - 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, - 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, - 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, - 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, - 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, - 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, - 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, - 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, - 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, - 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, - 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, - 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, - 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, - 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, - 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, - 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, - 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, - 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, - 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, - 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, - 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, - 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, - 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, - 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, - 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, - 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, - 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, - 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, - 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, - 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, - 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, - 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, - 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, - 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, - 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, - 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, - 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, - 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, - 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, - 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, - 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, - 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, - 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, - 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, - 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, - 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, - 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, - 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, - 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, - 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, - 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, - 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, - 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, - 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, - 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, - 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, - 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, - 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, - 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, - 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, - 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, - 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, - 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, - 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, - 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, - 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, - 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, - 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, - 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, - 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, - 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, - 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, - 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, - 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, - 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, - 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, - 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, - 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, - 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, - 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, - 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, - 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, - 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, - 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, - 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, - 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, - 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, - 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, - 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, - 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, - 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, - 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, - 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, - 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, - 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, - 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, - 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, - 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, -} // Size: 702 bytes - -// matchScript holds pairs of scriptIDs where readers of one script -// can typically also read the other. Each is associated with a confidence. -var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, - 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, - 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, - 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, -} // Size: 232 bytes - -var matchRegion = []regionIntelligibility{ // 15 elements - 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, - 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, - 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, - 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, - 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, - 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, - 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, - 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, - 8: {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4}, - 9: {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4}, - 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, - 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, - 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, - 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, - 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, -} // Size: 114 bytes - -// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/embed/vendor/golang.org/x/text/language/tags.go b/embed/vendor/golang.org/x/text/language/tags.go deleted file mode 100644 index 42ea7926..00000000 --- a/embed/vendor/golang.org/x/text/language/tags.go +++ /dev/null @@ -1,145 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import "golang.org/x/text/internal/language/compact" - -// TODO: Various sets of commonly use tags and regions. - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func MustParse(s string) Tag { - t, err := Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func (c CanonType) MustParse(s string) Tag { - t, err := c.Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. -// It simplifies safe initialization of Base values. -func MustParseBase(s string) Base { - b, err := ParseBase(s) - if err != nil { - panic(err) - } - return b -} - -// MustParseScript is like ParseScript, but panics if the given script cannot be -// parsed. It simplifies safe initialization of Script values. -func MustParseScript(s string) Script { - scr, err := ParseScript(s) - if err != nil { - panic(err) - } - return scr -} - -// MustParseRegion is like ParseRegion, but panics if the given region cannot be -// parsed. It simplifies safe initialization of Region values. -func MustParseRegion(s string) Region { - r, err := ParseRegion(s) - if err != nil { - panic(err) - } - return r -} - -var ( - und = Tag{} - - Und Tag = Tag{} - - Afrikaans Tag = Tag(compact.Afrikaans) - Amharic Tag = Tag(compact.Amharic) - Arabic Tag = Tag(compact.Arabic) - ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) - Azerbaijani Tag = Tag(compact.Azerbaijani) - Bulgarian Tag = Tag(compact.Bulgarian) - Bengali Tag = Tag(compact.Bengali) - Catalan Tag = Tag(compact.Catalan) - Czech Tag = Tag(compact.Czech) - Danish Tag = Tag(compact.Danish) - German Tag = Tag(compact.German) - Greek Tag = Tag(compact.Greek) - English Tag = Tag(compact.English) - AmericanEnglish Tag = Tag(compact.AmericanEnglish) - BritishEnglish Tag = Tag(compact.BritishEnglish) - Spanish Tag = Tag(compact.Spanish) - EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) - LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) - Estonian Tag = Tag(compact.Estonian) - Persian Tag = Tag(compact.Persian) - Finnish Tag = Tag(compact.Finnish) - Filipino Tag = Tag(compact.Filipino) - French Tag = Tag(compact.French) - CanadianFrench Tag = Tag(compact.CanadianFrench) - Gujarati Tag = Tag(compact.Gujarati) - Hebrew Tag = Tag(compact.Hebrew) - Hindi Tag = Tag(compact.Hindi) - Croatian Tag = Tag(compact.Croatian) - Hungarian Tag = Tag(compact.Hungarian) - Armenian Tag = Tag(compact.Armenian) - Indonesian Tag = Tag(compact.Indonesian) - Icelandic Tag = Tag(compact.Icelandic) - Italian Tag = Tag(compact.Italian) - Japanese Tag = Tag(compact.Japanese) - Georgian Tag = Tag(compact.Georgian) - Kazakh Tag = Tag(compact.Kazakh) - Khmer Tag = Tag(compact.Khmer) - Kannada Tag = Tag(compact.Kannada) - Korean Tag = Tag(compact.Korean) - Kirghiz Tag = Tag(compact.Kirghiz) - Lao Tag = Tag(compact.Lao) - Lithuanian Tag = Tag(compact.Lithuanian) - Latvian Tag = Tag(compact.Latvian) - Macedonian Tag = Tag(compact.Macedonian) - Malayalam Tag = Tag(compact.Malayalam) - Mongolian Tag = Tag(compact.Mongolian) - Marathi Tag = Tag(compact.Marathi) - Malay Tag = Tag(compact.Malay) - Burmese Tag = Tag(compact.Burmese) - Nepali Tag = Tag(compact.Nepali) - Dutch Tag = Tag(compact.Dutch) - Norwegian Tag = Tag(compact.Norwegian) - Punjabi Tag = Tag(compact.Punjabi) - Polish Tag = Tag(compact.Polish) - Portuguese Tag = Tag(compact.Portuguese) - BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) - EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) - Romanian Tag = Tag(compact.Romanian) - Russian Tag = Tag(compact.Russian) - Sinhala Tag = Tag(compact.Sinhala) - Slovak Tag = Tag(compact.Slovak) - Slovenian Tag = Tag(compact.Slovenian) - Albanian Tag = Tag(compact.Albanian) - Serbian Tag = Tag(compact.Serbian) - SerbianLatin Tag = Tag(compact.SerbianLatin) - Swedish Tag = Tag(compact.Swedish) - Swahili Tag = Tag(compact.Swahili) - Tamil Tag = Tag(compact.Tamil) - Telugu Tag = Tag(compact.Telugu) - Thai Tag = Tag(compact.Thai) - Turkish Tag = Tag(compact.Turkish) - Ukrainian Tag = Tag(compact.Ukrainian) - Urdu Tag = Tag(compact.Urdu) - Uzbek Tag = Tag(compact.Uzbek) - Vietnamese Tag = Tag(compact.Vietnamese) - Chinese Tag = Tag(compact.Chinese) - SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) - TraditionalChinese Tag = Tag(compact.TraditionalChinese) - Zulu Tag = Tag(compact.Zulu) -) diff --git a/embed/vendor/golang.org/x/text/transform/transform.go b/embed/vendor/golang.org/x/text/transform/transform.go deleted file mode 100644 index 48ec64b4..00000000 --- a/embed/vendor/golang.org/x/text/transform/transform.go +++ /dev/null @@ -1,709 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package transform provides reader and writer wrappers that transform the -// bytes passing through as well as various transformations. Example -// transformations provided by other packages include normalization and -// conversion between character sets. -package transform // import "golang.org/x/text/transform" - -import ( - "bytes" - "errors" - "io" - "unicode/utf8" -) - -var ( - // ErrShortDst means that the destination buffer was too short to - // receive all of the transformed bytes. - ErrShortDst = errors.New("transform: short destination buffer") - - // ErrShortSrc means that the source buffer has insufficient data to - // complete the transformation. - ErrShortSrc = errors.New("transform: short source buffer") - - // ErrEndOfSpan means that the input and output (the transformed input) - // are not identical. - ErrEndOfSpan = errors.New("transform: input and output are not identical") - - // errInconsistentByteCount means that Transform returned success (nil - // error) but also returned nSrc inconsistent with the src argument. - errInconsistentByteCount = errors.New("transform: inconsistent byte count returned") - - // errShortInternal means that an internal buffer is not large enough - // to make progress and the Transform operation must be aborted. - errShortInternal = errors.New("transform: short internal buffer") -) - -// Transformer transforms bytes. -type Transformer interface { - // Transform writes to dst the transformed bytes read from src, and - // returns the number of dst bytes written and src bytes read. The - // atEOF argument tells whether src represents the last bytes of the - // input. - // - // Callers should always process the nDst bytes produced and account - // for the nSrc bytes consumed before considering the error err. - // - // A nil error means that all of the transformed bytes (whether freshly - // transformed from src or left over from previous Transform calls) - // were written to dst. A nil error can be returned regardless of - // whether atEOF is true. If err is nil then nSrc must equal len(src); - // the converse is not necessarily true. - // - // ErrShortDst means that dst was too short to receive all of the - // transformed bytes. ErrShortSrc means that src had insufficient data - // to complete the transformation. If both conditions apply, then - // either error may be returned. Other than the error conditions listed - // here, implementations are free to report other errors that arise. - Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) - - // Reset resets the state and allows a Transformer to be reused. - Reset() -} - -// SpanningTransformer extends the Transformer interface with a Span method -// that determines how much of the input already conforms to the Transformer. -type SpanningTransformer interface { - Transformer - - // Span returns a position in src such that transforming src[:n] results in - // identical output src[:n] for these bytes. It does not necessarily return - // the largest such n. The atEOF argument tells whether src represents the - // last bytes of the input. - // - // Callers should always account for the n bytes consumed before - // considering the error err. - // - // A nil error means that all input bytes are known to be identical to the - // output produced by the Transformer. A nil error can be returned - // regardless of whether atEOF is true. If err is nil, then n must - // equal len(src); the converse is not necessarily true. - // - // ErrEndOfSpan means that the Transformer output may differ from the - // input after n bytes. Note that n may be len(src), meaning that the output - // would contain additional bytes after otherwise identical output. - // ErrShortSrc means that src had insufficient data to determine whether the - // remaining bytes would change. Other than the error conditions listed - // here, implementations are free to report other errors that arise. - // - // Calling Span can modify the Transformer state as a side effect. In - // effect, it does the transformation just as calling Transform would, only - // without copying to a destination buffer and only up to a point it can - // determine the input and output bytes are the same. This is obviously more - // limited than calling Transform, but can be more efficient in terms of - // copying and allocating buffers. Calls to Span and Transform may be - // interleaved. - Span(src []byte, atEOF bool) (n int, err error) -} - -// NopResetter can be embedded by implementations of Transformer to add a nop -// Reset method. -type NopResetter struct{} - -// Reset implements the Reset method of the Transformer interface. -func (NopResetter) Reset() {} - -// Reader wraps another io.Reader by transforming the bytes read. -type Reader struct { - r io.Reader - t Transformer - err error - - // dst[dst0:dst1] contains bytes that have been transformed by t but - // not yet copied out via Read. - dst []byte - dst0, dst1 int - - // src[src0:src1] contains bytes that have been read from r but not - // yet transformed through t. - src []byte - src0, src1 int - - // transformComplete is whether the transformation is complete, - // regardless of whether or not it was successful. - transformComplete bool -} - -const defaultBufSize = 4096 - -// NewReader returns a new Reader that wraps r by transforming the bytes read -// via t. It calls Reset on t. -func NewReader(r io.Reader, t Transformer) *Reader { - t.Reset() - return &Reader{ - r: r, - t: t, - dst: make([]byte, defaultBufSize), - src: make([]byte, defaultBufSize), - } -} - -// Read implements the io.Reader interface. -func (r *Reader) Read(p []byte) (int, error) { - n, err := 0, error(nil) - for { - // Copy out any transformed bytes and return the final error if we are done. - if r.dst0 != r.dst1 { - n = copy(p, r.dst[r.dst0:r.dst1]) - r.dst0 += n - if r.dst0 == r.dst1 && r.transformComplete { - return n, r.err - } - return n, nil - } else if r.transformComplete { - return 0, r.err - } - - // Try to transform some source bytes, or to flush the transformer if we - // are out of source bytes. We do this even if r.r.Read returned an error. - // As the io.Reader documentation says, "process the n > 0 bytes returned - // before considering the error". - if r.src0 != r.src1 || r.err != nil { - r.dst0 = 0 - r.dst1, n, err = r.t.Transform(r.dst, r.src[r.src0:r.src1], r.err == io.EOF) - r.src0 += n - - switch { - case err == nil: - if r.src0 != r.src1 { - r.err = errInconsistentByteCount - } - // The Transform call was successful; we are complete if we - // cannot read more bytes into src. - r.transformComplete = r.err != nil - continue - case err == ErrShortDst && (r.dst1 != 0 || n != 0): - // Make room in dst by copying out, and try again. - continue - case err == ErrShortSrc && r.src1-r.src0 != len(r.src) && r.err == nil: - // Read more bytes into src via the code below, and try again. - default: - r.transformComplete = true - // The reader error (r.err) takes precedence over the - // transformer error (err) unless r.err is nil or io.EOF. - if r.err == nil || r.err == io.EOF { - r.err = err - } - continue - } - } - - // Move any untransformed source bytes to the start of the buffer - // and read more bytes. - if r.src0 != 0 { - r.src0, r.src1 = 0, copy(r.src, r.src[r.src0:r.src1]) - } - n, r.err = r.r.Read(r.src[r.src1:]) - r.src1 += n - } -} - -// TODO: implement ReadByte (and ReadRune??). - -// Writer wraps another io.Writer by transforming the bytes read. -// The user needs to call Close to flush unwritten bytes that may -// be buffered. -type Writer struct { - w io.Writer - t Transformer - dst []byte - - // src[:n] contains bytes that have not yet passed through t. - src []byte - n int -} - -// NewWriter returns a new Writer that wraps w by transforming the bytes written -// via t. It calls Reset on t. -func NewWriter(w io.Writer, t Transformer) *Writer { - t.Reset() - return &Writer{ - w: w, - t: t, - dst: make([]byte, defaultBufSize), - src: make([]byte, defaultBufSize), - } -} - -// Write implements the io.Writer interface. If there are not enough -// bytes available to complete a Transform, the bytes will be buffered -// for the next write. Call Close to convert the remaining bytes. -func (w *Writer) Write(data []byte) (n int, err error) { - src := data - if w.n > 0 { - // Append bytes from data to the last remainder. - // TODO: limit the amount copied on first try. - n = copy(w.src[w.n:], data) - w.n += n - src = w.src[:w.n] - } - for { - nDst, nSrc, err := w.t.Transform(w.dst, src, false) - if _, werr := w.w.Write(w.dst[:nDst]); werr != nil { - return n, werr - } - src = src[nSrc:] - if w.n == 0 { - n += nSrc - } else if len(src) <= n { - // Enough bytes from w.src have been consumed. We make src point - // to data instead to reduce the copying. - w.n = 0 - n -= len(src) - src = data[n:] - if n < len(data) && (err == nil || err == ErrShortSrc) { - continue - } - } - switch err { - case ErrShortDst: - // This error is okay as long as we are making progress. - if nDst > 0 || nSrc > 0 { - continue - } - case ErrShortSrc: - if len(src) < len(w.src) { - m := copy(w.src, src) - // If w.n > 0, bytes from data were already copied to w.src and n - // was already set to the number of bytes consumed. - if w.n == 0 { - n += m - } - w.n = m - err = nil - } else if nDst > 0 || nSrc > 0 { - // Not enough buffer to store the remainder. Keep processing as - // long as there is progress. Without this case, transforms that - // require a lookahead larger than the buffer may result in an - // error. This is not something one may expect to be common in - // practice, but it may occur when buffers are set to small - // sizes during testing. - continue - } - case nil: - if w.n > 0 { - err = errInconsistentByteCount - } - } - return n, err - } -} - -// Close implements the io.Closer interface. -func (w *Writer) Close() error { - src := w.src[:w.n] - for { - nDst, nSrc, err := w.t.Transform(w.dst, src, true) - if _, werr := w.w.Write(w.dst[:nDst]); werr != nil { - return werr - } - if err != ErrShortDst { - return err - } - src = src[nSrc:] - } -} - -type nop struct{ NopResetter } - -func (nop) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - n := copy(dst, src) - if n < len(src) { - err = ErrShortDst - } - return n, n, err -} - -func (nop) Span(src []byte, atEOF bool) (n int, err error) { - return len(src), nil -} - -type discard struct{ NopResetter } - -func (discard) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - return 0, len(src), nil -} - -var ( - // Discard is a Transformer for which all Transform calls succeed - // by consuming all bytes and writing nothing. - Discard Transformer = discard{} - - // Nop is a SpanningTransformer that copies src to dst. - Nop SpanningTransformer = nop{} -) - -// chain is a sequence of links. A chain with N Transformers has N+1 links and -// N+1 buffers. Of those N+1 buffers, the first and last are the src and dst -// buffers given to chain.Transform and the middle N-1 buffers are intermediate -// buffers owned by the chain. The i'th link transforms bytes from the i'th -// buffer chain.link[i].b at read offset chain.link[i].p to the i+1'th buffer -// chain.link[i+1].b at write offset chain.link[i+1].n, for i in [0, N). -type chain struct { - link []link - err error - // errStart is the index at which the error occurred plus 1. Processing - // errStart at this level at the next call to Transform. As long as - // errStart > 0, chain will not consume any more source bytes. - errStart int -} - -func (c *chain) fatalError(errIndex int, err error) { - if i := errIndex + 1; i > c.errStart { - c.errStart = i - c.err = err - } -} - -type link struct { - t Transformer - // b[p:n] holds the bytes to be transformed by t. - b []byte - p int - n int -} - -func (l *link) src() []byte { - return l.b[l.p:l.n] -} - -func (l *link) dst() []byte { - return l.b[l.n:] -} - -// Chain returns a Transformer that applies t in sequence. -func Chain(t ...Transformer) Transformer { - if len(t) == 0 { - return nop{} - } - c := &chain{link: make([]link, len(t)+1)} - for i, tt := range t { - c.link[i].t = tt - } - // Allocate intermediate buffers. - b := make([][defaultBufSize]byte, len(t)-1) - for i := range b { - c.link[i+1].b = b[i][:] - } - return c -} - -// Reset resets the state of Chain. It calls Reset on all the Transformers. -func (c *chain) Reset() { - for i, l := range c.link { - if l.t != nil { - l.t.Reset() - } - c.link[i].p, c.link[i].n = 0, 0 - } -} - -// TODO: make chain use Span (is going to be fun to implement!) - -// Transform applies the transformers of c in sequence. -func (c *chain) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - // Set up src and dst in the chain. - srcL := &c.link[0] - dstL := &c.link[len(c.link)-1] - srcL.b, srcL.p, srcL.n = src, 0, len(src) - dstL.b, dstL.n = dst, 0 - var lastFull, needProgress bool // for detecting progress - - // i is the index of the next Transformer to apply, for i in [low, high]. - // low is the lowest index for which c.link[low] may still produce bytes. - // high is the highest index for which c.link[high] has a Transformer. - // The error returned by Transform determines whether to increase or - // decrease i. We try to completely fill a buffer before converting it. - for low, i, high := c.errStart, c.errStart, len(c.link)-2; low <= i && i <= high; { - in, out := &c.link[i], &c.link[i+1] - nDst, nSrc, err0 := in.t.Transform(out.dst(), in.src(), atEOF && low == i) - out.n += nDst - in.p += nSrc - if i > 0 && in.p == in.n { - in.p, in.n = 0, 0 - } - needProgress, lastFull = lastFull, false - switch err0 { - case ErrShortDst: - // Process the destination buffer next. Return if we are already - // at the high index. - if i == high { - return dstL.n, srcL.p, ErrShortDst - } - if out.n != 0 { - i++ - // If the Transformer at the next index is not able to process any - // source bytes there is nothing that can be done to make progress - // and the bytes will remain unprocessed. lastFull is used to - // detect this and break out of the loop with a fatal error. - lastFull = true - continue - } - // The destination buffer was too small, but is completely empty. - // Return a fatal error as this transformation can never complete. - c.fatalError(i, errShortInternal) - case ErrShortSrc: - if i == 0 { - // Save ErrShortSrc in err. All other errors take precedence. - err = ErrShortSrc - break - } - // Source bytes were depleted before filling up the destination buffer. - // Verify we made some progress, move the remaining bytes to the errStart - // and try to get more source bytes. - if needProgress && nSrc == 0 || in.n-in.p == len(in.b) { - // There were not enough source bytes to proceed while the source - // buffer cannot hold any more bytes. Return a fatal error as this - // transformation can never complete. - c.fatalError(i, errShortInternal) - break - } - // in.b is an internal buffer and we can make progress. - in.p, in.n = 0, copy(in.b, in.src()) - fallthrough - case nil: - // if i == low, we have depleted the bytes at index i or any lower levels. - // In that case we increase low and i. In all other cases we decrease i to - // fetch more bytes before proceeding to the next index. - if i > low { - i-- - continue - } - default: - c.fatalError(i, err0) - } - // Exhausted level low or fatal error: increase low and continue - // to process the bytes accepted so far. - i++ - low = i - } - - // If c.errStart > 0, this means we found a fatal error. We will clear - // all upstream buffers. At this point, no more progress can be made - // downstream, as Transform would have bailed while handling ErrShortDst. - if c.errStart > 0 { - for i := 1; i < c.errStart; i++ { - c.link[i].p, c.link[i].n = 0, 0 - } - err, c.errStart, c.err = c.err, 0, nil - } - return dstL.n, srcL.p, err -} - -// Deprecated: Use runes.Remove instead. -func RemoveFunc(f func(r rune) bool) Transformer { - return removeF(f) -} - -type removeF func(r rune) bool - -func (removeF) Reset() {} - -// Transform implements the Transformer interface. -func (t removeF) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - for r, sz := rune(0), 0; len(src) > 0; src = src[sz:] { - - if r = rune(src[0]); r < utf8.RuneSelf { - sz = 1 - } else { - r, sz = utf8.DecodeRune(src) - - if sz == 1 { - // Invalid rune. - if !atEOF && !utf8.FullRune(src) { - err = ErrShortSrc - break - } - // We replace illegal bytes with RuneError. Not doing so might - // otherwise turn a sequence of invalid UTF-8 into valid UTF-8. - // The resulting byte sequence may subsequently contain runes - // for which t(r) is true that were passed unnoticed. - if !t(r) { - if nDst+3 > len(dst) { - err = ErrShortDst - break - } - nDst += copy(dst[nDst:], "\uFFFD") - } - nSrc++ - continue - } - } - - if !t(r) { - if nDst+sz > len(dst) { - err = ErrShortDst - break - } - nDst += copy(dst[nDst:], src[:sz]) - } - nSrc += sz - } - return -} - -// grow returns a new []byte that is longer than b, and copies the first n bytes -// of b to the start of the new slice. -func grow(b []byte, n int) []byte { - m := len(b) - if m <= 32 { - m = 64 - } else if m <= 256 { - m *= 2 - } else { - m += m >> 1 - } - buf := make([]byte, m) - copy(buf, b[:n]) - return buf -} - -const initialBufSize = 128 - -// String returns a string with the result of converting s[:n] using t, where -// n <= len(s). If err == nil, n will be len(s). It calls Reset on t. -func String(t Transformer, s string) (result string, n int, err error) { - t.Reset() - if s == "" { - // Fast path for the common case for empty input. Results in about a - // 86% reduction of running time for BenchmarkStringLowerEmpty. - if _, _, err := t.Transform(nil, nil, true); err == nil { - return "", 0, nil - } - } - - // Allocate only once. Note that both dst and src escape when passed to - // Transform. - buf := [2 * initialBufSize]byte{} - dst := buf[:initialBufSize:initialBufSize] - src := buf[initialBufSize : 2*initialBufSize] - - // The input string s is transformed in multiple chunks (starting with a - // chunk size of initialBufSize). nDst and nSrc are per-chunk (or - // per-Transform-call) indexes, pDst and pSrc are overall indexes. - nDst, nSrc := 0, 0 - pDst, pSrc := 0, 0 - - // pPrefix is the length of a common prefix: the first pPrefix bytes of the - // result will equal the first pPrefix bytes of s. It is not guaranteed to - // be the largest such value, but if pPrefix, len(result) and len(s) are - // all equal after the final transform (i.e. calling Transform with atEOF - // being true returned nil error) then we don't need to allocate a new - // result string. - pPrefix := 0 - for { - // Invariant: pDst == pPrefix && pSrc == pPrefix. - - n := copy(src, s[pSrc:]) - nDst, nSrc, err = t.Transform(dst, src[:n], pSrc+n == len(s)) - pDst += nDst - pSrc += nSrc - - // TODO: let transformers implement an optional Spanner interface, akin - // to norm's QuickSpan. This would even allow us to avoid any allocation. - if !bytes.Equal(dst[:nDst], src[:nSrc]) { - break - } - pPrefix = pSrc - if err == ErrShortDst { - // A buffer can only be short if a transformer modifies its input. - break - } else if err == ErrShortSrc { - if nSrc == 0 { - // No progress was made. - break - } - // Equal so far and !atEOF, so continue checking. - } else if err != nil || pPrefix == len(s) { - return string(s[:pPrefix]), pPrefix, err - } - } - // Post-condition: pDst == pPrefix + nDst && pSrc == pPrefix + nSrc. - - // We have transformed the first pSrc bytes of the input s to become pDst - // transformed bytes. Those transformed bytes are discontiguous: the first - // pPrefix of them equal s[:pPrefix] and the last nDst of them equal - // dst[:nDst]. We copy them around, into a new dst buffer if necessary, so - // that they become one contiguous slice: dst[:pDst]. - if pPrefix != 0 { - newDst := dst - if pDst > len(newDst) { - newDst = make([]byte, len(s)+nDst-nSrc) - } - copy(newDst[pPrefix:pDst], dst[:nDst]) - copy(newDst[:pPrefix], s[:pPrefix]) - dst = newDst - } - - // Prevent duplicate Transform calls with atEOF being true at the end of - // the input. Also return if we have an unrecoverable error. - if (err == nil && pSrc == len(s)) || - (err != nil && err != ErrShortDst && err != ErrShortSrc) { - return string(dst[:pDst]), pSrc, err - } - - // Transform the remaining input, growing dst and src buffers as necessary. - for { - n := copy(src, s[pSrc:]) - atEOF := pSrc+n == len(s) - nDst, nSrc, err := t.Transform(dst[pDst:], src[:n], atEOF) - pDst += nDst - pSrc += nSrc - - // If we got ErrShortDst or ErrShortSrc, do not grow as long as we can - // make progress. This may avoid excessive allocations. - if err == ErrShortDst { - if nDst == 0 { - dst = grow(dst, pDst) - } - } else if err == ErrShortSrc { - if atEOF { - return string(dst[:pDst]), pSrc, err - } - if nSrc == 0 { - src = grow(src, 0) - } - } else if err != nil || pSrc == len(s) { - return string(dst[:pDst]), pSrc, err - } - } -} - -// Bytes returns a new byte slice with the result of converting b[:n] using t, -// where n <= len(b). If err == nil, n will be len(b). It calls Reset on t. -func Bytes(t Transformer, b []byte) (result []byte, n int, err error) { - return doAppend(t, 0, make([]byte, len(b)), b) -} - -// Append appends the result of converting src[:n] using t to dst, where -// n <= len(src), If err == nil, n will be len(src). It calls Reset on t. -func Append(t Transformer, dst, src []byte) (result []byte, n int, err error) { - if len(dst) == cap(dst) { - n := len(src) + len(dst) // It is okay for this to be 0. - b := make([]byte, n) - dst = b[:copy(b, dst)] - } - return doAppend(t, len(dst), dst[:cap(dst)], src) -} - -func doAppend(t Transformer, pDst int, dst, src []byte) (result []byte, n int, err error) { - t.Reset() - pSrc := 0 - for { - nDst, nSrc, err := t.Transform(dst[pDst:], src[pSrc:], true) - pDst += nDst - pSrc += nSrc - if err != ErrShortDst { - return dst[:pDst], pSrc, err - } - - // Grow the destination buffer, but do not grow as long as we can make - // progress. This may avoid excessive allocations. - if nDst == 0 { - dst = grow(dst, pDst) - } - } -} diff --git a/embed/vendor/golang.org/x/text/unicode/norm/composition.go b/embed/vendor/golang.org/x/text/unicode/norm/composition.go deleted file mode 100644 index e2087bce..00000000 --- a/embed/vendor/golang.org/x/text/unicode/norm/composition.go +++ /dev/null @@ -1,512 +0,0 @@ -// Copyright 2011 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package norm - -import "unicode/utf8" - -const ( - maxNonStarters = 30 - // The maximum number of characters needed for a buffer is - // maxNonStarters + 1 for the starter + 1 for the GCJ - maxBufferSize = maxNonStarters + 2 - maxNFCExpansion = 3 // NFC(0x1D160) - maxNFKCExpansion = 18 // NFKC(0xFDFA) - - maxByteBufferSize = utf8.UTFMax * maxBufferSize // 128 -) - -// ssState is used for reporting the segment state after inserting a rune. -// It is returned by streamSafe.next. -type ssState int - -const ( - // Indicates a rune was successfully added to the segment. - ssSuccess ssState = iota - // Indicates a rune starts a new segment and should not be added. - ssStarter - // Indicates a rune caused a segment overflow and a CGJ should be inserted. - ssOverflow -) - -// streamSafe implements the policy of when a CGJ should be inserted. -type streamSafe uint8 - -// first inserts the first rune of a segment. It is a faster version of next if -// it is known p represents the first rune in a segment. -func (ss *streamSafe) first(p Properties) { - *ss = streamSafe(p.nTrailingNonStarters()) -} - -// insert returns a ssState value to indicate whether a rune represented by p -// can be inserted. -func (ss *streamSafe) next(p Properties) ssState { - if *ss > maxNonStarters { - panic("streamSafe was not reset") - } - n := p.nLeadingNonStarters() - if *ss += streamSafe(n); *ss > maxNonStarters { - *ss = 0 - return ssOverflow - } - // The Stream-Safe Text Processing prescribes that the counting can stop - // as soon as a starter is encountered. However, there are some starters, - // like Jamo V and T, that can combine with other runes, leaving their - // successive non-starters appended to the previous, possibly causing an - // overflow. We will therefore consider any rune with a non-zero nLead to - // be a non-starter. Note that it always hold that if nLead > 0 then - // nLead == nTrail. - if n == 0 { - *ss = streamSafe(p.nTrailingNonStarters()) - return ssStarter - } - return ssSuccess -} - -// backwards is used for checking for overflow and segment starts -// when traversing a string backwards. Users do not need to call first -// for the first rune. The state of the streamSafe retains the count of -// the non-starters loaded. -func (ss *streamSafe) backwards(p Properties) ssState { - if *ss > maxNonStarters { - panic("streamSafe was not reset") - } - c := *ss + streamSafe(p.nTrailingNonStarters()) - if c > maxNonStarters { - return ssOverflow - } - *ss = c - if p.nLeadingNonStarters() == 0 { - return ssStarter - } - return ssSuccess -} - -func (ss streamSafe) isMax() bool { - return ss == maxNonStarters -} - -// GraphemeJoiner is inserted after maxNonStarters non-starter runes. -const GraphemeJoiner = "\u034F" - -// reorderBuffer is used to normalize a single segment. Characters inserted with -// insert are decomposed and reordered based on CCC. The compose method can -// be used to recombine characters. Note that the byte buffer does not hold -// the UTF-8 characters in order. Only the rune array is maintained in sorted -// order. flush writes the resulting segment to a byte array. -type reorderBuffer struct { - rune [maxBufferSize]Properties // Per character info. - byte [maxByteBufferSize]byte // UTF-8 buffer. Referenced by runeInfo.pos. - nbyte uint8 // Number or bytes. - ss streamSafe // For limiting length of non-starter sequence. - nrune int // Number of runeInfos. - f formInfo - - src input - nsrc int - tmpBytes input - - out []byte - flushF func(*reorderBuffer) bool -} - -func (rb *reorderBuffer) init(f Form, src []byte) { - rb.f = *formTable[f] - rb.src.setBytes(src) - rb.nsrc = len(src) - rb.ss = 0 -} - -func (rb *reorderBuffer) initString(f Form, src string) { - rb.f = *formTable[f] - rb.src.setString(src) - rb.nsrc = len(src) - rb.ss = 0 -} - -func (rb *reorderBuffer) setFlusher(out []byte, f func(*reorderBuffer) bool) { - rb.out = out - rb.flushF = f -} - -// reset discards all characters from the buffer. -func (rb *reorderBuffer) reset() { - rb.nrune = 0 - rb.nbyte = 0 -} - -func (rb *reorderBuffer) doFlush() bool { - if rb.f.composing { - rb.compose() - } - res := rb.flushF(rb) - rb.reset() - return res -} - -// appendFlush appends the normalized segment to rb.out. -func appendFlush(rb *reorderBuffer) bool { - for i := 0; i < rb.nrune; i++ { - start := rb.rune[i].pos - end := start + rb.rune[i].size - rb.out = append(rb.out, rb.byte[start:end]...) - } - return true -} - -// flush appends the normalized segment to out and resets rb. -func (rb *reorderBuffer) flush(out []byte) []byte { - for i := 0; i < rb.nrune; i++ { - start := rb.rune[i].pos - end := start + rb.rune[i].size - out = append(out, rb.byte[start:end]...) - } - rb.reset() - return out -} - -// flushCopy copies the normalized segment to buf and resets rb. -// It returns the number of bytes written to buf. -func (rb *reorderBuffer) flushCopy(buf []byte) int { - p := 0 - for i := 0; i < rb.nrune; i++ { - runep := rb.rune[i] - p += copy(buf[p:], rb.byte[runep.pos:runep.pos+runep.size]) - } - rb.reset() - return p -} - -// insertOrdered inserts a rune in the buffer, ordered by Canonical Combining Class. -// It returns false if the buffer is not large enough to hold the rune. -// It is used internally by insert and insertString only. -func (rb *reorderBuffer) insertOrdered(info Properties) { - n := rb.nrune - b := rb.rune[:] - cc := info.ccc - if cc > 0 { - // Find insertion position + move elements to make room. - for ; n > 0; n-- { - if b[n-1].ccc <= cc { - break - } - b[n] = b[n-1] - } - } - rb.nrune += 1 - pos := uint8(rb.nbyte) - rb.nbyte += utf8.UTFMax - info.pos = pos - b[n] = info -} - -// insertErr is an error code returned by insert. Using this type instead -// of error improves performance up to 20% for many of the benchmarks. -type insertErr int - -const ( - iSuccess insertErr = -iota - iShortDst - iShortSrc -) - -// insertFlush inserts the given rune in the buffer ordered by CCC. -// If a decomposition with multiple segments are encountered, they leading -// ones are flushed. -// It returns a non-zero error code if the rune was not inserted. -func (rb *reorderBuffer) insertFlush(src input, i int, info Properties) insertErr { - if rune := src.hangul(i); rune != 0 { - rb.decomposeHangul(rune) - return iSuccess - } - if info.hasDecomposition() { - return rb.insertDecomposed(info.Decomposition()) - } - rb.insertSingle(src, i, info) - return iSuccess -} - -// insertUnsafe inserts the given rune in the buffer ordered by CCC. -// It is assumed there is sufficient space to hold the runes. It is the -// responsibility of the caller to ensure this. This can be done by checking -// the state returned by the streamSafe type. -func (rb *reorderBuffer) insertUnsafe(src input, i int, info Properties) { - if rune := src.hangul(i); rune != 0 { - rb.decomposeHangul(rune) - } - if info.hasDecomposition() { - // TODO: inline. - rb.insertDecomposed(info.Decomposition()) - } else { - rb.insertSingle(src, i, info) - } -} - -// insertDecomposed inserts an entry in to the reorderBuffer for each rune -// in dcomp. dcomp must be a sequence of decomposed UTF-8-encoded runes. -// It flushes the buffer on each new segment start. -func (rb *reorderBuffer) insertDecomposed(dcomp []byte) insertErr { - rb.tmpBytes.setBytes(dcomp) - // As the streamSafe accounting already handles the counting for modifiers, - // we don't have to call next. However, we do need to keep the accounting - // intact when flushing the buffer. - for i := 0; i < len(dcomp); { - info := rb.f.info(rb.tmpBytes, i) - if info.BoundaryBefore() && rb.nrune > 0 && !rb.doFlush() { - return iShortDst - } - i += copy(rb.byte[rb.nbyte:], dcomp[i:i+int(info.size)]) - rb.insertOrdered(info) - } - return iSuccess -} - -// insertSingle inserts an entry in the reorderBuffer for the rune at -// position i. info is the runeInfo for the rune at position i. -func (rb *reorderBuffer) insertSingle(src input, i int, info Properties) { - src.copySlice(rb.byte[rb.nbyte:], i, i+int(info.size)) - rb.insertOrdered(info) -} - -// insertCGJ inserts a Combining Grapheme Joiner (0x034f) into rb. -func (rb *reorderBuffer) insertCGJ() { - rb.insertSingle(input{str: GraphemeJoiner}, 0, Properties{size: uint8(len(GraphemeJoiner))}) -} - -// appendRune inserts a rune at the end of the buffer. It is used for Hangul. -func (rb *reorderBuffer) appendRune(r rune) { - bn := rb.nbyte - sz := utf8.EncodeRune(rb.byte[bn:], rune(r)) - rb.nbyte += utf8.UTFMax - rb.rune[rb.nrune] = Properties{pos: bn, size: uint8(sz)} - rb.nrune++ -} - -// assignRune sets a rune at position pos. It is used for Hangul and recomposition. -func (rb *reorderBuffer) assignRune(pos int, r rune) { - bn := rb.rune[pos].pos - sz := utf8.EncodeRune(rb.byte[bn:], rune(r)) - rb.rune[pos] = Properties{pos: bn, size: uint8(sz)} -} - -// runeAt returns the rune at position n. It is used for Hangul and recomposition. -func (rb *reorderBuffer) runeAt(n int) rune { - inf := rb.rune[n] - r, _ := utf8.DecodeRune(rb.byte[inf.pos : inf.pos+inf.size]) - return r -} - -// bytesAt returns the UTF-8 encoding of the rune at position n. -// It is used for Hangul and recomposition. -func (rb *reorderBuffer) bytesAt(n int) []byte { - inf := rb.rune[n] - return rb.byte[inf.pos : int(inf.pos)+int(inf.size)] -} - -// For Hangul we combine algorithmically, instead of using tables. -const ( - hangulBase = 0xAC00 // UTF-8(hangulBase) -> EA B0 80 - hangulBase0 = 0xEA - hangulBase1 = 0xB0 - hangulBase2 = 0x80 - - hangulEnd = hangulBase + jamoLVTCount // UTF-8(0xD7A4) -> ED 9E A4 - hangulEnd0 = 0xED - hangulEnd1 = 0x9E - hangulEnd2 = 0xA4 - - jamoLBase = 0x1100 // UTF-8(jamoLBase) -> E1 84 00 - jamoLBase0 = 0xE1 - jamoLBase1 = 0x84 - jamoLEnd = 0x1113 - jamoVBase = 0x1161 - jamoVEnd = 0x1176 - jamoTBase = 0x11A7 - jamoTEnd = 0x11C3 - - jamoTCount = 28 - jamoVCount = 21 - jamoVTCount = 21 * 28 - jamoLVTCount = 19 * 21 * 28 -) - -const hangulUTF8Size = 3 - -func isHangul(b []byte) bool { - if len(b) < hangulUTF8Size { - return false - } - b0 := b[0] - if b0 < hangulBase0 { - return false - } - b1 := b[1] - switch { - case b0 == hangulBase0: - return b1 >= hangulBase1 - case b0 < hangulEnd0: - return true - case b0 > hangulEnd0: - return false - case b1 < hangulEnd1: - return true - } - return b1 == hangulEnd1 && b[2] < hangulEnd2 -} - -func isHangulString(b string) bool { - if len(b) < hangulUTF8Size { - return false - } - b0 := b[0] - if b0 < hangulBase0 { - return false - } - b1 := b[1] - switch { - case b0 == hangulBase0: - return b1 >= hangulBase1 - case b0 < hangulEnd0: - return true - case b0 > hangulEnd0: - return false - case b1 < hangulEnd1: - return true - } - return b1 == hangulEnd1 && b[2] < hangulEnd2 -} - -// Caller must ensure len(b) >= 2. -func isJamoVT(b []byte) bool { - // True if (rune & 0xff00) == jamoLBase - return b[0] == jamoLBase0 && (b[1]&0xFC) == jamoLBase1 -} - -func isHangulWithoutJamoT(b []byte) bool { - c, _ := utf8.DecodeRune(b) - c -= hangulBase - return c < jamoLVTCount && c%jamoTCount == 0 -} - -// decomposeHangul writes the decomposed Hangul to buf and returns the number -// of bytes written. len(buf) should be at least 9. -func decomposeHangul(buf []byte, r rune) int { - const JamoUTF8Len = 3 - r -= hangulBase - x := r % jamoTCount - r /= jamoTCount - utf8.EncodeRune(buf, jamoLBase+r/jamoVCount) - utf8.EncodeRune(buf[JamoUTF8Len:], jamoVBase+r%jamoVCount) - if x != 0 { - utf8.EncodeRune(buf[2*JamoUTF8Len:], jamoTBase+x) - return 3 * JamoUTF8Len - } - return 2 * JamoUTF8Len -} - -// decomposeHangul algorithmically decomposes a Hangul rune into -// its Jamo components. -// See https://unicode.org/reports/tr15/#Hangul for details on decomposing Hangul. -func (rb *reorderBuffer) decomposeHangul(r rune) { - r -= hangulBase - x := r % jamoTCount - r /= jamoTCount - rb.appendRune(jamoLBase + r/jamoVCount) - rb.appendRune(jamoVBase + r%jamoVCount) - if x != 0 { - rb.appendRune(jamoTBase + x) - } -} - -// combineHangul algorithmically combines Jamo character components into Hangul. -// See https://unicode.org/reports/tr15/#Hangul for details on combining Hangul. -func (rb *reorderBuffer) combineHangul(s, i, k int) { - b := rb.rune[:] - bn := rb.nrune - for ; i < bn; i++ { - cccB := b[k-1].ccc - cccC := b[i].ccc - if cccB == 0 { - s = k - 1 - } - if s != k-1 && cccB >= cccC { - // b[i] is blocked by greater-equal cccX below it - b[k] = b[i] - k++ - } else { - l := rb.runeAt(s) // also used to compare to hangulBase - v := rb.runeAt(i) // also used to compare to jamoT - switch { - case jamoLBase <= l && l < jamoLEnd && - jamoVBase <= v && v < jamoVEnd: - // 11xx plus 116x to LV - rb.assignRune(s, hangulBase+ - (l-jamoLBase)*jamoVTCount+(v-jamoVBase)*jamoTCount) - case hangulBase <= l && l < hangulEnd && - jamoTBase < v && v < jamoTEnd && - ((l-hangulBase)%jamoTCount) == 0: - // ACxx plus 11Ax to LVT - rb.assignRune(s, l+v-jamoTBase) - default: - b[k] = b[i] - k++ - } - } - } - rb.nrune = k -} - -// compose recombines the runes in the buffer. -// It should only be used to recompose a single segment, as it will not -// handle alternations between Hangul and non-Hangul characters correctly. -func (rb *reorderBuffer) compose() { - // Lazily load the map used by the combine func below, but do - // it outside of the loop. - recompMapOnce.Do(buildRecompMap) - - // UAX #15, section X5 , including Corrigendum #5 - // "In any character sequence beginning with starter S, a character C is - // blocked from S if and only if there is some character B between S - // and C, and either B is a starter or it has the same or higher - // combining class as C." - bn := rb.nrune - if bn == 0 { - return - } - k := 1 - b := rb.rune[:] - for s, i := 0, 1; i < bn; i++ { - if isJamoVT(rb.bytesAt(i)) { - // Redo from start in Hangul mode. Necessary to support - // U+320E..U+321E in NFKC mode. - rb.combineHangul(s, i, k) - return - } - ii := b[i] - // We can only use combineForward as a filter if we later - // get the info for the combined character. This is more - // expensive than using the filter. Using combinesBackward() - // is safe. - if ii.combinesBackward() { - cccB := b[k-1].ccc - cccC := ii.ccc - blocked := false // b[i] blocked by starter or greater or equal CCC? - if cccB == 0 { - s = k - 1 - } else { - blocked = s != k-1 && cccB >= cccC - } - if !blocked { - combined := combine(rb.runeAt(s), rb.runeAt(i)) - if combined != 0 { - rb.assignRune(s, combined) - continue - } - } - } - b[k] = b[i] - k++ - } - rb.nrune = k -} diff --git a/embed/vendor/golang.org/x/text/unicode/norm/forminfo.go b/embed/vendor/golang.org/x/text/unicode/norm/forminfo.go deleted file mode 100644 index f3a234e5..00000000 --- a/embed/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ /dev/null @@ -1,289 +0,0 @@ -// Copyright 2011 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package norm - -import "encoding/binary" - -// This file contains Form-specific logic and wrappers for data in tables.go. - -// Rune info is stored in a separate trie per composing form. A composing form -// and its corresponding decomposing form share the same trie. Each trie maps -// a rune to a uint16. The values take two forms. For v >= 0x8000: -// bits -// 15: 1 (inverse of NFD_QC bit of qcInfo) -// 12..7: qcInfo (see below). isYesD is always true (no decomposition). -// 6..0: ccc (compressed CCC value). -// For v < 0x8000, the respective rune has a decomposition and v is an index -// into a byte array of UTF-8 decomposition sequences and additional info and -// has the form: -//
* [ []] -// The header contains the number of bytes in the decomposition (excluding this -// length byte), with 33 mapped to 31 to fit in 5 bits. -// (If any 31- or 32-byte decompositions come along, we could switch to using -// use a general lookup table as long as there are at most 32 distinct lengths.) -// The three most significant bits of this length byte correspond -// to bit 5, 4, and 3 of qcInfo (see below). The byte sequence itself starts at v+1. -// The byte sequence is followed by a trailing and leading CCC if the values -// for these are not zero. The value of v determines which ccc are appended -// to the sequences. For v < firstCCC, there are none, for v >= firstCCC, -// the sequence is followed by a trailing ccc, and for v >= firstLeadingCC -// there is an additional leading ccc. The value of tccc itself is the -// trailing CCC shifted left 2 bits. The two least-significant bits of tccc -// are the number of trailing non-starters. - -const ( - qcInfoMask = 0x3F // to clear all but the relevant bits in a qcInfo - headerLenMask = 0x1F // extract the length value from the header byte (31 => 33) - headerFlagsMask = 0xE0 // extract the qcInfo bits from the header byte -) - -// Properties provides access to normalization properties of a rune. -type Properties struct { - pos uint8 // start position in reorderBuffer; used in composition.go - size uint8 // length of UTF-8 encoding of this rune - ccc uint8 // leading canonical combining class (ccc if not decomposition) - tccc uint8 // trailing canonical combining class (ccc if not decomposition) - nLead uint8 // number of leading non-starters. - flags qcInfo // quick check flags - index uint16 -} - -// functions dispatchable per form -type lookupFunc func(b input, i int) Properties - -// formInfo holds Form-specific functions and tables. -type formInfo struct { - form Form - composing, compatibility bool // form type - info lookupFunc - nextMain iterFunc -} - -var formTable = []*formInfo{{ - form: NFC, - composing: true, - compatibility: false, - info: lookupInfoNFC, - nextMain: nextComposed, -}, { - form: NFD, - composing: false, - compatibility: false, - info: lookupInfoNFC, - nextMain: nextDecomposed, -}, { - form: NFKC, - composing: true, - compatibility: true, - info: lookupInfoNFKC, - nextMain: nextComposed, -}, { - form: NFKD, - composing: false, - compatibility: true, - info: lookupInfoNFKC, - nextMain: nextDecomposed, -}} - -// We do not distinguish between boundaries for NFC, NFD, etc. to avoid -// unexpected behavior for the user. For example, in NFD, there is a boundary -// after 'a'. However, 'a' might combine with modifiers, so from the application's -// perspective it is not a good boundary. We will therefore always use the -// boundaries for the combining variants. - -// BoundaryBefore returns true if this rune starts a new segment and -// cannot combine with any rune on the left. -func (p Properties) BoundaryBefore() bool { - if p.ccc == 0 && !p.combinesBackward() { - return true - } - // We assume that the CCC of the first character in a decomposition - // is always non-zero if different from info.ccc and that we can return - // false at this point. This is verified by maketables. - return false -} - -// BoundaryAfter returns true if runes cannot combine with or otherwise -// interact with this or previous runes. -func (p Properties) BoundaryAfter() bool { - // TODO: loosen these conditions. - return p.isInert() -} - -// We pack quick check data in 6 bits: -// -// 5: Combines forward (0 == false, 1 == true) -// 4..3: NFC_QC Yes(00), No (10), or Maybe (11) -// 2: NFD_QC Yes (0) or No (1). No also means there is a decomposition. -// 1..0: Number of trailing non-starters. -// -// When all 6 bits are zero, the character is inert, meaning it is never -// influenced by normalization. -type qcInfo uint8 - -func (p Properties) isYesC() bool { return p.flags&0x10 == 0 } -func (p Properties) isYesD() bool { return p.flags&0x4 == 0 } - -func (p Properties) combinesForward() bool { return p.flags&0x20 != 0 } -func (p Properties) combinesBackward() bool { return p.flags&0x8 != 0 } // == isMaybe -func (p Properties) hasDecomposition() bool { return p.flags&0x4 != 0 } // == isNoD - -func (p Properties) isInert() bool { - return p.flags&qcInfoMask == 0 && p.ccc == 0 -} - -func (p Properties) multiSegment() bool { - return p.index >= firstMulti && p.index < endMulti -} - -func (p Properties) nLeadingNonStarters() uint8 { - return p.nLead -} - -func (p Properties) nTrailingNonStarters() uint8 { - return uint8(p.flags & 0x03) -} - -// Decomposition returns the decomposition for the underlying rune -// or nil if there is none. -func (p Properties) Decomposition() []byte { - // TODO: create the decomposition for Hangul? - if p.index == 0 { - return nil - } - i := p.index - n := decomps[i] & headerLenMask - if n == 31 { - n = 33 - } - i++ - return decomps[i : i+uint16(n)] -} - -// Size returns the length of UTF-8 encoding of the rune. -func (p Properties) Size() int { - return int(p.size) -} - -// CCC returns the canonical combining class of the underlying rune. -func (p Properties) CCC() uint8 { - if p.index >= firstCCCZeroExcept { - return 0 - } - return ccc[p.ccc] -} - -// LeadCCC returns the CCC of the first rune in the decomposition. -// If there is no decomposition, LeadCCC equals CCC. -func (p Properties) LeadCCC() uint8 { - return ccc[p.ccc] -} - -// TrailCCC returns the CCC of the last rune in the decomposition. -// If there is no decomposition, TrailCCC equals CCC. -func (p Properties) TrailCCC() uint8 { - return ccc[p.tccc] -} - -func buildRecompMap() { - recompMap = make(map[uint32]rune, len(recompMapPacked)/8) - var buf [8]byte - for i := 0; i < len(recompMapPacked); i += 8 { - copy(buf[:], recompMapPacked[i:i+8]) - key := binary.BigEndian.Uint32(buf[:4]) - val := binary.BigEndian.Uint32(buf[4:]) - recompMap[key] = rune(val) - } -} - -// Recomposition -// We use 32-bit keys instead of 64-bit for the two codepoint keys. -// This clips off the bits of three entries, but we know this will not -// result in a collision. In the unlikely event that changes to -// UnicodeData.txt introduce collisions, the compiler will catch it. -// Note that the recomposition map for NFC and NFKC are identical. - -// combine returns the combined rune or 0 if it doesn't exist. -// -// The caller is responsible for calling -// recompMapOnce.Do(buildRecompMap) sometime before this is called. -func combine(a, b rune) rune { - key := uint32(uint16(a))<<16 + uint32(uint16(b)) - if recompMap == nil { - panic("caller error") // see func comment - } - return recompMap[key] -} - -func lookupInfoNFC(b input, i int) Properties { - v, sz := b.charinfoNFC(i) - return compInfo(v, sz) -} - -func lookupInfoNFKC(b input, i int) Properties { - v, sz := b.charinfoNFKC(i) - return compInfo(v, sz) -} - -// Properties returns properties for the first rune in s. -func (f Form) Properties(s []byte) Properties { - if f == NFC || f == NFD { - return compInfo(nfcData.lookup(s)) - } - return compInfo(nfkcData.lookup(s)) -} - -// PropertiesString returns properties for the first rune in s. -func (f Form) PropertiesString(s string) Properties { - if f == NFC || f == NFD { - return compInfo(nfcData.lookupString(s)) - } - return compInfo(nfkcData.lookupString(s)) -} - -// compInfo converts the information contained in v and sz -// to a Properties. See the comment at the top of the file -// for more information on the format. -func compInfo(v uint16, sz int) Properties { - if v == 0 { - return Properties{size: uint8(sz)} - } else if v >= 0x8000 { - p := Properties{ - size: uint8(sz), - ccc: uint8(v), - tccc: uint8(v), - flags: qcInfo(v >> 8), - } - if p.ccc > 0 || p.combinesBackward() { - p.nLead = uint8(p.flags & 0x3) - } - return p - } - // has decomposition - h := decomps[v] - f := (qcInfo(h&headerFlagsMask) >> 2) | 0x4 - p := Properties{size: uint8(sz), flags: f, index: v} - if v >= firstCCC { - n := uint16(h & headerLenMask) - if n == 31 { - n = 33 - } - v += n + 1 - c := decomps[v] - p.tccc = c >> 2 - p.flags |= qcInfo(c & 0x3) - if v >= firstLeadingCCC { - p.nLead = c & 0x3 - if v >= firstStarterWithNLead { - // We were tricked. Remove the decomposition. - p.flags &= 0x03 - p.index = 0 - return p - } - p.ccc = decomps[v+1] - } - } - return p -} diff --git a/embed/vendor/golang.org/x/text/unicode/norm/input.go b/embed/vendor/golang.org/x/text/unicode/norm/input.go deleted file mode 100644 index 479e35bc..00000000 --- a/embed/vendor/golang.org/x/text/unicode/norm/input.go +++ /dev/null @@ -1,109 +0,0 @@ -// Copyright 2011 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package norm - -import "unicode/utf8" - -type input struct { - str string - bytes []byte -} - -func inputBytes(str []byte) input { - return input{bytes: str} -} - -func inputString(str string) input { - return input{str: str} -} - -func (in *input) setBytes(str []byte) { - in.str = "" - in.bytes = str -} - -func (in *input) setString(str string) { - in.str = str - in.bytes = nil -} - -func (in *input) _byte(p int) byte { - if in.bytes == nil { - return in.str[p] - } - return in.bytes[p] -} - -func (in *input) skipASCII(p, max int) int { - if in.bytes == nil { - for ; p < max && in.str[p] < utf8.RuneSelf; p++ { - } - } else { - for ; p < max && in.bytes[p] < utf8.RuneSelf; p++ { - } - } - return p -} - -func (in *input) skipContinuationBytes(p int) int { - if in.bytes == nil { - for ; p < len(in.str) && !utf8.RuneStart(in.str[p]); p++ { - } - } else { - for ; p < len(in.bytes) && !utf8.RuneStart(in.bytes[p]); p++ { - } - } - return p -} - -func (in *input) appendSlice(buf []byte, b, e int) []byte { - if in.bytes != nil { - return append(buf, in.bytes[b:e]...) - } - for i := b; i < e; i++ { - buf = append(buf, in.str[i]) - } - return buf -} - -func (in *input) copySlice(buf []byte, b, e int) int { - if in.bytes == nil { - return copy(buf, in.str[b:e]) - } - return copy(buf, in.bytes[b:e]) -} - -func (in *input) charinfoNFC(p int) (uint16, int) { - if in.bytes == nil { - return nfcData.lookupString(in.str[p:]) - } - return nfcData.lookup(in.bytes[p:]) -} - -func (in *input) charinfoNFKC(p int) (uint16, int) { - if in.bytes == nil { - return nfkcData.lookupString(in.str[p:]) - } - return nfkcData.lookup(in.bytes[p:]) -} - -func (in *input) hangul(p int) (r rune) { - var size int - if in.bytes == nil { - if !isHangulString(in.str[p:]) { - return 0 - } - r, size = utf8.DecodeRuneInString(in.str[p:]) - } else { - if !isHangul(in.bytes[p:]) { - return 0 - } - r, size = utf8.DecodeRune(in.bytes[p:]) - } - if size != hangulUTF8Size { - return 0 - } - return r -} diff --git a/embed/vendor/golang.org/x/text/unicode/norm/iter.go b/embed/vendor/golang.org/x/text/unicode/norm/iter.go deleted file mode 100644 index 417c6b26..00000000 --- a/embed/vendor/golang.org/x/text/unicode/norm/iter.go +++ /dev/null @@ -1,458 +0,0 @@ -// Copyright 2011 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package norm - -import ( - "fmt" - "unicode/utf8" -) - -// MaxSegmentSize is the maximum size of a byte buffer needed to consider any -// sequence of starter and non-starter runes for the purpose of normalization. -const MaxSegmentSize = maxByteBufferSize - -// An Iter iterates over a string or byte slice, while normalizing it -// to a given Form. -type Iter struct { - rb reorderBuffer - buf [maxByteBufferSize]byte - info Properties // first character saved from previous iteration - next iterFunc // implementation of next depends on form - asciiF iterFunc - - p int // current position in input source - multiSeg []byte // remainder of multi-segment decomposition -} - -type iterFunc func(*Iter) []byte - -// Init initializes i to iterate over src after normalizing it to Form f. -func (i *Iter) Init(f Form, src []byte) { - i.p = 0 - if len(src) == 0 { - i.setDone() - i.rb.nsrc = 0 - return - } - i.multiSeg = nil - i.rb.init(f, src) - i.next = i.rb.f.nextMain - i.asciiF = nextASCIIBytes - i.info = i.rb.f.info(i.rb.src, i.p) - i.rb.ss.first(i.info) -} - -// InitString initializes i to iterate over src after normalizing it to Form f. -func (i *Iter) InitString(f Form, src string) { - i.p = 0 - if len(src) == 0 { - i.setDone() - i.rb.nsrc = 0 - return - } - i.multiSeg = nil - i.rb.initString(f, src) - i.next = i.rb.f.nextMain - i.asciiF = nextASCIIString - i.info = i.rb.f.info(i.rb.src, i.p) - i.rb.ss.first(i.info) -} - -// Seek sets the segment to be returned by the next call to Next to start -// at position p. It is the responsibility of the caller to set p to the -// start of a segment. -func (i *Iter) Seek(offset int64, whence int) (int64, error) { - var abs int64 - switch whence { - case 0: - abs = offset - case 1: - abs = int64(i.p) + offset - case 2: - abs = int64(i.rb.nsrc) + offset - default: - return 0, fmt.Errorf("norm: invalid whence") - } - if abs < 0 { - return 0, fmt.Errorf("norm: negative position") - } - if int(abs) >= i.rb.nsrc { - i.setDone() - return int64(i.p), nil - } - i.p = int(abs) - i.multiSeg = nil - i.next = i.rb.f.nextMain - i.info = i.rb.f.info(i.rb.src, i.p) - i.rb.ss.first(i.info) - return abs, nil -} - -// returnSlice returns a slice of the underlying input type as a byte slice. -// If the underlying is of type []byte, it will simply return a slice. -// If the underlying is of type string, it will copy the slice to the buffer -// and return that. -func (i *Iter) returnSlice(a, b int) []byte { - if i.rb.src.bytes == nil { - return i.buf[:copy(i.buf[:], i.rb.src.str[a:b])] - } - return i.rb.src.bytes[a:b] -} - -// Pos returns the byte position at which the next call to Next will commence processing. -func (i *Iter) Pos() int { - return i.p -} - -func (i *Iter) setDone() { - i.next = nextDone - i.p = i.rb.nsrc -} - -// Done returns true if there is no more input to process. -func (i *Iter) Done() bool { - return i.p >= i.rb.nsrc -} - -// Next returns f(i.input[i.Pos():n]), where n is a boundary of i.input. -// For any input a and b for which f(a) == f(b), subsequent calls -// to Next will return the same segments. -// Modifying runes are grouped together with the preceding starter, if such a starter exists. -// Although not guaranteed, n will typically be the smallest possible n. -func (i *Iter) Next() []byte { - return i.next(i) -} - -func nextASCIIBytes(i *Iter) []byte { - p := i.p + 1 - if p >= i.rb.nsrc { - p0 := i.p - i.setDone() - return i.rb.src.bytes[p0:p] - } - if i.rb.src.bytes[p] < utf8.RuneSelf { - p0 := i.p - i.p = p - return i.rb.src.bytes[p0:p] - } - i.info = i.rb.f.info(i.rb.src, i.p) - i.next = i.rb.f.nextMain - return i.next(i) -} - -func nextASCIIString(i *Iter) []byte { - p := i.p + 1 - if p >= i.rb.nsrc { - i.buf[0] = i.rb.src.str[i.p] - i.setDone() - return i.buf[:1] - } - if i.rb.src.str[p] < utf8.RuneSelf { - i.buf[0] = i.rb.src.str[i.p] - i.p = p - return i.buf[:1] - } - i.info = i.rb.f.info(i.rb.src, i.p) - i.next = i.rb.f.nextMain - return i.next(i) -} - -func nextHangul(i *Iter) []byte { - p := i.p - next := p + hangulUTF8Size - if next >= i.rb.nsrc { - i.setDone() - } else if i.rb.src.hangul(next) == 0 { - i.rb.ss.next(i.info) - i.info = i.rb.f.info(i.rb.src, i.p) - i.next = i.rb.f.nextMain - return i.next(i) - } - i.p = next - return i.buf[:decomposeHangul(i.buf[:], i.rb.src.hangul(p))] -} - -func nextDone(i *Iter) []byte { - return nil -} - -// nextMulti is used for iterating over multi-segment decompositions -// for decomposing normal forms. -func nextMulti(i *Iter) []byte { - j := 0 - d := i.multiSeg - // skip first rune - for j = 1; j < len(d) && !utf8.RuneStart(d[j]); j++ { - } - for j < len(d) { - info := i.rb.f.info(input{bytes: d}, j) - if info.BoundaryBefore() { - i.multiSeg = d[j:] - return d[:j] - } - j += int(info.size) - } - // treat last segment as normal decomposition - i.next = i.rb.f.nextMain - return i.next(i) -} - -// nextMultiNorm is used for iterating over multi-segment decompositions -// for composing normal forms. -func nextMultiNorm(i *Iter) []byte { - j := 0 - d := i.multiSeg - for j < len(d) { - info := i.rb.f.info(input{bytes: d}, j) - if info.BoundaryBefore() { - i.rb.compose() - seg := i.buf[:i.rb.flushCopy(i.buf[:])] - i.rb.insertUnsafe(input{bytes: d}, j, info) - i.multiSeg = d[j+int(info.size):] - return seg - } - i.rb.insertUnsafe(input{bytes: d}, j, info) - j += int(info.size) - } - i.multiSeg = nil - i.next = nextComposed - return doNormComposed(i) -} - -// nextDecomposed is the implementation of Next for forms NFD and NFKD. -func nextDecomposed(i *Iter) (next []byte) { - outp := 0 - inCopyStart, outCopyStart := i.p, 0 - for { - if sz := int(i.info.size); sz <= 1 { - i.rb.ss = 0 - p := i.p - i.p++ // ASCII or illegal byte. Either way, advance by 1. - if i.p >= i.rb.nsrc { - i.setDone() - return i.returnSlice(p, i.p) - } else if i.rb.src._byte(i.p) < utf8.RuneSelf { - i.next = i.asciiF - return i.returnSlice(p, i.p) - } - outp++ - } else if d := i.info.Decomposition(); d != nil { - // Note: If leading CCC != 0, then len(d) == 2 and last is also non-zero. - // Case 1: there is a leftover to copy. In this case the decomposition - // must begin with a modifier and should always be appended. - // Case 2: no leftover. Simply return d if followed by a ccc == 0 value. - p := outp + len(d) - if outp > 0 { - i.rb.src.copySlice(i.buf[outCopyStart:], inCopyStart, i.p) - // TODO: this condition should not be possible, but we leave it - // in for defensive purposes. - if p > len(i.buf) { - return i.buf[:outp] - } - } else if i.info.multiSegment() { - // outp must be 0 as multi-segment decompositions always - // start a new segment. - if i.multiSeg == nil { - i.multiSeg = d - i.next = nextMulti - return nextMulti(i) - } - // We are in the last segment. Treat as normal decomposition. - d = i.multiSeg - i.multiSeg = nil - p = len(d) - } - prevCC := i.info.tccc - if i.p += sz; i.p >= i.rb.nsrc { - i.setDone() - i.info = Properties{} // Force BoundaryBefore to succeed. - } else { - i.info = i.rb.f.info(i.rb.src, i.p) - } - switch i.rb.ss.next(i.info) { - case ssOverflow: - i.next = nextCGJDecompose - fallthrough - case ssStarter: - if outp > 0 { - copy(i.buf[outp:], d) - return i.buf[:p] - } - return d - } - copy(i.buf[outp:], d) - outp = p - inCopyStart, outCopyStart = i.p, outp - if i.info.ccc < prevCC { - goto doNorm - } - continue - } else if r := i.rb.src.hangul(i.p); r != 0 { - outp = decomposeHangul(i.buf[:], r) - i.p += hangulUTF8Size - inCopyStart, outCopyStart = i.p, outp - if i.p >= i.rb.nsrc { - i.setDone() - break - } else if i.rb.src.hangul(i.p) != 0 { - i.next = nextHangul - return i.buf[:outp] - } - } else { - p := outp + sz - if p > len(i.buf) { - break - } - outp = p - i.p += sz - } - if i.p >= i.rb.nsrc { - i.setDone() - break - } - prevCC := i.info.tccc - i.info = i.rb.f.info(i.rb.src, i.p) - if v := i.rb.ss.next(i.info); v == ssStarter { - break - } else if v == ssOverflow { - i.next = nextCGJDecompose - break - } - if i.info.ccc < prevCC { - goto doNorm - } - } - if outCopyStart == 0 { - return i.returnSlice(inCopyStart, i.p) - } else if inCopyStart < i.p { - i.rb.src.copySlice(i.buf[outCopyStart:], inCopyStart, i.p) - } - return i.buf[:outp] -doNorm: - // Insert what we have decomposed so far in the reorderBuffer. - // As we will only reorder, there will always be enough room. - i.rb.src.copySlice(i.buf[outCopyStart:], inCopyStart, i.p) - i.rb.insertDecomposed(i.buf[0:outp]) - return doNormDecomposed(i) -} - -func doNormDecomposed(i *Iter) []byte { - for { - i.rb.insertUnsafe(i.rb.src, i.p, i.info) - if i.p += int(i.info.size); i.p >= i.rb.nsrc { - i.setDone() - break - } - i.info = i.rb.f.info(i.rb.src, i.p) - if i.info.ccc == 0 { - break - } - if s := i.rb.ss.next(i.info); s == ssOverflow { - i.next = nextCGJDecompose - break - } - } - // new segment or too many combining characters: exit normalization - return i.buf[:i.rb.flushCopy(i.buf[:])] -} - -func nextCGJDecompose(i *Iter) []byte { - i.rb.ss = 0 - i.rb.insertCGJ() - i.next = nextDecomposed - i.rb.ss.first(i.info) - buf := doNormDecomposed(i) - return buf -} - -// nextComposed is the implementation of Next for forms NFC and NFKC. -func nextComposed(i *Iter) []byte { - outp, startp := 0, i.p - var prevCC uint8 - for { - if !i.info.isYesC() { - goto doNorm - } - prevCC = i.info.tccc - sz := int(i.info.size) - if sz == 0 { - sz = 1 // illegal rune: copy byte-by-byte - } - p := outp + sz - if p > len(i.buf) { - break - } - outp = p - i.p += sz - if i.p >= i.rb.nsrc { - i.setDone() - break - } else if i.rb.src._byte(i.p) < utf8.RuneSelf { - i.rb.ss = 0 - i.next = i.asciiF - break - } - i.info = i.rb.f.info(i.rb.src, i.p) - if v := i.rb.ss.next(i.info); v == ssStarter { - break - } else if v == ssOverflow { - i.next = nextCGJCompose - break - } - if i.info.ccc < prevCC { - goto doNorm - } - } - return i.returnSlice(startp, i.p) -doNorm: - // reset to start position - i.p = startp - i.info = i.rb.f.info(i.rb.src, i.p) - i.rb.ss.first(i.info) - if i.info.multiSegment() { - d := i.info.Decomposition() - info := i.rb.f.info(input{bytes: d}, 0) - i.rb.insertUnsafe(input{bytes: d}, 0, info) - i.multiSeg = d[int(info.size):] - i.next = nextMultiNorm - return nextMultiNorm(i) - } - i.rb.ss.first(i.info) - i.rb.insertUnsafe(i.rb.src, i.p, i.info) - return doNormComposed(i) -} - -func doNormComposed(i *Iter) []byte { - // First rune should already be inserted. - for { - if i.p += int(i.info.size); i.p >= i.rb.nsrc { - i.setDone() - break - } - i.info = i.rb.f.info(i.rb.src, i.p) - if s := i.rb.ss.next(i.info); s == ssStarter { - break - } else if s == ssOverflow { - i.next = nextCGJCompose - break - } - i.rb.insertUnsafe(i.rb.src, i.p, i.info) - } - i.rb.compose() - seg := i.buf[:i.rb.flushCopy(i.buf[:])] - return seg -} - -func nextCGJCompose(i *Iter) []byte { - i.rb.ss = 0 // instead of first - i.rb.insertCGJ() - i.next = nextComposed - // Note that we treat any rune with nLeadingNonStarters > 0 as a non-starter, - // even if they are not. This is particularly dubious for U+FF9E and UFF9A. - // If we ever change that, insert a check here. - i.rb.ss.first(i.info) - i.rb.insertUnsafe(i.rb.src, i.p, i.info) - return doNormComposed(i) -} diff --git a/embed/vendor/golang.org/x/text/unicode/norm/normalize.go b/embed/vendor/golang.org/x/text/unicode/norm/normalize.go deleted file mode 100644 index 4747ad07..00000000 --- a/embed/vendor/golang.org/x/text/unicode/norm/normalize.go +++ /dev/null @@ -1,610 +0,0 @@ -// Copyright 2011 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Note: the file data_test.go that is generated should not be checked in. -//go:generate go run maketables.go triegen.go -//go:generate go test -tags test - -// Package norm contains types and functions for normalizing Unicode strings. -package norm // import "golang.org/x/text/unicode/norm" - -import ( - "unicode/utf8" - - "golang.org/x/text/transform" -) - -// A Form denotes a canonical representation of Unicode code points. -// The Unicode-defined normalization and equivalence forms are: -// -// NFC Unicode Normalization Form C -// NFD Unicode Normalization Form D -// NFKC Unicode Normalization Form KC -// NFKD Unicode Normalization Form KD -// -// For a Form f, this documentation uses the notation f(x) to mean -// the bytes or string x converted to the given form. -// A position n in x is called a boundary if conversion to the form can -// proceed independently on both sides: -// -// f(x) == append(f(x[0:n]), f(x[n:])...) -// -// References: https://unicode.org/reports/tr15/ and -// https://unicode.org/notes/tn5/. -type Form int - -const ( - NFC Form = iota - NFD - NFKC - NFKD -) - -// Bytes returns f(b). May return b if f(b) = b. -func (f Form) Bytes(b []byte) []byte { - src := inputBytes(b) - ft := formTable[f] - n, ok := ft.quickSpan(src, 0, len(b), true) - if ok { - return b - } - out := make([]byte, n, len(b)) - copy(out, b[0:n]) - rb := reorderBuffer{f: *ft, src: src, nsrc: len(b), out: out, flushF: appendFlush} - return doAppendInner(&rb, n) -} - -// String returns f(s). -func (f Form) String(s string) string { - src := inputString(s) - ft := formTable[f] - n, ok := ft.quickSpan(src, 0, len(s), true) - if ok { - return s - } - out := make([]byte, n, len(s)) - copy(out, s[0:n]) - rb := reorderBuffer{f: *ft, src: src, nsrc: len(s), out: out, flushF: appendFlush} - return string(doAppendInner(&rb, n)) -} - -// IsNormal returns true if b == f(b). -func (f Form) IsNormal(b []byte) bool { - src := inputBytes(b) - ft := formTable[f] - bp, ok := ft.quickSpan(src, 0, len(b), true) - if ok { - return true - } - rb := reorderBuffer{f: *ft, src: src, nsrc: len(b)} - rb.setFlusher(nil, cmpNormalBytes) - for bp < len(b) { - rb.out = b[bp:] - if bp = decomposeSegment(&rb, bp, true); bp < 0 { - return false - } - bp, _ = rb.f.quickSpan(rb.src, bp, len(b), true) - } - return true -} - -func cmpNormalBytes(rb *reorderBuffer) bool { - b := rb.out - for i := 0; i < rb.nrune; i++ { - info := rb.rune[i] - if int(info.size) > len(b) { - return false - } - p := info.pos - pe := p + info.size - for ; p < pe; p++ { - if b[0] != rb.byte[p] { - return false - } - b = b[1:] - } - } - return true -} - -// IsNormalString returns true if s == f(s). -func (f Form) IsNormalString(s string) bool { - src := inputString(s) - ft := formTable[f] - bp, ok := ft.quickSpan(src, 0, len(s), true) - if ok { - return true - } - rb := reorderBuffer{f: *ft, src: src, nsrc: len(s)} - rb.setFlusher(nil, func(rb *reorderBuffer) bool { - for i := 0; i < rb.nrune; i++ { - info := rb.rune[i] - if bp+int(info.size) > len(s) { - return false - } - p := info.pos - pe := p + info.size - for ; p < pe; p++ { - if s[bp] != rb.byte[p] { - return false - } - bp++ - } - } - return true - }) - for bp < len(s) { - if bp = decomposeSegment(&rb, bp, true); bp < 0 { - return false - } - bp, _ = rb.f.quickSpan(rb.src, bp, len(s), true) - } - return true -} - -// patchTail fixes a case where a rune may be incorrectly normalized -// if it is followed by illegal continuation bytes. It returns the -// patched buffer and whether the decomposition is still in progress. -func patchTail(rb *reorderBuffer) bool { - info, p := lastRuneStart(&rb.f, rb.out) - if p == -1 || info.size == 0 { - return true - } - end := p + int(info.size) - extra := len(rb.out) - end - if extra > 0 { - // Potentially allocating memory. However, this only - // happens with ill-formed UTF-8. - x := make([]byte, 0) - x = append(x, rb.out[len(rb.out)-extra:]...) - rb.out = rb.out[:end] - decomposeToLastBoundary(rb) - rb.doFlush() - rb.out = append(rb.out, x...) - return false - } - buf := rb.out[p:] - rb.out = rb.out[:p] - decomposeToLastBoundary(rb) - if s := rb.ss.next(info); s == ssStarter { - rb.doFlush() - rb.ss.first(info) - } else if s == ssOverflow { - rb.doFlush() - rb.insertCGJ() - rb.ss = 0 - } - rb.insertUnsafe(inputBytes(buf), 0, info) - return true -} - -func appendQuick(rb *reorderBuffer, i int) int { - if rb.nsrc == i { - return i - } - end, _ := rb.f.quickSpan(rb.src, i, rb.nsrc, true) - rb.out = rb.src.appendSlice(rb.out, i, end) - return end -} - -// Append returns f(append(out, b...)). -// The buffer out must be nil, empty, or equal to f(out). -func (f Form) Append(out []byte, src ...byte) []byte { - return f.doAppend(out, inputBytes(src), len(src)) -} - -func (f Form) doAppend(out []byte, src input, n int) []byte { - if n == 0 { - return out - } - ft := formTable[f] - // Attempt to do a quickSpan first so we can avoid initializing the reorderBuffer. - if len(out) == 0 { - p, _ := ft.quickSpan(src, 0, n, true) - out = src.appendSlice(out, 0, p) - if p == n { - return out - } - rb := reorderBuffer{f: *ft, src: src, nsrc: n, out: out, flushF: appendFlush} - return doAppendInner(&rb, p) - } - rb := reorderBuffer{f: *ft, src: src, nsrc: n} - return doAppend(&rb, out, 0) -} - -func doAppend(rb *reorderBuffer, out []byte, p int) []byte { - rb.setFlusher(out, appendFlush) - src, n := rb.src, rb.nsrc - doMerge := len(out) > 0 - if q := src.skipContinuationBytes(p); q > p { - // Move leading non-starters to destination. - rb.out = src.appendSlice(rb.out, p, q) - p = q - doMerge = patchTail(rb) - } - fd := &rb.f - if doMerge { - var info Properties - if p < n { - info = fd.info(src, p) - if !info.BoundaryBefore() || info.nLeadingNonStarters() > 0 { - if p == 0 { - decomposeToLastBoundary(rb) - } - p = decomposeSegment(rb, p, true) - } - } - if info.size == 0 { - rb.doFlush() - // Append incomplete UTF-8 encoding. - return src.appendSlice(rb.out, p, n) - } - if rb.nrune > 0 { - return doAppendInner(rb, p) - } - } - p = appendQuick(rb, p) - return doAppendInner(rb, p) -} - -func doAppendInner(rb *reorderBuffer, p int) []byte { - for n := rb.nsrc; p < n; { - p = decomposeSegment(rb, p, true) - p = appendQuick(rb, p) - } - return rb.out -} - -// AppendString returns f(append(out, []byte(s))). -// The buffer out must be nil, empty, or equal to f(out). -func (f Form) AppendString(out []byte, src string) []byte { - return f.doAppend(out, inputString(src), len(src)) -} - -// QuickSpan returns a boundary n such that b[0:n] == f(b[0:n]). -// It is not guaranteed to return the largest such n. -func (f Form) QuickSpan(b []byte) int { - n, _ := formTable[f].quickSpan(inputBytes(b), 0, len(b), true) - return n -} - -// Span implements transform.SpanningTransformer. It returns a boundary n such -// that b[0:n] == f(b[0:n]). It is not guaranteed to return the largest such n. -func (f Form) Span(b []byte, atEOF bool) (n int, err error) { - n, ok := formTable[f].quickSpan(inputBytes(b), 0, len(b), atEOF) - if n < len(b) { - if !ok { - err = transform.ErrEndOfSpan - } else { - err = transform.ErrShortSrc - } - } - return n, err -} - -// SpanString returns a boundary n such that s[0:n] == f(s[0:n]). -// It is not guaranteed to return the largest such n. -func (f Form) SpanString(s string, atEOF bool) (n int, err error) { - n, ok := formTable[f].quickSpan(inputString(s), 0, len(s), atEOF) - if n < len(s) { - if !ok { - err = transform.ErrEndOfSpan - } else { - err = transform.ErrShortSrc - } - } - return n, err -} - -// quickSpan returns a boundary n such that src[0:n] == f(src[0:n]) and -// whether any non-normalized parts were found. If atEOF is false, n will -// not point past the last segment if this segment might be become -// non-normalized by appending other runes. -func (f *formInfo) quickSpan(src input, i, end int, atEOF bool) (n int, ok bool) { - var lastCC uint8 - ss := streamSafe(0) - lastSegStart := i - for n = end; i < n; { - if j := src.skipASCII(i, n); i != j { - i = j - lastSegStart = i - 1 - lastCC = 0 - ss = 0 - continue - } - info := f.info(src, i) - if info.size == 0 { - if atEOF { - // include incomplete runes - return n, true - } - return lastSegStart, true - } - // This block needs to be before the next, because it is possible to - // have an overflow for runes that are starters (e.g. with U+FF9E). - switch ss.next(info) { - case ssStarter: - lastSegStart = i - case ssOverflow: - return lastSegStart, false - case ssSuccess: - if lastCC > info.ccc { - return lastSegStart, false - } - } - if f.composing { - if !info.isYesC() { - break - } - } else { - if !info.isYesD() { - break - } - } - lastCC = info.ccc - i += int(info.size) - } - if i == n { - if !atEOF { - n = lastSegStart - } - return n, true - } - return lastSegStart, false -} - -// QuickSpanString returns a boundary n such that s[0:n] == f(s[0:n]). -// It is not guaranteed to return the largest such n. -func (f Form) QuickSpanString(s string) int { - n, _ := formTable[f].quickSpan(inputString(s), 0, len(s), true) - return n -} - -// FirstBoundary returns the position i of the first boundary in b -// or -1 if b contains no boundary. -func (f Form) FirstBoundary(b []byte) int { - return f.firstBoundary(inputBytes(b), len(b)) -} - -func (f Form) firstBoundary(src input, nsrc int) int { - i := src.skipContinuationBytes(0) - if i >= nsrc { - return -1 - } - fd := formTable[f] - ss := streamSafe(0) - // We should call ss.first here, but we can't as the first rune is - // skipped already. This means FirstBoundary can't really determine - // CGJ insertion points correctly. Luckily it doesn't have to. - for { - info := fd.info(src, i) - if info.size == 0 { - return -1 - } - if s := ss.next(info); s != ssSuccess { - return i - } - i += int(info.size) - if i >= nsrc { - if !info.BoundaryAfter() && !ss.isMax() { - return -1 - } - return nsrc - } - } -} - -// FirstBoundaryInString returns the position i of the first boundary in s -// or -1 if s contains no boundary. -func (f Form) FirstBoundaryInString(s string) int { - return f.firstBoundary(inputString(s), len(s)) -} - -// NextBoundary reports the index of the boundary between the first and next -// segment in b or -1 if atEOF is false and there are not enough bytes to -// determine this boundary. -func (f Form) NextBoundary(b []byte, atEOF bool) int { - return f.nextBoundary(inputBytes(b), len(b), atEOF) -} - -// NextBoundaryInString reports the index of the boundary between the first and -// next segment in b or -1 if atEOF is false and there are not enough bytes to -// determine this boundary. -func (f Form) NextBoundaryInString(s string, atEOF bool) int { - return f.nextBoundary(inputString(s), len(s), atEOF) -} - -func (f Form) nextBoundary(src input, nsrc int, atEOF bool) int { - if nsrc == 0 { - if atEOF { - return 0 - } - return -1 - } - fd := formTable[f] - info := fd.info(src, 0) - if info.size == 0 { - if atEOF { - return 1 - } - return -1 - } - ss := streamSafe(0) - ss.first(info) - - for i := int(info.size); i < nsrc; i += int(info.size) { - info = fd.info(src, i) - if info.size == 0 { - if atEOF { - return i - } - return -1 - } - // TODO: Using streamSafe to determine the boundary isn't the same as - // using BoundaryBefore. Determine which should be used. - if s := ss.next(info); s != ssSuccess { - return i - } - } - if !atEOF && !info.BoundaryAfter() && !ss.isMax() { - return -1 - } - return nsrc -} - -// LastBoundary returns the position i of the last boundary in b -// or -1 if b contains no boundary. -func (f Form) LastBoundary(b []byte) int { - return lastBoundary(formTable[f], b) -} - -func lastBoundary(fd *formInfo, b []byte) int { - i := len(b) - info, p := lastRuneStart(fd, b) - if p == -1 { - return -1 - } - if info.size == 0 { // ends with incomplete rune - if p == 0 { // starts with incomplete rune - return -1 - } - i = p - info, p = lastRuneStart(fd, b[:i]) - if p == -1 { // incomplete UTF-8 encoding or non-starter bytes without a starter - return i - } - } - if p+int(info.size) != i { // trailing non-starter bytes: illegal UTF-8 - return i - } - if info.BoundaryAfter() { - return i - } - ss := streamSafe(0) - v := ss.backwards(info) - for i = p; i >= 0 && v != ssStarter; i = p { - info, p = lastRuneStart(fd, b[:i]) - if v = ss.backwards(info); v == ssOverflow { - break - } - if p+int(info.size) != i { - if p == -1 { // no boundary found - return -1 - } - return i // boundary after an illegal UTF-8 encoding - } - } - return i -} - -// decomposeSegment scans the first segment in src into rb. It inserts 0x034f -// (Grapheme Joiner) when it encounters a sequence of more than 30 non-starters -// and returns the number of bytes consumed from src or iShortDst or iShortSrc. -func decomposeSegment(rb *reorderBuffer, sp int, atEOF bool) int { - // Force one character to be consumed. - info := rb.f.info(rb.src, sp) - if info.size == 0 { - return 0 - } - if s := rb.ss.next(info); s == ssStarter { - // TODO: this could be removed if we don't support merging. - if rb.nrune > 0 { - goto end - } - } else if s == ssOverflow { - rb.insertCGJ() - goto end - } - if err := rb.insertFlush(rb.src, sp, info); err != iSuccess { - return int(err) - } - for { - sp += int(info.size) - if sp >= rb.nsrc { - if !atEOF && !info.BoundaryAfter() { - return int(iShortSrc) - } - break - } - info = rb.f.info(rb.src, sp) - if info.size == 0 { - if !atEOF { - return int(iShortSrc) - } - break - } - if s := rb.ss.next(info); s == ssStarter { - break - } else if s == ssOverflow { - rb.insertCGJ() - break - } - if err := rb.insertFlush(rb.src, sp, info); err != iSuccess { - return int(err) - } - } -end: - if !rb.doFlush() { - return int(iShortDst) - } - return sp -} - -// lastRuneStart returns the runeInfo and position of the last -// rune in buf or the zero runeInfo and -1 if no rune was found. -func lastRuneStart(fd *formInfo, buf []byte) (Properties, int) { - p := len(buf) - 1 - for ; p >= 0 && !utf8.RuneStart(buf[p]); p-- { - } - if p < 0 { - return Properties{}, -1 - } - return fd.info(inputBytes(buf), p), p -} - -// decomposeToLastBoundary finds an open segment at the end of the buffer -// and scans it into rb. Returns the buffer minus the last segment. -func decomposeToLastBoundary(rb *reorderBuffer) { - fd := &rb.f - info, i := lastRuneStart(fd, rb.out) - if int(info.size) != len(rb.out)-i { - // illegal trailing continuation bytes - return - } - if info.BoundaryAfter() { - return - } - var add [maxNonStarters + 1]Properties // stores runeInfo in reverse order - padd := 0 - ss := streamSafe(0) - p := len(rb.out) - for { - add[padd] = info - v := ss.backwards(info) - if v == ssOverflow { - // Note that if we have an overflow, it the string we are appending to - // is not correctly normalized. In this case the behavior is undefined. - break - } - padd++ - p -= int(info.size) - if v == ssStarter || p < 0 { - break - } - info, i = lastRuneStart(fd, rb.out[:p]) - if int(info.size) != p-i { - break - } - } - rb.ss = ss - // Copy bytes for insertion as we may need to overwrite rb.out. - var buf [maxBufferSize * utf8.UTFMax]byte - cp := buf[:copy(buf[:], rb.out[p:])] - rb.out = rb.out[:p] - for padd--; padd >= 0; padd-- { - info = add[padd] - rb.insertUnsafe(inputBytes(cp), 0, info) - cp = cp[info.size:] - } -} diff --git a/embed/vendor/golang.org/x/text/unicode/norm/readwriter.go b/embed/vendor/golang.org/x/text/unicode/norm/readwriter.go deleted file mode 100644 index b38096f5..00000000 --- a/embed/vendor/golang.org/x/text/unicode/norm/readwriter.go +++ /dev/null @@ -1,125 +0,0 @@ -// Copyright 2011 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package norm - -import "io" - -type normWriter struct { - rb reorderBuffer - w io.Writer - buf []byte -} - -// Write implements the standard write interface. If the last characters are -// not at a normalization boundary, the bytes will be buffered for the next -// write. The remaining bytes will be written on close. -func (w *normWriter) Write(data []byte) (n int, err error) { - // Process data in pieces to keep w.buf size bounded. - const chunk = 4000 - - for len(data) > 0 { - // Normalize into w.buf. - m := len(data) - if m > chunk { - m = chunk - } - w.rb.src = inputBytes(data[:m]) - w.rb.nsrc = m - w.buf = doAppend(&w.rb, w.buf, 0) - data = data[m:] - n += m - - // Write out complete prefix, save remainder. - // Note that lastBoundary looks back at most 31 runes. - i := lastBoundary(&w.rb.f, w.buf) - if i == -1 { - i = 0 - } - if i > 0 { - if _, err = w.w.Write(w.buf[:i]); err != nil { - break - } - bn := copy(w.buf, w.buf[i:]) - w.buf = w.buf[:bn] - } - } - return n, err -} - -// Close forces data that remains in the buffer to be written. -func (w *normWriter) Close() error { - if len(w.buf) > 0 { - _, err := w.w.Write(w.buf) - if err != nil { - return err - } - } - return nil -} - -// Writer returns a new writer that implements Write(b) -// by writing f(b) to w. The returned writer may use an -// internal buffer to maintain state across Write calls. -// Calling its Close method writes any buffered data to w. -func (f Form) Writer(w io.Writer) io.WriteCloser { - wr := &normWriter{rb: reorderBuffer{}, w: w} - wr.rb.init(f, nil) - return wr -} - -type normReader struct { - rb reorderBuffer - r io.Reader - inbuf []byte - outbuf []byte - bufStart int - lastBoundary int - err error -} - -// Read implements the standard read interface. -func (r *normReader) Read(p []byte) (int, error) { - for { - if r.lastBoundary-r.bufStart > 0 { - n := copy(p, r.outbuf[r.bufStart:r.lastBoundary]) - r.bufStart += n - if r.lastBoundary-r.bufStart > 0 { - return n, nil - } - return n, r.err - } - if r.err != nil { - return 0, r.err - } - outn := copy(r.outbuf, r.outbuf[r.lastBoundary:]) - r.outbuf = r.outbuf[0:outn] - r.bufStart = 0 - - n, err := r.r.Read(r.inbuf) - r.rb.src = inputBytes(r.inbuf[0:n]) - r.rb.nsrc, r.err = n, err - if n > 0 { - r.outbuf = doAppend(&r.rb, r.outbuf, 0) - } - if err == io.EOF { - r.lastBoundary = len(r.outbuf) - } else { - r.lastBoundary = lastBoundary(&r.rb.f, r.outbuf) - if r.lastBoundary == -1 { - r.lastBoundary = 0 - } - } - } -} - -// Reader returns a new reader that implements Read -// by reading data from r and returning f(data). -func (f Form) Reader(r io.Reader) io.Reader { - const chunk = 4000 - buf := make([]byte, chunk) - rr := &normReader{rb: reorderBuffer{}, r: r, inbuf: buf} - rr.rb.init(f, buf) - return rr -} diff --git a/embed/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go b/embed/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go deleted file mode 100644 index d9623241..00000000 --- a/embed/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go +++ /dev/null @@ -1,7907 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -//go:build !go1.27 - -package norm - -import "sync" - -const ( - // Version is the Unicode edition from which the tables are derived. - Version = "15.0.0" - - // MaxTransformChunkSize indicates the maximum number of bytes that Transform - // may need to write atomically for any Form. Making a destination buffer at - // least this size ensures that Transform can always make progress and that - // the user does not need to grow the buffer on an ErrShortDst. - MaxTransformChunkSize = 35 + maxNonStarters*4 -) - -var ccc = [56]uint8{ - 0, 1, 6, 7, 8, 9, 10, 11, - 12, 13, 14, 15, 16, 17, 18, 19, - 20, 21, 22, 23, 24, 25, 26, 27, - 28, 29, 30, 31, 32, 33, 34, 35, - 36, 84, 91, 103, 107, 118, 122, 129, - 130, 132, 202, 214, 216, 218, 220, 222, - 224, 226, 228, 230, 232, 233, 234, 240, -} - -const ( - firstMulti = 0x199A - firstCCC = 0x2DD5 - endMulti = 0x2EBF - firstLeadingCCC = 0x4AEF - firstCCCZeroExcept = 0x4BB9 - firstStarterWithNLead = 0x4BE0 - lastDecomp = 0x4BE2 - maxDecomp = 0x8000 -) - -// decomps: 19426 bytes -var decomps = [...]byte{ - // Bytes 0 - 3f - 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, - 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41, - 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41, - 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41, - 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41, - 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41, - 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41, - 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41, - // Bytes 40 - 7f - 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41, - 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41, - 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41, - 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41, - 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41, - 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41, - 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41, - 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41, - // Bytes 80 - bf - 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41, - 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41, - 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41, - 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41, - 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41, - 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41, - 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41, - 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42, - // Bytes c0 - ff - 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5, - 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2, - 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xA6, 0x42, - 0xC3, 0xB0, 0x42, 0xC3, 0xB8, 0x42, 0xC4, 0xA6, - 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, 0x42, 0xC5, - 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, 0x8E, 0x42, - 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, 0xC7, 0x80, - 0x42, 0xC7, 0x81, 0x42, 0xC7, 0x82, 0x42, 0xC8, - // Bytes 100 - 13f - 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, 0x42, - 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, 0x93, - 0x42, 0xC9, 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, - 0x96, 0x42, 0xC9, 0x97, 0x42, 0xC9, 0x98, 0x42, - 0xC9, 0x99, 0x42, 0xC9, 0x9B, 0x42, 0xC9, 0x9C, - 0x42, 0xC9, 0x9E, 0x42, 0xC9, 0x9F, 0x42, 0xC9, - 0xA0, 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA2, 0x42, - 0xC9, 0xA3, 0x42, 0xC9, 0xA4, 0x42, 0xC9, 0xA5, - // Bytes 140 - 17f - 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA7, 0x42, 0xC9, - 0xA8, 0x42, 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, - 0xC9, 0xAB, 0x42, 0xC9, 0xAC, 0x42, 0xC9, 0xAD, - 0x42, 0xC9, 0xAE, 0x42, 0xC9, 0xAF, 0x42, 0xC9, - 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42, - 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5, - 0x42, 0xC9, 0xB6, 0x42, 0xC9, 0xB7, 0x42, 0xC9, - 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, 0xBA, 0x42, - // Bytes 180 - 1bf - 0xC9, 0xBB, 0x42, 0xC9, 0xBD, 0x42, 0xC9, 0xBE, - 0x42, 0xCA, 0x80, 0x42, 0xCA, 0x81, 0x42, 0xCA, - 0x82, 0x42, 0xCA, 0x83, 0x42, 0xCA, 0x84, 0x42, - 0xCA, 0x88, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A, - 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA, - 0x8D, 0x42, 0xCA, 0x8E, 0x42, 0xCA, 0x8F, 0x42, - 0xCA, 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, - 0x42, 0xCA, 0x95, 0x42, 0xCA, 0x98, 0x42, 0xCA, - // Bytes 1c0 - 1ff - 0x99, 0x42, 0xCA, 0x9B, 0x42, 0xCA, 0x9C, 0x42, - 0xCA, 0x9D, 0x42, 0xCA, 0x9F, 0x42, 0xCA, 0xA1, - 0x42, 0xCA, 0xA2, 0x42, 0xCA, 0xA3, 0x42, 0xCA, - 0xA4, 0x42, 0xCA, 0xA5, 0x42, 0xCA, 0xA6, 0x42, - 0xCA, 0xA7, 0x42, 0xCA, 0xA8, 0x42, 0xCA, 0xA9, - 0x42, 0xCA, 0xAA, 0x42, 0xCA, 0xAB, 0x42, 0xCA, - 0xB9, 0x42, 0xCB, 0x90, 0x42, 0xCB, 0x91, 0x42, - 0xCE, 0x91, 0x42, 0xCE, 0x92, 0x42, 0xCE, 0x93, - // Bytes 200 - 23f - 0x42, 0xCE, 0x94, 0x42, 0xCE, 0x95, 0x42, 0xCE, - 0x96, 0x42, 0xCE, 0x97, 0x42, 0xCE, 0x98, 0x42, - 0xCE, 0x99, 0x42, 0xCE, 0x9A, 0x42, 0xCE, 0x9B, - 0x42, 0xCE, 0x9C, 0x42, 0xCE, 0x9D, 0x42, 0xCE, - 0x9E, 0x42, 0xCE, 0x9F, 0x42, 0xCE, 0xA0, 0x42, - 0xCE, 0xA1, 0x42, 0xCE, 0xA3, 0x42, 0xCE, 0xA4, - 0x42, 0xCE, 0xA5, 0x42, 0xCE, 0xA6, 0x42, 0xCE, - 0xA7, 0x42, 0xCE, 0xA8, 0x42, 0xCE, 0xA9, 0x42, - // Bytes 240 - 27f - 0xCE, 0xB1, 0x42, 0xCE, 0xB2, 0x42, 0xCE, 0xB3, - 0x42, 0xCE, 0xB4, 0x42, 0xCE, 0xB5, 0x42, 0xCE, - 0xB6, 0x42, 0xCE, 0xB7, 0x42, 0xCE, 0xB8, 0x42, - 0xCE, 0xB9, 0x42, 0xCE, 0xBA, 0x42, 0xCE, 0xBB, - 0x42, 0xCE, 0xBC, 0x42, 0xCE, 0xBD, 0x42, 0xCE, - 0xBE, 0x42, 0xCE, 0xBF, 0x42, 0xCF, 0x80, 0x42, - 0xCF, 0x81, 0x42, 0xCF, 0x82, 0x42, 0xCF, 0x83, - 0x42, 0xCF, 0x84, 0x42, 0xCF, 0x85, 0x42, 0xCF, - // Bytes 280 - 2bf - 0x86, 0x42, 0xCF, 0x87, 0x42, 0xCF, 0x88, 0x42, - 0xCF, 0x89, 0x42, 0xCF, 0x9C, 0x42, 0xCF, 0x9D, - 0x42, 0xD0, 0xB0, 0x42, 0xD0, 0xB1, 0x42, 0xD0, - 0xB2, 0x42, 0xD0, 0xB3, 0x42, 0xD0, 0xB4, 0x42, - 0xD0, 0xB5, 0x42, 0xD0, 0xB6, 0x42, 0xD0, 0xB7, - 0x42, 0xD0, 0xB8, 0x42, 0xD0, 0xBA, 0x42, 0xD0, - 0xBB, 0x42, 0xD0, 0xBC, 0x42, 0xD0, 0xBD, 0x42, - 0xD0, 0xBE, 0x42, 0xD0, 0xBF, 0x42, 0xD1, 0x80, - // Bytes 2c0 - 2ff - 0x42, 0xD1, 0x81, 0x42, 0xD1, 0x82, 0x42, 0xD1, - 0x83, 0x42, 0xD1, 0x84, 0x42, 0xD1, 0x85, 0x42, - 0xD1, 0x86, 0x42, 0xD1, 0x87, 0x42, 0xD1, 0x88, - 0x42, 0xD1, 0x8A, 0x42, 0xD1, 0x8B, 0x42, 0xD1, - 0x8C, 0x42, 0xD1, 0x8D, 0x42, 0xD1, 0x8E, 0x42, - 0xD1, 0x95, 0x42, 0xD1, 0x96, 0x42, 0xD1, 0x98, - 0x42, 0xD1, 0x9F, 0x42, 0xD2, 0x91, 0x42, 0xD2, - 0xAB, 0x42, 0xD2, 0xAF, 0x42, 0xD2, 0xB1, 0x42, - // Bytes 300 - 33f - 0xD3, 0x8F, 0x42, 0xD3, 0x99, 0x42, 0xD3, 0xA9, - 0x42, 0xD7, 0x90, 0x42, 0xD7, 0x91, 0x42, 0xD7, - 0x92, 0x42, 0xD7, 0x93, 0x42, 0xD7, 0x94, 0x42, - 0xD7, 0x9B, 0x42, 0xD7, 0x9C, 0x42, 0xD7, 0x9D, - 0x42, 0xD7, 0xA2, 0x42, 0xD7, 0xA8, 0x42, 0xD7, - 0xAA, 0x42, 0xD8, 0xA1, 0x42, 0xD8, 0xA7, 0x42, - 0xD8, 0xA8, 0x42, 0xD8, 0xA9, 0x42, 0xD8, 0xAA, - 0x42, 0xD8, 0xAB, 0x42, 0xD8, 0xAC, 0x42, 0xD8, - // Bytes 340 - 37f - 0xAD, 0x42, 0xD8, 0xAE, 0x42, 0xD8, 0xAF, 0x42, - 0xD8, 0xB0, 0x42, 0xD8, 0xB1, 0x42, 0xD8, 0xB2, - 0x42, 0xD8, 0xB3, 0x42, 0xD8, 0xB4, 0x42, 0xD8, - 0xB5, 0x42, 0xD8, 0xB6, 0x42, 0xD8, 0xB7, 0x42, - 0xD8, 0xB8, 0x42, 0xD8, 0xB9, 0x42, 0xD8, 0xBA, - 0x42, 0xD9, 0x81, 0x42, 0xD9, 0x82, 0x42, 0xD9, - 0x83, 0x42, 0xD9, 0x84, 0x42, 0xD9, 0x85, 0x42, - 0xD9, 0x86, 0x42, 0xD9, 0x87, 0x42, 0xD9, 0x88, - // Bytes 380 - 3bf - 0x42, 0xD9, 0x89, 0x42, 0xD9, 0x8A, 0x42, 0xD9, - 0xAE, 0x42, 0xD9, 0xAF, 0x42, 0xD9, 0xB1, 0x42, - 0xD9, 0xB9, 0x42, 0xD9, 0xBA, 0x42, 0xD9, 0xBB, - 0x42, 0xD9, 0xBE, 0x42, 0xD9, 0xBF, 0x42, 0xDA, - 0x80, 0x42, 0xDA, 0x83, 0x42, 0xDA, 0x84, 0x42, - 0xDA, 0x86, 0x42, 0xDA, 0x87, 0x42, 0xDA, 0x88, - 0x42, 0xDA, 0x8C, 0x42, 0xDA, 0x8D, 0x42, 0xDA, - 0x8E, 0x42, 0xDA, 0x91, 0x42, 0xDA, 0x98, 0x42, - // Bytes 3c0 - 3ff - 0xDA, 0xA1, 0x42, 0xDA, 0xA4, 0x42, 0xDA, 0xA6, - 0x42, 0xDA, 0xA9, 0x42, 0xDA, 0xAD, 0x42, 0xDA, - 0xAF, 0x42, 0xDA, 0xB1, 0x42, 0xDA, 0xB3, 0x42, - 0xDA, 0xBA, 0x42, 0xDA, 0xBB, 0x42, 0xDA, 0xBE, - 0x42, 0xDB, 0x81, 0x42, 0xDB, 0x85, 0x42, 0xDB, - 0x86, 0x42, 0xDB, 0x87, 0x42, 0xDB, 0x88, 0x42, - 0xDB, 0x89, 0x42, 0xDB, 0x8B, 0x42, 0xDB, 0x8C, - 0x42, 0xDB, 0x90, 0x42, 0xDB, 0x92, 0x43, 0xE0, - // Bytes 400 - 43f - 0xBC, 0x8B, 0x43, 0xE1, 0x83, 0x9C, 0x43, 0xE1, - 0x84, 0x80, 0x43, 0xE1, 0x84, 0x81, 0x43, 0xE1, - 0x84, 0x82, 0x43, 0xE1, 0x84, 0x83, 0x43, 0xE1, - 0x84, 0x84, 0x43, 0xE1, 0x84, 0x85, 0x43, 0xE1, - 0x84, 0x86, 0x43, 0xE1, 0x84, 0x87, 0x43, 0xE1, - 0x84, 0x88, 0x43, 0xE1, 0x84, 0x89, 0x43, 0xE1, - 0x84, 0x8A, 0x43, 0xE1, 0x84, 0x8B, 0x43, 0xE1, - 0x84, 0x8C, 0x43, 0xE1, 0x84, 0x8D, 0x43, 0xE1, - // Bytes 440 - 47f - 0x84, 0x8E, 0x43, 0xE1, 0x84, 0x8F, 0x43, 0xE1, - 0x84, 0x90, 0x43, 0xE1, 0x84, 0x91, 0x43, 0xE1, - 0x84, 0x92, 0x43, 0xE1, 0x84, 0x94, 0x43, 0xE1, - 0x84, 0x95, 0x43, 0xE1, 0x84, 0x9A, 0x43, 0xE1, - 0x84, 0x9C, 0x43, 0xE1, 0x84, 0x9D, 0x43, 0xE1, - 0x84, 0x9E, 0x43, 0xE1, 0x84, 0xA0, 0x43, 0xE1, - 0x84, 0xA1, 0x43, 0xE1, 0x84, 0xA2, 0x43, 0xE1, - 0x84, 0xA3, 0x43, 0xE1, 0x84, 0xA7, 0x43, 0xE1, - // Bytes 480 - 4bf - 0x84, 0xA9, 0x43, 0xE1, 0x84, 0xAB, 0x43, 0xE1, - 0x84, 0xAC, 0x43, 0xE1, 0x84, 0xAD, 0x43, 0xE1, - 0x84, 0xAE, 0x43, 0xE1, 0x84, 0xAF, 0x43, 0xE1, - 0x84, 0xB2, 0x43, 0xE1, 0x84, 0xB6, 0x43, 0xE1, - 0x85, 0x80, 0x43, 0xE1, 0x85, 0x87, 0x43, 0xE1, - 0x85, 0x8C, 0x43, 0xE1, 0x85, 0x97, 0x43, 0xE1, - 0x85, 0x98, 0x43, 0xE1, 0x85, 0x99, 0x43, 0xE1, - 0x85, 0xA0, 0x43, 0xE1, 0x86, 0x84, 0x43, 0xE1, - // Bytes 4c0 - 4ff - 0x86, 0x85, 0x43, 0xE1, 0x86, 0x88, 0x43, 0xE1, - 0x86, 0x91, 0x43, 0xE1, 0x86, 0x92, 0x43, 0xE1, - 0x86, 0x94, 0x43, 0xE1, 0x86, 0x9E, 0x43, 0xE1, - 0x86, 0xA1, 0x43, 0xE1, 0x87, 0x87, 0x43, 0xE1, - 0x87, 0x88, 0x43, 0xE1, 0x87, 0x8C, 0x43, 0xE1, - 0x87, 0x8E, 0x43, 0xE1, 0x87, 0x93, 0x43, 0xE1, - 0x87, 0x97, 0x43, 0xE1, 0x87, 0x99, 0x43, 0xE1, - 0x87, 0x9D, 0x43, 0xE1, 0x87, 0x9F, 0x43, 0xE1, - // Bytes 500 - 53f - 0x87, 0xB1, 0x43, 0xE1, 0x87, 0xB2, 0x43, 0xE1, - 0xB4, 0x82, 0x43, 0xE1, 0xB4, 0x96, 0x43, 0xE1, - 0xB4, 0x97, 0x43, 0xE1, 0xB4, 0x9C, 0x43, 0xE1, - 0xB4, 0x9D, 0x43, 0xE1, 0xB4, 0xA5, 0x43, 0xE1, - 0xB5, 0xBB, 0x43, 0xE1, 0xB6, 0x85, 0x43, 0xE1, - 0xB6, 0x91, 0x43, 0xE2, 0x80, 0x82, 0x43, 0xE2, - 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, 0xE2, - 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, 0xE2, - // Bytes 540 - 57f - 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, 0xE2, - 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, 0xE2, - 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, 0xE2, - 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, 0xE2, - 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, 0xE2, - 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, 0xE2, - 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, 0xE2, - 0xB1, 0xB1, 0x43, 0xE2, 0xB5, 0xA1, 0x43, 0xE3, - // Bytes 580 - 5bf - 0x80, 0x81, 0x43, 0xE3, 0x80, 0x82, 0x43, 0xE3, - 0x80, 0x88, 0x43, 0xE3, 0x80, 0x89, 0x43, 0xE3, - 0x80, 0x8A, 0x43, 0xE3, 0x80, 0x8B, 0x43, 0xE3, - 0x80, 0x8C, 0x43, 0xE3, 0x80, 0x8D, 0x43, 0xE3, - 0x80, 0x8E, 0x43, 0xE3, 0x80, 0x8F, 0x43, 0xE3, - 0x80, 0x90, 0x43, 0xE3, 0x80, 0x91, 0x43, 0xE3, - 0x80, 0x92, 0x43, 0xE3, 0x80, 0x94, 0x43, 0xE3, - 0x80, 0x95, 0x43, 0xE3, 0x80, 0x96, 0x43, 0xE3, - // Bytes 5c0 - 5ff - 0x80, 0x97, 0x43, 0xE3, 0x82, 0xA1, 0x43, 0xE3, - 0x82, 0xA2, 0x43, 0xE3, 0x82, 0xA3, 0x43, 0xE3, - 0x82, 0xA4, 0x43, 0xE3, 0x82, 0xA5, 0x43, 0xE3, - 0x82, 0xA6, 0x43, 0xE3, 0x82, 0xA7, 0x43, 0xE3, - 0x82, 0xA8, 0x43, 0xE3, 0x82, 0xA9, 0x43, 0xE3, - 0x82, 0xAA, 0x43, 0xE3, 0x82, 0xAB, 0x43, 0xE3, - 0x82, 0xAD, 0x43, 0xE3, 0x82, 0xAF, 0x43, 0xE3, - 0x82, 0xB1, 0x43, 0xE3, 0x82, 0xB3, 0x43, 0xE3, - // Bytes 600 - 63f - 0x82, 0xB5, 0x43, 0xE3, 0x82, 0xB7, 0x43, 0xE3, - 0x82, 0xB9, 0x43, 0xE3, 0x82, 0xBB, 0x43, 0xE3, - 0x82, 0xBD, 0x43, 0xE3, 0x82, 0xBF, 0x43, 0xE3, - 0x83, 0x81, 0x43, 0xE3, 0x83, 0x83, 0x43, 0xE3, - 0x83, 0x84, 0x43, 0xE3, 0x83, 0x86, 0x43, 0xE3, - 0x83, 0x88, 0x43, 0xE3, 0x83, 0x8A, 0x43, 0xE3, - 0x83, 0x8B, 0x43, 0xE3, 0x83, 0x8C, 0x43, 0xE3, - 0x83, 0x8D, 0x43, 0xE3, 0x83, 0x8E, 0x43, 0xE3, - // Bytes 640 - 67f - 0x83, 0x8F, 0x43, 0xE3, 0x83, 0x92, 0x43, 0xE3, - 0x83, 0x95, 0x43, 0xE3, 0x83, 0x98, 0x43, 0xE3, - 0x83, 0x9B, 0x43, 0xE3, 0x83, 0x9E, 0x43, 0xE3, - 0x83, 0x9F, 0x43, 0xE3, 0x83, 0xA0, 0x43, 0xE3, - 0x83, 0xA1, 0x43, 0xE3, 0x83, 0xA2, 0x43, 0xE3, - 0x83, 0xA3, 0x43, 0xE3, 0x83, 0xA4, 0x43, 0xE3, - 0x83, 0xA5, 0x43, 0xE3, 0x83, 0xA6, 0x43, 0xE3, - 0x83, 0xA7, 0x43, 0xE3, 0x83, 0xA8, 0x43, 0xE3, - // Bytes 680 - 6bf - 0x83, 0xA9, 0x43, 0xE3, 0x83, 0xAA, 0x43, 0xE3, - 0x83, 0xAB, 0x43, 0xE3, 0x83, 0xAC, 0x43, 0xE3, - 0x83, 0xAD, 0x43, 0xE3, 0x83, 0xAF, 0x43, 0xE3, - 0x83, 0xB0, 0x43, 0xE3, 0x83, 0xB1, 0x43, 0xE3, - 0x83, 0xB2, 0x43, 0xE3, 0x83, 0xB3, 0x43, 0xE3, - 0x83, 0xBB, 0x43, 0xE3, 0x83, 0xBC, 0x43, 0xE3, - 0x92, 0x9E, 0x43, 0xE3, 0x92, 0xB9, 0x43, 0xE3, - 0x92, 0xBB, 0x43, 0xE3, 0x93, 0x9F, 0x43, 0xE3, - // Bytes 6c0 - 6ff - 0x94, 0x95, 0x43, 0xE3, 0x9B, 0xAE, 0x43, 0xE3, - 0x9B, 0xBC, 0x43, 0xE3, 0x9E, 0x81, 0x43, 0xE3, - 0xA0, 0xAF, 0x43, 0xE3, 0xA1, 0xA2, 0x43, 0xE3, - 0xA1, 0xBC, 0x43, 0xE3, 0xA3, 0x87, 0x43, 0xE3, - 0xA3, 0xA3, 0x43, 0xE3, 0xA4, 0x9C, 0x43, 0xE3, - 0xA4, 0xBA, 0x43, 0xE3, 0xA8, 0xAE, 0x43, 0xE3, - 0xA9, 0xAC, 0x43, 0xE3, 0xAB, 0xA4, 0x43, 0xE3, - 0xAC, 0x88, 0x43, 0xE3, 0xAC, 0x99, 0x43, 0xE3, - // Bytes 700 - 73f - 0xAD, 0x89, 0x43, 0xE3, 0xAE, 0x9D, 0x43, 0xE3, - 0xB0, 0x98, 0x43, 0xE3, 0xB1, 0x8E, 0x43, 0xE3, - 0xB4, 0xB3, 0x43, 0xE3, 0xB6, 0x96, 0x43, 0xE3, - 0xBA, 0xAC, 0x43, 0xE3, 0xBA, 0xB8, 0x43, 0xE3, - 0xBC, 0x9B, 0x43, 0xE3, 0xBF, 0xBC, 0x43, 0xE4, - 0x80, 0x88, 0x43, 0xE4, 0x80, 0x98, 0x43, 0xE4, - 0x80, 0xB9, 0x43, 0xE4, 0x81, 0x86, 0x43, 0xE4, - 0x82, 0x96, 0x43, 0xE4, 0x83, 0xA3, 0x43, 0xE4, - // Bytes 740 - 77f - 0x84, 0xAF, 0x43, 0xE4, 0x88, 0x82, 0x43, 0xE4, - 0x88, 0xA7, 0x43, 0xE4, 0x8A, 0xA0, 0x43, 0xE4, - 0x8C, 0x81, 0x43, 0xE4, 0x8C, 0xB4, 0x43, 0xE4, - 0x8D, 0x99, 0x43, 0xE4, 0x8F, 0x95, 0x43, 0xE4, - 0x8F, 0x99, 0x43, 0xE4, 0x90, 0x8B, 0x43, 0xE4, - 0x91, 0xAB, 0x43, 0xE4, 0x94, 0xAB, 0x43, 0xE4, - 0x95, 0x9D, 0x43, 0xE4, 0x95, 0xA1, 0x43, 0xE4, - 0x95, 0xAB, 0x43, 0xE4, 0x97, 0x97, 0x43, 0xE4, - // Bytes 780 - 7bf - 0x97, 0xB9, 0x43, 0xE4, 0x98, 0xB5, 0x43, 0xE4, - 0x9A, 0xBE, 0x43, 0xE4, 0x9B, 0x87, 0x43, 0xE4, - 0xA6, 0x95, 0x43, 0xE4, 0xA7, 0xA6, 0x43, 0xE4, - 0xA9, 0xAE, 0x43, 0xE4, 0xA9, 0xB6, 0x43, 0xE4, - 0xAA, 0xB2, 0x43, 0xE4, 0xAC, 0xB3, 0x43, 0xE4, - 0xAF, 0x8E, 0x43, 0xE4, 0xB3, 0x8E, 0x43, 0xE4, - 0xB3, 0xAD, 0x43, 0xE4, 0xB3, 0xB8, 0x43, 0xE4, - 0xB5, 0x96, 0x43, 0xE4, 0xB8, 0x80, 0x43, 0xE4, - // Bytes 7c0 - 7ff - 0xB8, 0x81, 0x43, 0xE4, 0xB8, 0x83, 0x43, 0xE4, - 0xB8, 0x89, 0x43, 0xE4, 0xB8, 0x8A, 0x43, 0xE4, - 0xB8, 0x8B, 0x43, 0xE4, 0xB8, 0x8D, 0x43, 0xE4, - 0xB8, 0x99, 0x43, 0xE4, 0xB8, 0xA6, 0x43, 0xE4, - 0xB8, 0xA8, 0x43, 0xE4, 0xB8, 0xAD, 0x43, 0xE4, - 0xB8, 0xB2, 0x43, 0xE4, 0xB8, 0xB6, 0x43, 0xE4, - 0xB8, 0xB8, 0x43, 0xE4, 0xB8, 0xB9, 0x43, 0xE4, - 0xB8, 0xBD, 0x43, 0xE4, 0xB8, 0xBF, 0x43, 0xE4, - // Bytes 800 - 83f - 0xB9, 0x81, 0x43, 0xE4, 0xB9, 0x99, 0x43, 0xE4, - 0xB9, 0x9D, 0x43, 0xE4, 0xBA, 0x82, 0x43, 0xE4, - 0xBA, 0x85, 0x43, 0xE4, 0xBA, 0x86, 0x43, 0xE4, - 0xBA, 0x8C, 0x43, 0xE4, 0xBA, 0x94, 0x43, 0xE4, - 0xBA, 0xA0, 0x43, 0xE4, 0xBA, 0xA4, 0x43, 0xE4, - 0xBA, 0xAE, 0x43, 0xE4, 0xBA, 0xBA, 0x43, 0xE4, - 0xBB, 0x80, 0x43, 0xE4, 0xBB, 0x8C, 0x43, 0xE4, - 0xBB, 0xA4, 0x43, 0xE4, 0xBC, 0x81, 0x43, 0xE4, - // Bytes 840 - 87f - 0xBC, 0x91, 0x43, 0xE4, 0xBD, 0xA0, 0x43, 0xE4, - 0xBE, 0x80, 0x43, 0xE4, 0xBE, 0x86, 0x43, 0xE4, - 0xBE, 0x8B, 0x43, 0xE4, 0xBE, 0xAE, 0x43, 0xE4, - 0xBE, 0xBB, 0x43, 0xE4, 0xBE, 0xBF, 0x43, 0xE5, - 0x80, 0x82, 0x43, 0xE5, 0x80, 0xAB, 0x43, 0xE5, - 0x81, 0xBA, 0x43, 0xE5, 0x82, 0x99, 0x43, 0xE5, - 0x83, 0x8F, 0x43, 0xE5, 0x83, 0x9A, 0x43, 0xE5, - 0x83, 0xA7, 0x43, 0xE5, 0x84, 0xAA, 0x43, 0xE5, - // Bytes 880 - 8bf - 0x84, 0xBF, 0x43, 0xE5, 0x85, 0x80, 0x43, 0xE5, - 0x85, 0x85, 0x43, 0xE5, 0x85, 0x8D, 0x43, 0xE5, - 0x85, 0x94, 0x43, 0xE5, 0x85, 0xA4, 0x43, 0xE5, - 0x85, 0xA5, 0x43, 0xE5, 0x85, 0xA7, 0x43, 0xE5, - 0x85, 0xA8, 0x43, 0xE5, 0x85, 0xA9, 0x43, 0xE5, - 0x85, 0xAB, 0x43, 0xE5, 0x85, 0xAD, 0x43, 0xE5, - 0x85, 0xB7, 0x43, 0xE5, 0x86, 0x80, 0x43, 0xE5, - 0x86, 0x82, 0x43, 0xE5, 0x86, 0x8D, 0x43, 0xE5, - // Bytes 8c0 - 8ff - 0x86, 0x92, 0x43, 0xE5, 0x86, 0x95, 0x43, 0xE5, - 0x86, 0x96, 0x43, 0xE5, 0x86, 0x97, 0x43, 0xE5, - 0x86, 0x99, 0x43, 0xE5, 0x86, 0xA4, 0x43, 0xE5, - 0x86, 0xAB, 0x43, 0xE5, 0x86, 0xAC, 0x43, 0xE5, - 0x86, 0xB5, 0x43, 0xE5, 0x86, 0xB7, 0x43, 0xE5, - 0x87, 0x89, 0x43, 0xE5, 0x87, 0x8C, 0x43, 0xE5, - 0x87, 0x9C, 0x43, 0xE5, 0x87, 0x9E, 0x43, 0xE5, - 0x87, 0xA0, 0x43, 0xE5, 0x87, 0xB5, 0x43, 0xE5, - // Bytes 900 - 93f - 0x88, 0x80, 0x43, 0xE5, 0x88, 0x83, 0x43, 0xE5, - 0x88, 0x87, 0x43, 0xE5, 0x88, 0x97, 0x43, 0xE5, - 0x88, 0x9D, 0x43, 0xE5, 0x88, 0xA9, 0x43, 0xE5, - 0x88, 0xBA, 0x43, 0xE5, 0x88, 0xBB, 0x43, 0xE5, - 0x89, 0x86, 0x43, 0xE5, 0x89, 0x8D, 0x43, 0xE5, - 0x89, 0xB2, 0x43, 0xE5, 0x89, 0xB7, 0x43, 0xE5, - 0x8A, 0x89, 0x43, 0xE5, 0x8A, 0x9B, 0x43, 0xE5, - 0x8A, 0xA3, 0x43, 0xE5, 0x8A, 0xB3, 0x43, 0xE5, - // Bytes 940 - 97f - 0x8A, 0xB4, 0x43, 0xE5, 0x8B, 0x87, 0x43, 0xE5, - 0x8B, 0x89, 0x43, 0xE5, 0x8B, 0x92, 0x43, 0xE5, - 0x8B, 0x9E, 0x43, 0xE5, 0x8B, 0xA4, 0x43, 0xE5, - 0x8B, 0xB5, 0x43, 0xE5, 0x8B, 0xB9, 0x43, 0xE5, - 0x8B, 0xBA, 0x43, 0xE5, 0x8C, 0x85, 0x43, 0xE5, - 0x8C, 0x86, 0x43, 0xE5, 0x8C, 0x95, 0x43, 0xE5, - 0x8C, 0x97, 0x43, 0xE5, 0x8C, 0x9A, 0x43, 0xE5, - 0x8C, 0xB8, 0x43, 0xE5, 0x8C, 0xBB, 0x43, 0xE5, - // Bytes 980 - 9bf - 0x8C, 0xBF, 0x43, 0xE5, 0x8D, 0x81, 0x43, 0xE5, - 0x8D, 0x84, 0x43, 0xE5, 0x8D, 0x85, 0x43, 0xE5, - 0x8D, 0x89, 0x43, 0xE5, 0x8D, 0x91, 0x43, 0xE5, - 0x8D, 0x94, 0x43, 0xE5, 0x8D, 0x9A, 0x43, 0xE5, - 0x8D, 0x9C, 0x43, 0xE5, 0x8D, 0xA9, 0x43, 0xE5, - 0x8D, 0xB0, 0x43, 0xE5, 0x8D, 0xB3, 0x43, 0xE5, - 0x8D, 0xB5, 0x43, 0xE5, 0x8D, 0xBD, 0x43, 0xE5, - 0x8D, 0xBF, 0x43, 0xE5, 0x8E, 0x82, 0x43, 0xE5, - // Bytes 9c0 - 9ff - 0x8E, 0xB6, 0x43, 0xE5, 0x8F, 0x83, 0x43, 0xE5, - 0x8F, 0x88, 0x43, 0xE5, 0x8F, 0x8A, 0x43, 0xE5, - 0x8F, 0x8C, 0x43, 0xE5, 0x8F, 0x9F, 0x43, 0xE5, - 0x8F, 0xA3, 0x43, 0xE5, 0x8F, 0xA5, 0x43, 0xE5, - 0x8F, 0xAB, 0x43, 0xE5, 0x8F, 0xAF, 0x43, 0xE5, - 0x8F, 0xB1, 0x43, 0xE5, 0x8F, 0xB3, 0x43, 0xE5, - 0x90, 0x86, 0x43, 0xE5, 0x90, 0x88, 0x43, 0xE5, - 0x90, 0x8D, 0x43, 0xE5, 0x90, 0x8F, 0x43, 0xE5, - // Bytes a00 - a3f - 0x90, 0x9D, 0x43, 0xE5, 0x90, 0xB8, 0x43, 0xE5, - 0x90, 0xB9, 0x43, 0xE5, 0x91, 0x82, 0x43, 0xE5, - 0x91, 0x88, 0x43, 0xE5, 0x91, 0xA8, 0x43, 0xE5, - 0x92, 0x9E, 0x43, 0xE5, 0x92, 0xA2, 0x43, 0xE5, - 0x92, 0xBD, 0x43, 0xE5, 0x93, 0xB6, 0x43, 0xE5, - 0x94, 0x90, 0x43, 0xE5, 0x95, 0x8F, 0x43, 0xE5, - 0x95, 0x93, 0x43, 0xE5, 0x95, 0x95, 0x43, 0xE5, - 0x95, 0xA3, 0x43, 0xE5, 0x96, 0x84, 0x43, 0xE5, - // Bytes a40 - a7f - 0x96, 0x87, 0x43, 0xE5, 0x96, 0x99, 0x43, 0xE5, - 0x96, 0x9D, 0x43, 0xE5, 0x96, 0xAB, 0x43, 0xE5, - 0x96, 0xB3, 0x43, 0xE5, 0x96, 0xB6, 0x43, 0xE5, - 0x97, 0x80, 0x43, 0xE5, 0x97, 0x82, 0x43, 0xE5, - 0x97, 0xA2, 0x43, 0xE5, 0x98, 0x86, 0x43, 0xE5, - 0x99, 0x91, 0x43, 0xE5, 0x99, 0xA8, 0x43, 0xE5, - 0x99, 0xB4, 0x43, 0xE5, 0x9B, 0x97, 0x43, 0xE5, - 0x9B, 0x9B, 0x43, 0xE5, 0x9B, 0xB9, 0x43, 0xE5, - // Bytes a80 - abf - 0x9C, 0x96, 0x43, 0xE5, 0x9C, 0x97, 0x43, 0xE5, - 0x9C, 0x9F, 0x43, 0xE5, 0x9C, 0xB0, 0x43, 0xE5, - 0x9E, 0x8B, 0x43, 0xE5, 0x9F, 0x8E, 0x43, 0xE5, - 0x9F, 0xB4, 0x43, 0xE5, 0xA0, 0x8D, 0x43, 0xE5, - 0xA0, 0xB1, 0x43, 0xE5, 0xA0, 0xB2, 0x43, 0xE5, - 0xA1, 0x80, 0x43, 0xE5, 0xA1, 0x9A, 0x43, 0xE5, - 0xA1, 0x9E, 0x43, 0xE5, 0xA2, 0xA8, 0x43, 0xE5, - 0xA2, 0xAC, 0x43, 0xE5, 0xA2, 0xB3, 0x43, 0xE5, - // Bytes ac0 - aff - 0xA3, 0x98, 0x43, 0xE5, 0xA3, 0x9F, 0x43, 0xE5, - 0xA3, 0xAB, 0x43, 0xE5, 0xA3, 0xAE, 0x43, 0xE5, - 0xA3, 0xB0, 0x43, 0xE5, 0xA3, 0xB2, 0x43, 0xE5, - 0xA3, 0xB7, 0x43, 0xE5, 0xA4, 0x82, 0x43, 0xE5, - 0xA4, 0x86, 0x43, 0xE5, 0xA4, 0x8A, 0x43, 0xE5, - 0xA4, 0x95, 0x43, 0xE5, 0xA4, 0x9A, 0x43, 0xE5, - 0xA4, 0x9C, 0x43, 0xE5, 0xA4, 0xA2, 0x43, 0xE5, - 0xA4, 0xA7, 0x43, 0xE5, 0xA4, 0xA9, 0x43, 0xE5, - // Bytes b00 - b3f - 0xA5, 0x84, 0x43, 0xE5, 0xA5, 0x88, 0x43, 0xE5, - 0xA5, 0x91, 0x43, 0xE5, 0xA5, 0x94, 0x43, 0xE5, - 0xA5, 0xA2, 0x43, 0xE5, 0xA5, 0xB3, 0x43, 0xE5, - 0xA7, 0x98, 0x43, 0xE5, 0xA7, 0xAC, 0x43, 0xE5, - 0xA8, 0x9B, 0x43, 0xE5, 0xA8, 0xA7, 0x43, 0xE5, - 0xA9, 0xA2, 0x43, 0xE5, 0xA9, 0xA6, 0x43, 0xE5, - 0xAA, 0xB5, 0x43, 0xE5, 0xAC, 0x88, 0x43, 0xE5, - 0xAC, 0xA8, 0x43, 0xE5, 0xAC, 0xBE, 0x43, 0xE5, - // Bytes b40 - b7f - 0xAD, 0x90, 0x43, 0xE5, 0xAD, 0x97, 0x43, 0xE5, - 0xAD, 0xA6, 0x43, 0xE5, 0xAE, 0x80, 0x43, 0xE5, - 0xAE, 0x85, 0x43, 0xE5, 0xAE, 0x97, 0x43, 0xE5, - 0xAF, 0x83, 0x43, 0xE5, 0xAF, 0x98, 0x43, 0xE5, - 0xAF, 0xA7, 0x43, 0xE5, 0xAF, 0xAE, 0x43, 0xE5, - 0xAF, 0xB3, 0x43, 0xE5, 0xAF, 0xB8, 0x43, 0xE5, - 0xAF, 0xBF, 0x43, 0xE5, 0xB0, 0x86, 0x43, 0xE5, - 0xB0, 0x8F, 0x43, 0xE5, 0xB0, 0xA2, 0x43, 0xE5, - // Bytes b80 - bbf - 0xB0, 0xB8, 0x43, 0xE5, 0xB0, 0xBF, 0x43, 0xE5, - 0xB1, 0xA0, 0x43, 0xE5, 0xB1, 0xA2, 0x43, 0xE5, - 0xB1, 0xA4, 0x43, 0xE5, 0xB1, 0xA5, 0x43, 0xE5, - 0xB1, 0xAE, 0x43, 0xE5, 0xB1, 0xB1, 0x43, 0xE5, - 0xB2, 0x8D, 0x43, 0xE5, 0xB3, 0x80, 0x43, 0xE5, - 0xB4, 0x99, 0x43, 0xE5, 0xB5, 0x83, 0x43, 0xE5, - 0xB5, 0x90, 0x43, 0xE5, 0xB5, 0xAB, 0x43, 0xE5, - 0xB5, 0xAE, 0x43, 0xE5, 0xB5, 0xBC, 0x43, 0xE5, - // Bytes bc0 - bff - 0xB6, 0xB2, 0x43, 0xE5, 0xB6, 0xBA, 0x43, 0xE5, - 0xB7, 0x9B, 0x43, 0xE5, 0xB7, 0xA1, 0x43, 0xE5, - 0xB7, 0xA2, 0x43, 0xE5, 0xB7, 0xA5, 0x43, 0xE5, - 0xB7, 0xA6, 0x43, 0xE5, 0xB7, 0xB1, 0x43, 0xE5, - 0xB7, 0xBD, 0x43, 0xE5, 0xB7, 0xBE, 0x43, 0xE5, - 0xB8, 0xA8, 0x43, 0xE5, 0xB8, 0xBD, 0x43, 0xE5, - 0xB9, 0xA9, 0x43, 0xE5, 0xB9, 0xB2, 0x43, 0xE5, - 0xB9, 0xB4, 0x43, 0xE5, 0xB9, 0xBA, 0x43, 0xE5, - // Bytes c00 - c3f - 0xB9, 0xBC, 0x43, 0xE5, 0xB9, 0xBF, 0x43, 0xE5, - 0xBA, 0xA6, 0x43, 0xE5, 0xBA, 0xB0, 0x43, 0xE5, - 0xBA, 0xB3, 0x43, 0xE5, 0xBA, 0xB6, 0x43, 0xE5, - 0xBB, 0x89, 0x43, 0xE5, 0xBB, 0x8A, 0x43, 0xE5, - 0xBB, 0x92, 0x43, 0xE5, 0xBB, 0x93, 0x43, 0xE5, - 0xBB, 0x99, 0x43, 0xE5, 0xBB, 0xAC, 0x43, 0xE5, - 0xBB, 0xB4, 0x43, 0xE5, 0xBB, 0xBE, 0x43, 0xE5, - 0xBC, 0x84, 0x43, 0xE5, 0xBC, 0x8B, 0x43, 0xE5, - // Bytes c40 - c7f - 0xBC, 0x93, 0x43, 0xE5, 0xBC, 0xA2, 0x43, 0xE5, - 0xBD, 0x90, 0x43, 0xE5, 0xBD, 0x93, 0x43, 0xE5, - 0xBD, 0xA1, 0x43, 0xE5, 0xBD, 0xA2, 0x43, 0xE5, - 0xBD, 0xA9, 0x43, 0xE5, 0xBD, 0xAB, 0x43, 0xE5, - 0xBD, 0xB3, 0x43, 0xE5, 0xBE, 0x8B, 0x43, 0xE5, - 0xBE, 0x8C, 0x43, 0xE5, 0xBE, 0x97, 0x43, 0xE5, - 0xBE, 0x9A, 0x43, 0xE5, 0xBE, 0xA9, 0x43, 0xE5, - 0xBE, 0xAD, 0x43, 0xE5, 0xBF, 0x83, 0x43, 0xE5, - // Bytes c80 - cbf - 0xBF, 0x8D, 0x43, 0xE5, 0xBF, 0x97, 0x43, 0xE5, - 0xBF, 0xB5, 0x43, 0xE5, 0xBF, 0xB9, 0x43, 0xE6, - 0x80, 0x92, 0x43, 0xE6, 0x80, 0x9C, 0x43, 0xE6, - 0x81, 0xB5, 0x43, 0xE6, 0x82, 0x81, 0x43, 0xE6, - 0x82, 0x94, 0x43, 0xE6, 0x83, 0x87, 0x43, 0xE6, - 0x83, 0x98, 0x43, 0xE6, 0x83, 0xA1, 0x43, 0xE6, - 0x84, 0x88, 0x43, 0xE6, 0x85, 0x84, 0x43, 0xE6, - 0x85, 0x88, 0x43, 0xE6, 0x85, 0x8C, 0x43, 0xE6, - // Bytes cc0 - cff - 0x85, 0x8E, 0x43, 0xE6, 0x85, 0xA0, 0x43, 0xE6, - 0x85, 0xA8, 0x43, 0xE6, 0x85, 0xBA, 0x43, 0xE6, - 0x86, 0x8E, 0x43, 0xE6, 0x86, 0x90, 0x43, 0xE6, - 0x86, 0xA4, 0x43, 0xE6, 0x86, 0xAF, 0x43, 0xE6, - 0x86, 0xB2, 0x43, 0xE6, 0x87, 0x9E, 0x43, 0xE6, - 0x87, 0xB2, 0x43, 0xE6, 0x87, 0xB6, 0x43, 0xE6, - 0x88, 0x80, 0x43, 0xE6, 0x88, 0x88, 0x43, 0xE6, - 0x88, 0x90, 0x43, 0xE6, 0x88, 0x9B, 0x43, 0xE6, - // Bytes d00 - d3f - 0x88, 0xAE, 0x43, 0xE6, 0x88, 0xB4, 0x43, 0xE6, - 0x88, 0xB6, 0x43, 0xE6, 0x89, 0x8B, 0x43, 0xE6, - 0x89, 0x93, 0x43, 0xE6, 0x89, 0x9D, 0x43, 0xE6, - 0x8A, 0x95, 0x43, 0xE6, 0x8A, 0xB1, 0x43, 0xE6, - 0x8B, 0x89, 0x43, 0xE6, 0x8B, 0x8F, 0x43, 0xE6, - 0x8B, 0x93, 0x43, 0xE6, 0x8B, 0x94, 0x43, 0xE6, - 0x8B, 0xBC, 0x43, 0xE6, 0x8B, 0xBE, 0x43, 0xE6, - 0x8C, 0x87, 0x43, 0xE6, 0x8C, 0xBD, 0x43, 0xE6, - // Bytes d40 - d7f - 0x8D, 0x90, 0x43, 0xE6, 0x8D, 0x95, 0x43, 0xE6, - 0x8D, 0xA8, 0x43, 0xE6, 0x8D, 0xBB, 0x43, 0xE6, - 0x8E, 0x83, 0x43, 0xE6, 0x8E, 0xA0, 0x43, 0xE6, - 0x8E, 0xA9, 0x43, 0xE6, 0x8F, 0x84, 0x43, 0xE6, - 0x8F, 0x85, 0x43, 0xE6, 0x8F, 0xA4, 0x43, 0xE6, - 0x90, 0x9C, 0x43, 0xE6, 0x90, 0xA2, 0x43, 0xE6, - 0x91, 0x92, 0x43, 0xE6, 0x91, 0xA9, 0x43, 0xE6, - 0x91, 0xB7, 0x43, 0xE6, 0x91, 0xBE, 0x43, 0xE6, - // Bytes d80 - dbf - 0x92, 0x9A, 0x43, 0xE6, 0x92, 0x9D, 0x43, 0xE6, - 0x93, 0x84, 0x43, 0xE6, 0x94, 0xAF, 0x43, 0xE6, - 0x94, 0xB4, 0x43, 0xE6, 0x95, 0x8F, 0x43, 0xE6, - 0x95, 0x96, 0x43, 0xE6, 0x95, 0xAC, 0x43, 0xE6, - 0x95, 0xB8, 0x43, 0xE6, 0x96, 0x87, 0x43, 0xE6, - 0x96, 0x97, 0x43, 0xE6, 0x96, 0x99, 0x43, 0xE6, - 0x96, 0xA4, 0x43, 0xE6, 0x96, 0xB0, 0x43, 0xE6, - 0x96, 0xB9, 0x43, 0xE6, 0x97, 0x85, 0x43, 0xE6, - // Bytes dc0 - dff - 0x97, 0xA0, 0x43, 0xE6, 0x97, 0xA2, 0x43, 0xE6, - 0x97, 0xA3, 0x43, 0xE6, 0x97, 0xA5, 0x43, 0xE6, - 0x98, 0x93, 0x43, 0xE6, 0x98, 0xA0, 0x43, 0xE6, - 0x99, 0x89, 0x43, 0xE6, 0x99, 0xB4, 0x43, 0xE6, - 0x9A, 0x88, 0x43, 0xE6, 0x9A, 0x91, 0x43, 0xE6, - 0x9A, 0x9C, 0x43, 0xE6, 0x9A, 0xB4, 0x43, 0xE6, - 0x9B, 0x86, 0x43, 0xE6, 0x9B, 0xB0, 0x43, 0xE6, - 0x9B, 0xB4, 0x43, 0xE6, 0x9B, 0xB8, 0x43, 0xE6, - // Bytes e00 - e3f - 0x9C, 0x80, 0x43, 0xE6, 0x9C, 0x88, 0x43, 0xE6, - 0x9C, 0x89, 0x43, 0xE6, 0x9C, 0x97, 0x43, 0xE6, - 0x9C, 0x9B, 0x43, 0xE6, 0x9C, 0xA1, 0x43, 0xE6, - 0x9C, 0xA8, 0x43, 0xE6, 0x9D, 0x8E, 0x43, 0xE6, - 0x9D, 0x93, 0x43, 0xE6, 0x9D, 0x96, 0x43, 0xE6, - 0x9D, 0x9E, 0x43, 0xE6, 0x9D, 0xBB, 0x43, 0xE6, - 0x9E, 0x85, 0x43, 0xE6, 0x9E, 0x97, 0x43, 0xE6, - 0x9F, 0xB3, 0x43, 0xE6, 0x9F, 0xBA, 0x43, 0xE6, - // Bytes e40 - e7f - 0xA0, 0x97, 0x43, 0xE6, 0xA0, 0x9F, 0x43, 0xE6, - 0xA0, 0xAA, 0x43, 0xE6, 0xA1, 0x92, 0x43, 0xE6, - 0xA2, 0x81, 0x43, 0xE6, 0xA2, 0x85, 0x43, 0xE6, - 0xA2, 0x8E, 0x43, 0xE6, 0xA2, 0xA8, 0x43, 0xE6, - 0xA4, 0x94, 0x43, 0xE6, 0xA5, 0x82, 0x43, 0xE6, - 0xA6, 0xA3, 0x43, 0xE6, 0xA7, 0xAA, 0x43, 0xE6, - 0xA8, 0x82, 0x43, 0xE6, 0xA8, 0x93, 0x43, 0xE6, - 0xAA, 0xA8, 0x43, 0xE6, 0xAB, 0x93, 0x43, 0xE6, - // Bytes e80 - ebf - 0xAB, 0x9B, 0x43, 0xE6, 0xAC, 0x84, 0x43, 0xE6, - 0xAC, 0xA0, 0x43, 0xE6, 0xAC, 0xA1, 0x43, 0xE6, - 0xAD, 0x94, 0x43, 0xE6, 0xAD, 0xA2, 0x43, 0xE6, - 0xAD, 0xA3, 0x43, 0xE6, 0xAD, 0xB2, 0x43, 0xE6, - 0xAD, 0xB7, 0x43, 0xE6, 0xAD, 0xB9, 0x43, 0xE6, - 0xAE, 0x9F, 0x43, 0xE6, 0xAE, 0xAE, 0x43, 0xE6, - 0xAE, 0xB3, 0x43, 0xE6, 0xAE, 0xBA, 0x43, 0xE6, - 0xAE, 0xBB, 0x43, 0xE6, 0xAF, 0x8B, 0x43, 0xE6, - // Bytes ec0 - eff - 0xAF, 0x8D, 0x43, 0xE6, 0xAF, 0x94, 0x43, 0xE6, - 0xAF, 0x9B, 0x43, 0xE6, 0xB0, 0x8F, 0x43, 0xE6, - 0xB0, 0x94, 0x43, 0xE6, 0xB0, 0xB4, 0x43, 0xE6, - 0xB1, 0x8E, 0x43, 0xE6, 0xB1, 0xA7, 0x43, 0xE6, - 0xB2, 0x88, 0x43, 0xE6, 0xB2, 0xBF, 0x43, 0xE6, - 0xB3, 0x8C, 0x43, 0xE6, 0xB3, 0x8D, 0x43, 0xE6, - 0xB3, 0xA5, 0x43, 0xE6, 0xB3, 0xA8, 0x43, 0xE6, - 0xB4, 0x96, 0x43, 0xE6, 0xB4, 0x9B, 0x43, 0xE6, - // Bytes f00 - f3f - 0xB4, 0x9E, 0x43, 0xE6, 0xB4, 0xB4, 0x43, 0xE6, - 0xB4, 0xBE, 0x43, 0xE6, 0xB5, 0x81, 0x43, 0xE6, - 0xB5, 0xA9, 0x43, 0xE6, 0xB5, 0xAA, 0x43, 0xE6, - 0xB5, 0xB7, 0x43, 0xE6, 0xB5, 0xB8, 0x43, 0xE6, - 0xB6, 0x85, 0x43, 0xE6, 0xB7, 0x8B, 0x43, 0xE6, - 0xB7, 0x9A, 0x43, 0xE6, 0xB7, 0xAA, 0x43, 0xE6, - 0xB7, 0xB9, 0x43, 0xE6, 0xB8, 0x9A, 0x43, 0xE6, - 0xB8, 0xAF, 0x43, 0xE6, 0xB9, 0xAE, 0x43, 0xE6, - // Bytes f40 - f7f - 0xBA, 0x80, 0x43, 0xE6, 0xBA, 0x9C, 0x43, 0xE6, - 0xBA, 0xBA, 0x43, 0xE6, 0xBB, 0x87, 0x43, 0xE6, - 0xBB, 0x8B, 0x43, 0xE6, 0xBB, 0x91, 0x43, 0xE6, - 0xBB, 0x9B, 0x43, 0xE6, 0xBC, 0x8F, 0x43, 0xE6, - 0xBC, 0x94, 0x43, 0xE6, 0xBC, 0xA2, 0x43, 0xE6, - 0xBC, 0xA3, 0x43, 0xE6, 0xBD, 0xAE, 0x43, 0xE6, - 0xBF, 0x86, 0x43, 0xE6, 0xBF, 0xAB, 0x43, 0xE6, - 0xBF, 0xBE, 0x43, 0xE7, 0x80, 0x9B, 0x43, 0xE7, - // Bytes f80 - fbf - 0x80, 0x9E, 0x43, 0xE7, 0x80, 0xB9, 0x43, 0xE7, - 0x81, 0x8A, 0x43, 0xE7, 0x81, 0xAB, 0x43, 0xE7, - 0x81, 0xB0, 0x43, 0xE7, 0x81, 0xB7, 0x43, 0xE7, - 0x81, 0xBD, 0x43, 0xE7, 0x82, 0x99, 0x43, 0xE7, - 0x82, 0xAD, 0x43, 0xE7, 0x83, 0x88, 0x43, 0xE7, - 0x83, 0x99, 0x43, 0xE7, 0x84, 0xA1, 0x43, 0xE7, - 0x85, 0x85, 0x43, 0xE7, 0x85, 0x89, 0x43, 0xE7, - 0x85, 0xAE, 0x43, 0xE7, 0x86, 0x9C, 0x43, 0xE7, - // Bytes fc0 - fff - 0x87, 0x8E, 0x43, 0xE7, 0x87, 0x90, 0x43, 0xE7, - 0x88, 0x90, 0x43, 0xE7, 0x88, 0x9B, 0x43, 0xE7, - 0x88, 0xA8, 0x43, 0xE7, 0x88, 0xAA, 0x43, 0xE7, - 0x88, 0xAB, 0x43, 0xE7, 0x88, 0xB5, 0x43, 0xE7, - 0x88, 0xB6, 0x43, 0xE7, 0x88, 0xBB, 0x43, 0xE7, - 0x88, 0xBF, 0x43, 0xE7, 0x89, 0x87, 0x43, 0xE7, - 0x89, 0x90, 0x43, 0xE7, 0x89, 0x99, 0x43, 0xE7, - 0x89, 0x9B, 0x43, 0xE7, 0x89, 0xA2, 0x43, 0xE7, - // Bytes 1000 - 103f - 0x89, 0xB9, 0x43, 0xE7, 0x8A, 0x80, 0x43, 0xE7, - 0x8A, 0x95, 0x43, 0xE7, 0x8A, 0xAC, 0x43, 0xE7, - 0x8A, 0xAF, 0x43, 0xE7, 0x8B, 0x80, 0x43, 0xE7, - 0x8B, 0xBC, 0x43, 0xE7, 0x8C, 0xAA, 0x43, 0xE7, - 0x8D, 0xB5, 0x43, 0xE7, 0x8D, 0xBA, 0x43, 0xE7, - 0x8E, 0x84, 0x43, 0xE7, 0x8E, 0x87, 0x43, 0xE7, - 0x8E, 0x89, 0x43, 0xE7, 0x8E, 0x8B, 0x43, 0xE7, - 0x8E, 0xA5, 0x43, 0xE7, 0x8E, 0xB2, 0x43, 0xE7, - // Bytes 1040 - 107f - 0x8F, 0x9E, 0x43, 0xE7, 0x90, 0x86, 0x43, 0xE7, - 0x90, 0x89, 0x43, 0xE7, 0x90, 0xA2, 0x43, 0xE7, - 0x91, 0x87, 0x43, 0xE7, 0x91, 0x9C, 0x43, 0xE7, - 0x91, 0xA9, 0x43, 0xE7, 0x91, 0xB1, 0x43, 0xE7, - 0x92, 0x85, 0x43, 0xE7, 0x92, 0x89, 0x43, 0xE7, - 0x92, 0x98, 0x43, 0xE7, 0x93, 0x8A, 0x43, 0xE7, - 0x93, 0x9C, 0x43, 0xE7, 0x93, 0xA6, 0x43, 0xE7, - 0x94, 0x86, 0x43, 0xE7, 0x94, 0x98, 0x43, 0xE7, - // Bytes 1080 - 10bf - 0x94, 0x9F, 0x43, 0xE7, 0x94, 0xA4, 0x43, 0xE7, - 0x94, 0xA8, 0x43, 0xE7, 0x94, 0xB0, 0x43, 0xE7, - 0x94, 0xB2, 0x43, 0xE7, 0x94, 0xB3, 0x43, 0xE7, - 0x94, 0xB7, 0x43, 0xE7, 0x94, 0xBB, 0x43, 0xE7, - 0x94, 0xBE, 0x43, 0xE7, 0x95, 0x99, 0x43, 0xE7, - 0x95, 0xA5, 0x43, 0xE7, 0x95, 0xB0, 0x43, 0xE7, - 0x96, 0x8B, 0x43, 0xE7, 0x96, 0x92, 0x43, 0xE7, - 0x97, 0xA2, 0x43, 0xE7, 0x98, 0x90, 0x43, 0xE7, - // Bytes 10c0 - 10ff - 0x98, 0x9D, 0x43, 0xE7, 0x98, 0x9F, 0x43, 0xE7, - 0x99, 0x82, 0x43, 0xE7, 0x99, 0xA9, 0x43, 0xE7, - 0x99, 0xB6, 0x43, 0xE7, 0x99, 0xBD, 0x43, 0xE7, - 0x9A, 0xAE, 0x43, 0xE7, 0x9A, 0xBF, 0x43, 0xE7, - 0x9B, 0x8A, 0x43, 0xE7, 0x9B, 0x9B, 0x43, 0xE7, - 0x9B, 0xA3, 0x43, 0xE7, 0x9B, 0xA7, 0x43, 0xE7, - 0x9B, 0xAE, 0x43, 0xE7, 0x9B, 0xB4, 0x43, 0xE7, - 0x9C, 0x81, 0x43, 0xE7, 0x9C, 0x9E, 0x43, 0xE7, - // Bytes 1100 - 113f - 0x9C, 0x9F, 0x43, 0xE7, 0x9D, 0x80, 0x43, 0xE7, - 0x9D, 0x8A, 0x43, 0xE7, 0x9E, 0x8B, 0x43, 0xE7, - 0x9E, 0xA7, 0x43, 0xE7, 0x9F, 0x9B, 0x43, 0xE7, - 0x9F, 0xA2, 0x43, 0xE7, 0x9F, 0xB3, 0x43, 0xE7, - 0xA1, 0x8E, 0x43, 0xE7, 0xA1, 0xAB, 0x43, 0xE7, - 0xA2, 0x8C, 0x43, 0xE7, 0xA2, 0x91, 0x43, 0xE7, - 0xA3, 0x8A, 0x43, 0xE7, 0xA3, 0x8C, 0x43, 0xE7, - 0xA3, 0xBB, 0x43, 0xE7, 0xA4, 0xAA, 0x43, 0xE7, - // Bytes 1140 - 117f - 0xA4, 0xBA, 0x43, 0xE7, 0xA4, 0xBC, 0x43, 0xE7, - 0xA4, 0xBE, 0x43, 0xE7, 0xA5, 0x88, 0x43, 0xE7, - 0xA5, 0x89, 0x43, 0xE7, 0xA5, 0x90, 0x43, 0xE7, - 0xA5, 0x96, 0x43, 0xE7, 0xA5, 0x9D, 0x43, 0xE7, - 0xA5, 0x9E, 0x43, 0xE7, 0xA5, 0xA5, 0x43, 0xE7, - 0xA5, 0xBF, 0x43, 0xE7, 0xA6, 0x81, 0x43, 0xE7, - 0xA6, 0x8D, 0x43, 0xE7, 0xA6, 0x8E, 0x43, 0xE7, - 0xA6, 0x8F, 0x43, 0xE7, 0xA6, 0xAE, 0x43, 0xE7, - // Bytes 1180 - 11bf - 0xA6, 0xB8, 0x43, 0xE7, 0xA6, 0xBE, 0x43, 0xE7, - 0xA7, 0x8A, 0x43, 0xE7, 0xA7, 0x98, 0x43, 0xE7, - 0xA7, 0xAB, 0x43, 0xE7, 0xA8, 0x9C, 0x43, 0xE7, - 0xA9, 0x80, 0x43, 0xE7, 0xA9, 0x8A, 0x43, 0xE7, - 0xA9, 0x8F, 0x43, 0xE7, 0xA9, 0xB4, 0x43, 0xE7, - 0xA9, 0xBA, 0x43, 0xE7, 0xAA, 0x81, 0x43, 0xE7, - 0xAA, 0xB1, 0x43, 0xE7, 0xAB, 0x8B, 0x43, 0xE7, - 0xAB, 0xAE, 0x43, 0xE7, 0xAB, 0xB9, 0x43, 0xE7, - // Bytes 11c0 - 11ff - 0xAC, 0xA0, 0x43, 0xE7, 0xAE, 0x8F, 0x43, 0xE7, - 0xAF, 0x80, 0x43, 0xE7, 0xAF, 0x86, 0x43, 0xE7, - 0xAF, 0x89, 0x43, 0xE7, 0xB0, 0xBE, 0x43, 0xE7, - 0xB1, 0xA0, 0x43, 0xE7, 0xB1, 0xB3, 0x43, 0xE7, - 0xB1, 0xBB, 0x43, 0xE7, 0xB2, 0x92, 0x43, 0xE7, - 0xB2, 0xBE, 0x43, 0xE7, 0xB3, 0x92, 0x43, 0xE7, - 0xB3, 0x96, 0x43, 0xE7, 0xB3, 0xA3, 0x43, 0xE7, - 0xB3, 0xA7, 0x43, 0xE7, 0xB3, 0xA8, 0x43, 0xE7, - // Bytes 1200 - 123f - 0xB3, 0xB8, 0x43, 0xE7, 0xB4, 0x80, 0x43, 0xE7, - 0xB4, 0x90, 0x43, 0xE7, 0xB4, 0xA2, 0x43, 0xE7, - 0xB4, 0xAF, 0x43, 0xE7, 0xB5, 0x82, 0x43, 0xE7, - 0xB5, 0x9B, 0x43, 0xE7, 0xB5, 0xA3, 0x43, 0xE7, - 0xB6, 0xA0, 0x43, 0xE7, 0xB6, 0xBE, 0x43, 0xE7, - 0xB7, 0x87, 0x43, 0xE7, 0xB7, 0xB4, 0x43, 0xE7, - 0xB8, 0x82, 0x43, 0xE7, 0xB8, 0x89, 0x43, 0xE7, - 0xB8, 0xB7, 0x43, 0xE7, 0xB9, 0x81, 0x43, 0xE7, - // Bytes 1240 - 127f - 0xB9, 0x85, 0x43, 0xE7, 0xBC, 0xB6, 0x43, 0xE7, - 0xBC, 0xBE, 0x43, 0xE7, 0xBD, 0x91, 0x43, 0xE7, - 0xBD, 0xB2, 0x43, 0xE7, 0xBD, 0xB9, 0x43, 0xE7, - 0xBD, 0xBA, 0x43, 0xE7, 0xBE, 0x85, 0x43, 0xE7, - 0xBE, 0x8A, 0x43, 0xE7, 0xBE, 0x95, 0x43, 0xE7, - 0xBE, 0x9A, 0x43, 0xE7, 0xBE, 0xBD, 0x43, 0xE7, - 0xBF, 0xBA, 0x43, 0xE8, 0x80, 0x81, 0x43, 0xE8, - 0x80, 0x85, 0x43, 0xE8, 0x80, 0x8C, 0x43, 0xE8, - // Bytes 1280 - 12bf - 0x80, 0x92, 0x43, 0xE8, 0x80, 0xB3, 0x43, 0xE8, - 0x81, 0x86, 0x43, 0xE8, 0x81, 0xA0, 0x43, 0xE8, - 0x81, 0xAF, 0x43, 0xE8, 0x81, 0xB0, 0x43, 0xE8, - 0x81, 0xBE, 0x43, 0xE8, 0x81, 0xBF, 0x43, 0xE8, - 0x82, 0x89, 0x43, 0xE8, 0x82, 0x8B, 0x43, 0xE8, - 0x82, 0xAD, 0x43, 0xE8, 0x82, 0xB2, 0x43, 0xE8, - 0x84, 0x83, 0x43, 0xE8, 0x84, 0xBE, 0x43, 0xE8, - 0x87, 0x98, 0x43, 0xE8, 0x87, 0xA3, 0x43, 0xE8, - // Bytes 12c0 - 12ff - 0x87, 0xA8, 0x43, 0xE8, 0x87, 0xAA, 0x43, 0xE8, - 0x87, 0xAD, 0x43, 0xE8, 0x87, 0xB3, 0x43, 0xE8, - 0x87, 0xBC, 0x43, 0xE8, 0x88, 0x81, 0x43, 0xE8, - 0x88, 0x84, 0x43, 0xE8, 0x88, 0x8C, 0x43, 0xE8, - 0x88, 0x98, 0x43, 0xE8, 0x88, 0x9B, 0x43, 0xE8, - 0x88, 0x9F, 0x43, 0xE8, 0x89, 0xAE, 0x43, 0xE8, - 0x89, 0xAF, 0x43, 0xE8, 0x89, 0xB2, 0x43, 0xE8, - 0x89, 0xB8, 0x43, 0xE8, 0x89, 0xB9, 0x43, 0xE8, - // Bytes 1300 - 133f - 0x8A, 0x8B, 0x43, 0xE8, 0x8A, 0x91, 0x43, 0xE8, - 0x8A, 0x9D, 0x43, 0xE8, 0x8A, 0xB1, 0x43, 0xE8, - 0x8A, 0xB3, 0x43, 0xE8, 0x8A, 0xBD, 0x43, 0xE8, - 0x8B, 0xA5, 0x43, 0xE8, 0x8B, 0xA6, 0x43, 0xE8, - 0x8C, 0x9D, 0x43, 0xE8, 0x8C, 0xA3, 0x43, 0xE8, - 0x8C, 0xB6, 0x43, 0xE8, 0x8D, 0x92, 0x43, 0xE8, - 0x8D, 0x93, 0x43, 0xE8, 0x8D, 0xA3, 0x43, 0xE8, - 0x8E, 0xAD, 0x43, 0xE8, 0x8E, 0xBD, 0x43, 0xE8, - // Bytes 1340 - 137f - 0x8F, 0x89, 0x43, 0xE8, 0x8F, 0x8A, 0x43, 0xE8, - 0x8F, 0x8C, 0x43, 0xE8, 0x8F, 0x9C, 0x43, 0xE8, - 0x8F, 0xA7, 0x43, 0xE8, 0x8F, 0xAF, 0x43, 0xE8, - 0x8F, 0xB1, 0x43, 0xE8, 0x90, 0xBD, 0x43, 0xE8, - 0x91, 0x89, 0x43, 0xE8, 0x91, 0x97, 0x43, 0xE8, - 0x93, 0xAE, 0x43, 0xE8, 0x93, 0xB1, 0x43, 0xE8, - 0x93, 0xB3, 0x43, 0xE8, 0x93, 0xBC, 0x43, 0xE8, - 0x94, 0x96, 0x43, 0xE8, 0x95, 0xA4, 0x43, 0xE8, - // Bytes 1380 - 13bf - 0x97, 0x8D, 0x43, 0xE8, 0x97, 0xBA, 0x43, 0xE8, - 0x98, 0x86, 0x43, 0xE8, 0x98, 0x92, 0x43, 0xE8, - 0x98, 0xAD, 0x43, 0xE8, 0x98, 0xBF, 0x43, 0xE8, - 0x99, 0x8D, 0x43, 0xE8, 0x99, 0x90, 0x43, 0xE8, - 0x99, 0x9C, 0x43, 0xE8, 0x99, 0xA7, 0x43, 0xE8, - 0x99, 0xA9, 0x43, 0xE8, 0x99, 0xAB, 0x43, 0xE8, - 0x9A, 0x88, 0x43, 0xE8, 0x9A, 0xA9, 0x43, 0xE8, - 0x9B, 0xA2, 0x43, 0xE8, 0x9C, 0x8E, 0x43, 0xE8, - // Bytes 13c0 - 13ff - 0x9C, 0xA8, 0x43, 0xE8, 0x9D, 0xAB, 0x43, 0xE8, - 0x9D, 0xB9, 0x43, 0xE8, 0x9E, 0x86, 0x43, 0xE8, - 0x9E, 0xBA, 0x43, 0xE8, 0x9F, 0xA1, 0x43, 0xE8, - 0xA0, 0x81, 0x43, 0xE8, 0xA0, 0x9F, 0x43, 0xE8, - 0xA1, 0x80, 0x43, 0xE8, 0xA1, 0x8C, 0x43, 0xE8, - 0xA1, 0xA0, 0x43, 0xE8, 0xA1, 0xA3, 0x43, 0xE8, - 0xA3, 0x82, 0x43, 0xE8, 0xA3, 0x8F, 0x43, 0xE8, - 0xA3, 0x97, 0x43, 0xE8, 0xA3, 0x9E, 0x43, 0xE8, - // Bytes 1400 - 143f - 0xA3, 0xA1, 0x43, 0xE8, 0xA3, 0xB8, 0x43, 0xE8, - 0xA3, 0xBA, 0x43, 0xE8, 0xA4, 0x90, 0x43, 0xE8, - 0xA5, 0x81, 0x43, 0xE8, 0xA5, 0xA4, 0x43, 0xE8, - 0xA5, 0xBE, 0x43, 0xE8, 0xA6, 0x86, 0x43, 0xE8, - 0xA6, 0x8B, 0x43, 0xE8, 0xA6, 0x96, 0x43, 0xE8, - 0xA7, 0x92, 0x43, 0xE8, 0xA7, 0xA3, 0x43, 0xE8, - 0xA8, 0x80, 0x43, 0xE8, 0xAA, 0xA0, 0x43, 0xE8, - 0xAA, 0xAA, 0x43, 0xE8, 0xAA, 0xBF, 0x43, 0xE8, - // Bytes 1440 - 147f - 0xAB, 0x8B, 0x43, 0xE8, 0xAB, 0x92, 0x43, 0xE8, - 0xAB, 0x96, 0x43, 0xE8, 0xAB, 0xAD, 0x43, 0xE8, - 0xAB, 0xB8, 0x43, 0xE8, 0xAB, 0xBE, 0x43, 0xE8, - 0xAC, 0x81, 0x43, 0xE8, 0xAC, 0xB9, 0x43, 0xE8, - 0xAD, 0x98, 0x43, 0xE8, 0xAE, 0x80, 0x43, 0xE8, - 0xAE, 0x8A, 0x43, 0xE8, 0xB0, 0xB7, 0x43, 0xE8, - 0xB1, 0x86, 0x43, 0xE8, 0xB1, 0x88, 0x43, 0xE8, - 0xB1, 0x95, 0x43, 0xE8, 0xB1, 0xB8, 0x43, 0xE8, - // Bytes 1480 - 14bf - 0xB2, 0x9D, 0x43, 0xE8, 0xB2, 0xA1, 0x43, 0xE8, - 0xB2, 0xA9, 0x43, 0xE8, 0xB2, 0xAB, 0x43, 0xE8, - 0xB3, 0x81, 0x43, 0xE8, 0xB3, 0x82, 0x43, 0xE8, - 0xB3, 0x87, 0x43, 0xE8, 0xB3, 0x88, 0x43, 0xE8, - 0xB3, 0x93, 0x43, 0xE8, 0xB4, 0x88, 0x43, 0xE8, - 0xB4, 0x9B, 0x43, 0xE8, 0xB5, 0xA4, 0x43, 0xE8, - 0xB5, 0xB0, 0x43, 0xE8, 0xB5, 0xB7, 0x43, 0xE8, - 0xB6, 0xB3, 0x43, 0xE8, 0xB6, 0xBC, 0x43, 0xE8, - // Bytes 14c0 - 14ff - 0xB7, 0x8B, 0x43, 0xE8, 0xB7, 0xAF, 0x43, 0xE8, - 0xB7, 0xB0, 0x43, 0xE8, 0xBA, 0xAB, 0x43, 0xE8, - 0xBB, 0x8A, 0x43, 0xE8, 0xBB, 0x94, 0x43, 0xE8, - 0xBC, 0xA6, 0x43, 0xE8, 0xBC, 0xAA, 0x43, 0xE8, - 0xBC, 0xB8, 0x43, 0xE8, 0xBC, 0xBB, 0x43, 0xE8, - 0xBD, 0xA2, 0x43, 0xE8, 0xBE, 0x9B, 0x43, 0xE8, - 0xBE, 0x9E, 0x43, 0xE8, 0xBE, 0xB0, 0x43, 0xE8, - 0xBE, 0xB5, 0x43, 0xE8, 0xBE, 0xB6, 0x43, 0xE9, - // Bytes 1500 - 153f - 0x80, 0xA3, 0x43, 0xE9, 0x80, 0xB8, 0x43, 0xE9, - 0x81, 0x8A, 0x43, 0xE9, 0x81, 0xA9, 0x43, 0xE9, - 0x81, 0xB2, 0x43, 0xE9, 0x81, 0xBC, 0x43, 0xE9, - 0x82, 0x8F, 0x43, 0xE9, 0x82, 0x91, 0x43, 0xE9, - 0x82, 0x94, 0x43, 0xE9, 0x83, 0x8E, 0x43, 0xE9, - 0x83, 0x9E, 0x43, 0xE9, 0x83, 0xB1, 0x43, 0xE9, - 0x83, 0xBD, 0x43, 0xE9, 0x84, 0x91, 0x43, 0xE9, - 0x84, 0x9B, 0x43, 0xE9, 0x85, 0x89, 0x43, 0xE9, - // Bytes 1540 - 157f - 0x85, 0x8D, 0x43, 0xE9, 0x85, 0xAA, 0x43, 0xE9, - 0x86, 0x99, 0x43, 0xE9, 0x86, 0xB4, 0x43, 0xE9, - 0x87, 0x86, 0x43, 0xE9, 0x87, 0x8C, 0x43, 0xE9, - 0x87, 0x8F, 0x43, 0xE9, 0x87, 0x91, 0x43, 0xE9, - 0x88, 0xB4, 0x43, 0xE9, 0x88, 0xB8, 0x43, 0xE9, - 0x89, 0xB6, 0x43, 0xE9, 0x89, 0xBC, 0x43, 0xE9, - 0x8B, 0x97, 0x43, 0xE9, 0x8B, 0x98, 0x43, 0xE9, - 0x8C, 0x84, 0x43, 0xE9, 0x8D, 0x8A, 0x43, 0xE9, - // Bytes 1580 - 15bf - 0x8F, 0xB9, 0x43, 0xE9, 0x90, 0x95, 0x43, 0xE9, - 0x95, 0xB7, 0x43, 0xE9, 0x96, 0x80, 0x43, 0xE9, - 0x96, 0x8B, 0x43, 0xE9, 0x96, 0xAD, 0x43, 0xE9, - 0x96, 0xB7, 0x43, 0xE9, 0x98, 0x9C, 0x43, 0xE9, - 0x98, 0xAE, 0x43, 0xE9, 0x99, 0x8B, 0x43, 0xE9, - 0x99, 0x8D, 0x43, 0xE9, 0x99, 0xB5, 0x43, 0xE9, - 0x99, 0xB8, 0x43, 0xE9, 0x99, 0xBC, 0x43, 0xE9, - 0x9A, 0x86, 0x43, 0xE9, 0x9A, 0xA3, 0x43, 0xE9, - // Bytes 15c0 - 15ff - 0x9A, 0xB6, 0x43, 0xE9, 0x9A, 0xB7, 0x43, 0xE9, - 0x9A, 0xB8, 0x43, 0xE9, 0x9A, 0xB9, 0x43, 0xE9, - 0x9B, 0x83, 0x43, 0xE9, 0x9B, 0xA2, 0x43, 0xE9, - 0x9B, 0xA3, 0x43, 0xE9, 0x9B, 0xA8, 0x43, 0xE9, - 0x9B, 0xB6, 0x43, 0xE9, 0x9B, 0xB7, 0x43, 0xE9, - 0x9C, 0xA3, 0x43, 0xE9, 0x9C, 0xB2, 0x43, 0xE9, - 0x9D, 0x88, 0x43, 0xE9, 0x9D, 0x91, 0x43, 0xE9, - 0x9D, 0x96, 0x43, 0xE9, 0x9D, 0x9E, 0x43, 0xE9, - // Bytes 1600 - 163f - 0x9D, 0xA2, 0x43, 0xE9, 0x9D, 0xA9, 0x43, 0xE9, - 0x9F, 0x8B, 0x43, 0xE9, 0x9F, 0x9B, 0x43, 0xE9, - 0x9F, 0xA0, 0x43, 0xE9, 0x9F, 0xAD, 0x43, 0xE9, - 0x9F, 0xB3, 0x43, 0xE9, 0x9F, 0xBF, 0x43, 0xE9, - 0xA0, 0x81, 0x43, 0xE9, 0xA0, 0x85, 0x43, 0xE9, - 0xA0, 0x8B, 0x43, 0xE9, 0xA0, 0x98, 0x43, 0xE9, - 0xA0, 0xA9, 0x43, 0xE9, 0xA0, 0xBB, 0x43, 0xE9, - 0xA1, 0x9E, 0x43, 0xE9, 0xA2, 0xA8, 0x43, 0xE9, - // Bytes 1640 - 167f - 0xA3, 0x9B, 0x43, 0xE9, 0xA3, 0x9F, 0x43, 0xE9, - 0xA3, 0xA2, 0x43, 0xE9, 0xA3, 0xAF, 0x43, 0xE9, - 0xA3, 0xBC, 0x43, 0xE9, 0xA4, 0xA8, 0x43, 0xE9, - 0xA4, 0xA9, 0x43, 0xE9, 0xA6, 0x96, 0x43, 0xE9, - 0xA6, 0x99, 0x43, 0xE9, 0xA6, 0xA7, 0x43, 0xE9, - 0xA6, 0xAC, 0x43, 0xE9, 0xA7, 0x82, 0x43, 0xE9, - 0xA7, 0xB1, 0x43, 0xE9, 0xA7, 0xBE, 0x43, 0xE9, - 0xA9, 0xAA, 0x43, 0xE9, 0xAA, 0xA8, 0x43, 0xE9, - // Bytes 1680 - 16bf - 0xAB, 0x98, 0x43, 0xE9, 0xAB, 0x9F, 0x43, 0xE9, - 0xAC, 0x92, 0x43, 0xE9, 0xAC, 0xA5, 0x43, 0xE9, - 0xAC, 0xAF, 0x43, 0xE9, 0xAC, 0xB2, 0x43, 0xE9, - 0xAC, 0xBC, 0x43, 0xE9, 0xAD, 0x9A, 0x43, 0xE9, - 0xAD, 0xAF, 0x43, 0xE9, 0xB1, 0x80, 0x43, 0xE9, - 0xB1, 0x97, 0x43, 0xE9, 0xB3, 0xA5, 0x43, 0xE9, - 0xB3, 0xBD, 0x43, 0xE9, 0xB5, 0xA7, 0x43, 0xE9, - 0xB6, 0xB4, 0x43, 0xE9, 0xB7, 0xBA, 0x43, 0xE9, - // Bytes 16c0 - 16ff - 0xB8, 0x9E, 0x43, 0xE9, 0xB9, 0xB5, 0x43, 0xE9, - 0xB9, 0xBF, 0x43, 0xE9, 0xBA, 0x97, 0x43, 0xE9, - 0xBA, 0x9F, 0x43, 0xE9, 0xBA, 0xA5, 0x43, 0xE9, - 0xBA, 0xBB, 0x43, 0xE9, 0xBB, 0x83, 0x43, 0xE9, - 0xBB, 0x8D, 0x43, 0xE9, 0xBB, 0x8E, 0x43, 0xE9, - 0xBB, 0x91, 0x43, 0xE9, 0xBB, 0xB9, 0x43, 0xE9, - 0xBB, 0xBD, 0x43, 0xE9, 0xBB, 0xBE, 0x43, 0xE9, - 0xBC, 0x85, 0x43, 0xE9, 0xBC, 0x8E, 0x43, 0xE9, - // Bytes 1700 - 173f - 0xBC, 0x8F, 0x43, 0xE9, 0xBC, 0x93, 0x43, 0xE9, - 0xBC, 0x96, 0x43, 0xE9, 0xBC, 0xA0, 0x43, 0xE9, - 0xBC, 0xBB, 0x43, 0xE9, 0xBD, 0x83, 0x43, 0xE9, - 0xBD, 0x8A, 0x43, 0xE9, 0xBD, 0x92, 0x43, 0xE9, - 0xBE, 0x8D, 0x43, 0xE9, 0xBE, 0x8E, 0x43, 0xE9, - 0xBE, 0x9C, 0x43, 0xE9, 0xBE, 0x9F, 0x43, 0xE9, - 0xBE, 0xA0, 0x43, 0xEA, 0x99, 0x91, 0x43, 0xEA, - 0x9A, 0x89, 0x43, 0xEA, 0x9C, 0xA7, 0x43, 0xEA, - // Bytes 1740 - 177f - 0x9D, 0xAF, 0x43, 0xEA, 0x9E, 0x8E, 0x43, 0xEA, - 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x43, 0xEA, - 0xAD, 0xA6, 0x43, 0xEA, 0xAD, 0xA7, 0x44, 0xF0, - 0x9D, 0xBC, 0x84, 0x44, 0xF0, 0x9D, 0xBC, 0x85, - 0x44, 0xF0, 0x9D, 0xBC, 0x86, 0x44, 0xF0, 0x9D, - 0xBC, 0x88, 0x44, 0xF0, 0x9D, 0xBC, 0x8A, 0x44, - 0xF0, 0x9D, 0xBC, 0x9E, 0x44, 0xF0, 0xA0, 0x84, - 0xA2, 0x44, 0xF0, 0xA0, 0x94, 0x9C, 0x44, 0xF0, - // Bytes 1780 - 17bf - 0xA0, 0x94, 0xA5, 0x44, 0xF0, 0xA0, 0x95, 0x8B, - 0x44, 0xF0, 0xA0, 0x98, 0xBA, 0x44, 0xF0, 0xA0, - 0xA0, 0x84, 0x44, 0xF0, 0xA0, 0xA3, 0x9E, 0x44, - 0xF0, 0xA0, 0xA8, 0xAC, 0x44, 0xF0, 0xA0, 0xAD, - 0xA3, 0x44, 0xF0, 0xA1, 0x93, 0xA4, 0x44, 0xF0, - 0xA1, 0x9A, 0xA8, 0x44, 0xF0, 0xA1, 0x9B, 0xAA, - 0x44, 0xF0, 0xA1, 0xA7, 0x88, 0x44, 0xF0, 0xA1, - 0xAC, 0x98, 0x44, 0xF0, 0xA1, 0xB4, 0x8B, 0x44, - // Bytes 17c0 - 17ff - 0xF0, 0xA1, 0xB7, 0xA4, 0x44, 0xF0, 0xA1, 0xB7, - 0xA6, 0x44, 0xF0, 0xA2, 0x86, 0x83, 0x44, 0xF0, - 0xA2, 0x86, 0x9F, 0x44, 0xF0, 0xA2, 0x8C, 0xB1, - 0x44, 0xF0, 0xA2, 0x9B, 0x94, 0x44, 0xF0, 0xA2, - 0xA1, 0x84, 0x44, 0xF0, 0xA2, 0xA1, 0x8A, 0x44, - 0xF0, 0xA2, 0xAC, 0x8C, 0x44, 0xF0, 0xA2, 0xAF, - 0xB1, 0x44, 0xF0, 0xA3, 0x80, 0x8A, 0x44, 0xF0, - 0xA3, 0x8A, 0xB8, 0x44, 0xF0, 0xA3, 0x8D, 0x9F, - // Bytes 1800 - 183f - 0x44, 0xF0, 0xA3, 0x8E, 0x93, 0x44, 0xF0, 0xA3, - 0x8E, 0x9C, 0x44, 0xF0, 0xA3, 0x8F, 0x83, 0x44, - 0xF0, 0xA3, 0x8F, 0x95, 0x44, 0xF0, 0xA3, 0x91, - 0xAD, 0x44, 0xF0, 0xA3, 0x9A, 0xA3, 0x44, 0xF0, - 0xA3, 0xA2, 0xA7, 0x44, 0xF0, 0xA3, 0xAA, 0x8D, - 0x44, 0xF0, 0xA3, 0xAB, 0xBA, 0x44, 0xF0, 0xA3, - 0xB2, 0xBC, 0x44, 0xF0, 0xA3, 0xB4, 0x9E, 0x44, - 0xF0, 0xA3, 0xBB, 0x91, 0x44, 0xF0, 0xA3, 0xBD, - // Bytes 1840 - 187f - 0x9E, 0x44, 0xF0, 0xA3, 0xBE, 0x8E, 0x44, 0xF0, - 0xA4, 0x89, 0xA3, 0x44, 0xF0, 0xA4, 0x8B, 0xAE, - 0x44, 0xF0, 0xA4, 0x8E, 0xAB, 0x44, 0xF0, 0xA4, - 0x98, 0x88, 0x44, 0xF0, 0xA4, 0x9C, 0xB5, 0x44, - 0xF0, 0xA4, 0xA0, 0x94, 0x44, 0xF0, 0xA4, 0xB0, - 0xB6, 0x44, 0xF0, 0xA4, 0xB2, 0x92, 0x44, 0xF0, - 0xA4, 0xBE, 0xA1, 0x44, 0xF0, 0xA4, 0xBE, 0xB8, - 0x44, 0xF0, 0xA5, 0x81, 0x84, 0x44, 0xF0, 0xA5, - // Bytes 1880 - 18bf - 0x83, 0xB2, 0x44, 0xF0, 0xA5, 0x83, 0xB3, 0x44, - 0xF0, 0xA5, 0x84, 0x99, 0x44, 0xF0, 0xA5, 0x84, - 0xB3, 0x44, 0xF0, 0xA5, 0x89, 0x89, 0x44, 0xF0, - 0xA5, 0x90, 0x9D, 0x44, 0xF0, 0xA5, 0x98, 0xA6, - 0x44, 0xF0, 0xA5, 0x9A, 0x9A, 0x44, 0xF0, 0xA5, - 0x9B, 0x85, 0x44, 0xF0, 0xA5, 0xA5, 0xBC, 0x44, - 0xF0, 0xA5, 0xAA, 0xA7, 0x44, 0xF0, 0xA5, 0xAE, - 0xAB, 0x44, 0xF0, 0xA5, 0xB2, 0x80, 0x44, 0xF0, - // Bytes 18c0 - 18ff - 0xA5, 0xB3, 0x90, 0x44, 0xF0, 0xA5, 0xBE, 0x86, - 0x44, 0xF0, 0xA6, 0x87, 0x9A, 0x44, 0xF0, 0xA6, - 0x88, 0xA8, 0x44, 0xF0, 0xA6, 0x89, 0x87, 0x44, - 0xF0, 0xA6, 0x8B, 0x99, 0x44, 0xF0, 0xA6, 0x8C, - 0xBE, 0x44, 0xF0, 0xA6, 0x93, 0x9A, 0x44, 0xF0, - 0xA6, 0x94, 0xA3, 0x44, 0xF0, 0xA6, 0x96, 0xA8, - 0x44, 0xF0, 0xA6, 0x9E, 0xA7, 0x44, 0xF0, 0xA6, - 0x9E, 0xB5, 0x44, 0xF0, 0xA6, 0xAC, 0xBC, 0x44, - // Bytes 1900 - 193f - 0xF0, 0xA6, 0xB0, 0xB6, 0x44, 0xF0, 0xA6, 0xB3, - 0x95, 0x44, 0xF0, 0xA6, 0xB5, 0xAB, 0x44, 0xF0, - 0xA6, 0xBC, 0xAC, 0x44, 0xF0, 0xA6, 0xBE, 0xB1, - 0x44, 0xF0, 0xA7, 0x83, 0x92, 0x44, 0xF0, 0xA7, - 0x8F, 0x8A, 0x44, 0xF0, 0xA7, 0x99, 0xA7, 0x44, - 0xF0, 0xA7, 0xA2, 0xAE, 0x44, 0xF0, 0xA7, 0xA5, - 0xA6, 0x44, 0xF0, 0xA7, 0xB2, 0xA8, 0x44, 0xF0, - 0xA7, 0xBB, 0x93, 0x44, 0xF0, 0xA7, 0xBC, 0xAF, - // Bytes 1940 - 197f - 0x44, 0xF0, 0xA8, 0x97, 0x92, 0x44, 0xF0, 0xA8, - 0x97, 0xAD, 0x44, 0xF0, 0xA8, 0x9C, 0xAE, 0x44, - 0xF0, 0xA8, 0xAF, 0xBA, 0x44, 0xF0, 0xA8, 0xB5, - 0xB7, 0x44, 0xF0, 0xA9, 0x85, 0x85, 0x44, 0xF0, - 0xA9, 0x87, 0x9F, 0x44, 0xF0, 0xA9, 0x88, 0x9A, - 0x44, 0xF0, 0xA9, 0x90, 0x8A, 0x44, 0xF0, 0xA9, - 0x92, 0x96, 0x44, 0xF0, 0xA9, 0x96, 0xB6, 0x44, - 0xF0, 0xA9, 0xAC, 0xB0, 0x44, 0xF0, 0xAA, 0x83, - // Bytes 1980 - 19bf - 0x8E, 0x44, 0xF0, 0xAA, 0x84, 0x85, 0x44, 0xF0, - 0xAA, 0x88, 0x8E, 0x44, 0xF0, 0xAA, 0x8A, 0x91, - 0x44, 0xF0, 0xAA, 0x8E, 0x92, 0x44, 0xF0, 0xAA, - 0x98, 0x80, 0x42, 0x21, 0x21, 0x42, 0x21, 0x3F, - 0x42, 0x2E, 0x2E, 0x42, 0x30, 0x2C, 0x42, 0x30, - 0x2E, 0x42, 0x31, 0x2C, 0x42, 0x31, 0x2E, 0x42, - 0x31, 0x30, 0x42, 0x31, 0x31, 0x42, 0x31, 0x32, - 0x42, 0x31, 0x33, 0x42, 0x31, 0x34, 0x42, 0x31, - // Bytes 19c0 - 19ff - 0x35, 0x42, 0x31, 0x36, 0x42, 0x31, 0x37, 0x42, - 0x31, 0x38, 0x42, 0x31, 0x39, 0x42, 0x32, 0x2C, - 0x42, 0x32, 0x2E, 0x42, 0x32, 0x30, 0x42, 0x32, - 0x31, 0x42, 0x32, 0x32, 0x42, 0x32, 0x33, 0x42, - 0x32, 0x34, 0x42, 0x32, 0x35, 0x42, 0x32, 0x36, - 0x42, 0x32, 0x37, 0x42, 0x32, 0x38, 0x42, 0x32, - 0x39, 0x42, 0x33, 0x2C, 0x42, 0x33, 0x2E, 0x42, - 0x33, 0x30, 0x42, 0x33, 0x31, 0x42, 0x33, 0x32, - // Bytes 1a00 - 1a3f - 0x42, 0x33, 0x33, 0x42, 0x33, 0x34, 0x42, 0x33, - 0x35, 0x42, 0x33, 0x36, 0x42, 0x33, 0x37, 0x42, - 0x33, 0x38, 0x42, 0x33, 0x39, 0x42, 0x34, 0x2C, - 0x42, 0x34, 0x2E, 0x42, 0x34, 0x30, 0x42, 0x34, - 0x31, 0x42, 0x34, 0x32, 0x42, 0x34, 0x33, 0x42, - 0x34, 0x34, 0x42, 0x34, 0x35, 0x42, 0x34, 0x36, - 0x42, 0x34, 0x37, 0x42, 0x34, 0x38, 0x42, 0x34, - 0x39, 0x42, 0x35, 0x2C, 0x42, 0x35, 0x2E, 0x42, - // Bytes 1a40 - 1a7f - 0x35, 0x30, 0x42, 0x36, 0x2C, 0x42, 0x36, 0x2E, - 0x42, 0x37, 0x2C, 0x42, 0x37, 0x2E, 0x42, 0x38, - 0x2C, 0x42, 0x38, 0x2E, 0x42, 0x39, 0x2C, 0x42, - 0x39, 0x2E, 0x42, 0x3D, 0x3D, 0x42, 0x3F, 0x21, - 0x42, 0x3F, 0x3F, 0x42, 0x41, 0x55, 0x42, 0x42, - 0x71, 0x42, 0x43, 0x44, 0x42, 0x44, 0x4A, 0x42, - 0x44, 0x5A, 0x42, 0x44, 0x7A, 0x42, 0x47, 0x42, - 0x42, 0x47, 0x79, 0x42, 0x48, 0x50, 0x42, 0x48, - // Bytes 1a80 - 1abf - 0x56, 0x42, 0x48, 0x67, 0x42, 0x48, 0x7A, 0x42, - 0x49, 0x49, 0x42, 0x49, 0x4A, 0x42, 0x49, 0x55, - 0x42, 0x49, 0x56, 0x42, 0x49, 0x58, 0x42, 0x4B, - 0x42, 0x42, 0x4B, 0x4B, 0x42, 0x4B, 0x4D, 0x42, - 0x4C, 0x4A, 0x42, 0x4C, 0x6A, 0x42, 0x4D, 0x42, - 0x42, 0x4D, 0x43, 0x42, 0x4D, 0x44, 0x42, 0x4D, - 0x52, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42, - 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F, - // Bytes 1ac0 - 1aff - 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50, - 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42, - 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76, - 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57, - 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42, - 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64, - 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64, - 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42, - // Bytes 1b00 - 1b3f - 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66, - 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66, - 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42, - 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76, - 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B, - 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42, - 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74, - 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C, - // Bytes 1b40 - 1b7f - 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42, - 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56, - 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D, - 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42, - 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46, - 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E, - 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42, - 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46, - // Bytes 1b80 - 1bbf - 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70, - 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42, - 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69, - 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29, - 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29, - 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29, - 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29, - 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29, - // Bytes 1bc0 - 1bff - 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29, - 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29, - 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29, - 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29, - 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29, - 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29, - 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29, - 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29, - // Bytes 1c00 - 1c3f - 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29, - 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29, - 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29, - 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29, - 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29, - 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29, - 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29, - 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29, - // Bytes 1c40 - 1c7f - 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29, - 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29, - 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29, - 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29, - 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29, - 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29, - 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29, - 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29, - // Bytes 1c80 - 1cbf - 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29, - 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E, - 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E, - 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E, - 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E, - 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E, - 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E, - 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D, - // Bytes 1cc0 - 1cff - 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E, - 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A, - 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49, - 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7, - 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61, - 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D, - 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45, - 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A, - // Bytes 1d00 - 1d3f - 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49, - 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73, - 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72, - 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75, - 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32, - 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32, - 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67, - 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C, - // Bytes 1d40 - 1d7f - 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61, - 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A, - 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32, - 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9, - 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7, - 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32, - 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C, - 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69, - // Bytes 1d80 - 1dbf - 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43, - 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E, - 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46, - 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57, - 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C, - 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73, - 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31, - 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44, - // Bytes 1dc0 - 1dff - 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34, - 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28, - 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29, - 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31, - 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44, - 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81, - 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31, - 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9, - // Bytes 1e00 - 1e3f - 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6, - 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44, - 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C, - 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34, - 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88, - 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6, - 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44, - 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97, - // Bytes 1e40 - 1e7f - 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36, - 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5, - 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7, - 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44, - 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82, - 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39, - 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9, - 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E, - // Bytes 1e80 - 1ebf - 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44, - 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69, - 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5, - 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB, - 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4, - 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44, - 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9, - 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8, - // Bytes 1ec0 - 1eff - 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE, - 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8, - 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44, - 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9, - 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8, - 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC, - 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA, - 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44, - // Bytes 1f00 - 1f3f - 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9, - 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8, - 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89, - 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB, - 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44, - 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9, - 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8, - 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89, - // Bytes 1f40 - 1f7f - 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC, - 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44, - 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9, - 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8, - 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89, - 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE, - 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44, - 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9, - // Bytes 1f80 - 1fbf - 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8, - 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD, - 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3, - 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44, - 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9, - 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8, - 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD, - 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4, - // Bytes 1fc0 - 1fff - 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44, - 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9, - 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8, - 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE, - 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5, - 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44, - 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8, - 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8, - // Bytes 2000 - 203f - 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1, - 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6, - 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44, - 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9, - 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8, - 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85, - 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9, - 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44, - // Bytes 2040 - 207f - 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8, - 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8, - 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A, - 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81, - 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44, - 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9, - 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9, - 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85, - // Bytes 2080 - 20bf - 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82, - 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44, - 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8, - 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9, - 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85, - 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83, - 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44, - 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8, - // Bytes 20c0 - 20ff - 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9, - 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87, - 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84, - 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44, - 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8, - 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9, - 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89, - 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86, - // Bytes 2100 - 213f - 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44, - 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8, - 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9, - 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86, - 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86, - 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44, - 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9, - 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9, - // Bytes 2140 - 217f - 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4, - 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A, - 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44, - 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8, - 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9, - 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87, - 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A, - 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44, - // Bytes 2180 - 21bf - 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84, - 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29, - 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28, - 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84, - 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29, - 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28, - 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84, - 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29, - // Bytes 21c0 - 21ff - 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28, - 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84, - 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29, - 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28, - 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8, - 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29, - 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28, - 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB, - // Bytes 2200 - 223f - 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29, - 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28, - 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85, - 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29, - 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28, - 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90, - 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29, - 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28, - // Bytes 2240 - 227f - 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD, - 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29, - 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28, - 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C, - 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29, - 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28, - 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89, - 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29, - // Bytes 2280 - 22bf - 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28, - 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5, - 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29, - 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28, - 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3, - 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29, - 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, - 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6, - // Bytes 22c0 - 22ff - 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9, - 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31, - 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7, - 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5, - 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31, - 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6, - 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9, - 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31, - // Bytes 2300 - 233f - 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6, - 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9, - 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31, - 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6, - 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9, - 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31, - 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6, - 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9, - // Bytes 2340 - 237f - 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31, - 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81, - 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35, - 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31, - 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81, - 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39, - 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32, - 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6, - // Bytes 2380 - 23bf - 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9, - 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32, - 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6, - 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9, - 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32, - 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6, - 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5, - 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32, - // Bytes 23c0 - 23ff - 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6, - 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33, - 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, - 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6, - 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34, - 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, - 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81, - 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36, - // Bytes 2400 - 243f - 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37, - 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88, - 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D, - 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31, - 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2, - 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88, - 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD, - 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9, - // Bytes 2440 - 247f - 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85, - 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46, - 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, - 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA, - 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, - 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, - 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9, - 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC, - // Bytes 2480 - 24bf - 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46, - 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8, - 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA, - 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8, - 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD, - 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8, - 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89, - 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46, - // Bytes 24c0 - 24ff - 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, - 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD, - 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8, - 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC, - 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8, - 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89, - 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46, - 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8, - // Bytes 2500 - 253f - 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, - 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, - 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, - 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9, - 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE, - 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46, - 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8, - 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5, - // Bytes 2540 - 257f - 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9, - 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85, - 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, - 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A, - 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46, - 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, - 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7, - 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8, - // Bytes 2580 - 25bf - 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, - 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, - 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A, - 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46, - 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, - 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81, - 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9, - 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84, - // Bytes 25c0 - 25ff - 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8, - 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85, - 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46, - 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, - 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84, - 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8, - 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC, - 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, - // Bytes 2600 - 263f - 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89, - 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, - 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, - 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84, - 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8, - 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC, - 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, - 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A, - // Bytes 2640 - 267f - 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, - 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, - 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85, - 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8, - 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE, - 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9, - 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD, - 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46, - // Bytes 2680 - 26bf - 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9, - 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86, - 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8, - 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD, - 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, - 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A, - 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46, - 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, - // Bytes 26c0 - 26ff - 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, - 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, - 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85, - 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, - 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC, - 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46, - 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9, - 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A, - // Bytes 2700 - 273f - 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9, - 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94, - 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, - 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88, - 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46, - 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9, - 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A, - 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9, - // Bytes 2740 - 277f - 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94, - 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB, - 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2, - 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46, - 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0, - 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD, - 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82, - 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0, - // Bytes 2780 - 27bf - 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE, - 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7, - 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46, - 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, - 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, - 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1, - 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0, - 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE, - // Bytes 27c0 - 27ff - 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, - 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46, - 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2, - 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81, - 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88, - 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3, - 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82, - 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88, - // Bytes 2800 - 283f - 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46, - 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3, - 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83, - 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA, - 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3, - 0x83, 0xA0, 0x46, 0xE4, 0xBB, 0xA4, 0xE5, 0x92, - 0x8C, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, 0xA3, - 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, 0x46, - // Bytes 2840 - 287f - 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, 0xE6, - 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, 0x61, - 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, 0x80, - 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, 0xE1, - 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, - 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, 0x48, - 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x29, - 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, - // Bytes 2880 - 28bf - 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, 0x85, - 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, 0xE1, - 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x89, - 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, - 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, - 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, - 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, 0x48, - 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x29, - // Bytes 28c0 - 28ff - 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, - 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, 0x85, - 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, 0xE1, - 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x92, - 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, 0x64, - 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, 0xA7, - 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, 0xD8, - 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, 0x48, - // Bytes 2900 - 293f - 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, 0x84, - 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, 0xD9, - 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, 0xB9, - 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, 0xD9, - 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, 0xAD, - 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, 0xD8, - 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, 0x80, - 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0x49, - // Bytes 2940 - 297f - 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, 0x80, - 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, - 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, 0xE2, - 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, 0x80, - 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, 0x49, - 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, 0x80, - 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, 0x9D, - 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, - // Bytes 2980 - 29bf - 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, - 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, 0x49, - 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, 0x80, - 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, 0xAC, - 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE7, - 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, - 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, 0x49, - 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, 0x83, - // Bytes 29c0 - 29ff - 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, - 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, 0xE3, - 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x82, - 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, 0x49, - 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, 0x83, - 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0xA4, - 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, 0xE3, - 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, 0x82, - // Bytes 2a00 - 2a3f - 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, 0x49, - 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, - 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, - 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, 0xE3, - 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, 0x83, - 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, - 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, 0x83, - 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0xA4, - // Bytes 2a40 - 2a7f - 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, 0xE3, - 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, - 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, 0x49, - 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, 0x83, - 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, - 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, 0xE3, - 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, - 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, 0x49, - // Bytes 2a80 - 2abf - 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, - 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, - 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, 0xE3, - 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, 0x83, - 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, 0x49, - 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, - 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, 0xA2, - 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, 0xE3, - // Bytes 2ac0 - 2aff - 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, 0x80, - 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, - 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, 0x88, - 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x4C, - 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, 0x83, - 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, 0xA8, - 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, 0x83, - 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, - // Bytes 2b00 - 2b3f - 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, 0xE3, - 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xB3, - 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, - 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, - 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, 0xE3, - 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, - 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, 0xE3, - 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x83, - // Bytes 2b40 - 2b7f - 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, - 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, - 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, 0xAF, - 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, 0x83, - 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0xA4, - 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, - 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, - 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, 0xE3, - // Bytes 2b80 - 2bbf - 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x84, - 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, - 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, - 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, 0xE3, - 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, - 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, 0x4C, - 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, - 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, 0x98, - // Bytes 2bc0 - 2bff - 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, 0x82, - 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, - 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, 0xE3, - 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, 0xAF, - 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, 0xE3, - 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, - 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, 0xE3, - 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, - // Bytes 2c00 - 2c3f - 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, - 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, 0x83, - 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0x4C, - 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, 0xBC, - 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, 0x84, - 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, 0xE1, - 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, 0x84, - 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, - // Bytes 2c40 - 2c7f - 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, - 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, - 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, - 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, - 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, 0xE3, - 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, 0x83, - 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, 0xE3, - 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, 0xBC, - // Bytes 2c80 - 2cbf - 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, 0xE3, - 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAC, - 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, 0xE3, - 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, 0xBC, - 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, 0xE3, - 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, - 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, 0xE3, - 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, 0xA7, - // Bytes 2cc0 - 2cff - 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, 0xE3, - 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x88, - 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, 0xE3, - 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, - 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, 0x8B, - 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, 0x85, - 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, 0x82, - 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0xE3, - // Bytes 2d00 - 2d3f - 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, - 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, 0xE3, - 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, - 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, 0xE3, - 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, - 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, 0xE3, - 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, - 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, 0x83, - // Bytes 2d40 - 2d7f - 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, - 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, 0x82, - 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, 0x8F, - 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x82, - 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, 0x52, - 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, - 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, 0xE3, - 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, 0x82, - // Bytes 2d80 - 2dbf - 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, 0xE3, - 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, - 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, 0xE3, - 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, - 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, 0xE3, - 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, - 0xE3, 0x83, 0xB3, 0x5F, 0xD8, 0xB5, 0xD9, 0x84, - 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, 0xD9, - // Bytes 2dc0 - 2dff - 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, 0x84, - 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, 0xD8, - 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x44, 0x44, 0x5A, - 0xCC, 0x8C, 0xCD, 0x44, 0x44, 0x7A, 0xCC, 0x8C, - 0xCD, 0x44, 0x64, 0x7A, 0xCC, 0x8C, 0xCD, 0x46, - 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x46, - 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, 0xCD, 0x46, - 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, 0xB9, 0x49, - // Bytes 2e00 - 2e3f - 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, 0xE3, 0x82, - 0x99, 0x11, 0x4C, 0xE1, 0x84, 0x8C, 0xE1, 0x85, - 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xB4, 0x01, - 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, 0xE3, - 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11, 0x4C, 0xE3, - 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x9B, - 0xE3, 0x82, 0x9A, 0x11, 0x4C, 0xE3, 0x83, 0xA4, - 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, 0xE3, 0x82, - // Bytes 2e40 - 2e7f - 0x99, 0x11, 0x4F, 0xE1, 0x84, 0x8E, 0xE1, 0x85, - 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, 0x80, 0xE1, - 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, 0xA4, 0xE3, - 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xAF, - 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, 0x82, 0xB7, - 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, - 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, 0x83, - 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, - // Bytes 2e80 - 2ebf - 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, - 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, - 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x11, 0x52, - 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, 0xE3, 0x82, - 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, 0xE3, - 0x82, 0x99, 0x11, 0x52, 0xE3, 0x83, 0x95, 0xE3, - 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, 0x83, 0x83, - 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x11, 0x03, - // Bytes 2ec0 - 2eff - 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, 0xCC, 0xB8, - 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, 0x03, 0x41, - 0xCC, 0x80, 0xCD, 0x03, 0x41, 0xCC, 0x81, 0xCD, - 0x03, 0x41, 0xCC, 0x83, 0xCD, 0x03, 0x41, 0xCC, - 0x84, 0xCD, 0x03, 0x41, 0xCC, 0x89, 0xCD, 0x03, - 0x41, 0xCC, 0x8C, 0xCD, 0x03, 0x41, 0xCC, 0x8F, - 0xCD, 0x03, 0x41, 0xCC, 0x91, 0xCD, 0x03, 0x41, - 0xCC, 0xA5, 0xB9, 0x03, 0x41, 0xCC, 0xA8, 0xA9, - // Bytes 2f00 - 2f3f - 0x03, 0x42, 0xCC, 0x87, 0xCD, 0x03, 0x42, 0xCC, - 0xA3, 0xB9, 0x03, 0x42, 0xCC, 0xB1, 0xB9, 0x03, - 0x43, 0xCC, 0x81, 0xCD, 0x03, 0x43, 0xCC, 0x82, - 0xCD, 0x03, 0x43, 0xCC, 0x87, 0xCD, 0x03, 0x43, - 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC, 0x87, 0xCD, - 0x03, 0x44, 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC, - 0xA3, 0xB9, 0x03, 0x44, 0xCC, 0xA7, 0xA9, 0x03, - 0x44, 0xCC, 0xAD, 0xB9, 0x03, 0x44, 0xCC, 0xB1, - // Bytes 2f40 - 2f7f - 0xB9, 0x03, 0x45, 0xCC, 0x80, 0xCD, 0x03, 0x45, - 0xCC, 0x81, 0xCD, 0x03, 0x45, 0xCC, 0x83, 0xCD, - 0x03, 0x45, 0xCC, 0x86, 0xCD, 0x03, 0x45, 0xCC, - 0x87, 0xCD, 0x03, 0x45, 0xCC, 0x88, 0xCD, 0x03, - 0x45, 0xCC, 0x89, 0xCD, 0x03, 0x45, 0xCC, 0x8C, - 0xCD, 0x03, 0x45, 0xCC, 0x8F, 0xCD, 0x03, 0x45, - 0xCC, 0x91, 0xCD, 0x03, 0x45, 0xCC, 0xA8, 0xA9, - 0x03, 0x45, 0xCC, 0xAD, 0xB9, 0x03, 0x45, 0xCC, - // Bytes 2f80 - 2fbf - 0xB0, 0xB9, 0x03, 0x46, 0xCC, 0x87, 0xCD, 0x03, - 0x47, 0xCC, 0x81, 0xCD, 0x03, 0x47, 0xCC, 0x82, - 0xCD, 0x03, 0x47, 0xCC, 0x84, 0xCD, 0x03, 0x47, - 0xCC, 0x86, 0xCD, 0x03, 0x47, 0xCC, 0x87, 0xCD, - 0x03, 0x47, 0xCC, 0x8C, 0xCD, 0x03, 0x47, 0xCC, - 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0x82, 0xCD, 0x03, - 0x48, 0xCC, 0x87, 0xCD, 0x03, 0x48, 0xCC, 0x88, - 0xCD, 0x03, 0x48, 0xCC, 0x8C, 0xCD, 0x03, 0x48, - // Bytes 2fc0 - 2fff - 0xCC, 0xA3, 0xB9, 0x03, 0x48, 0xCC, 0xA7, 0xA9, - 0x03, 0x48, 0xCC, 0xAE, 0xB9, 0x03, 0x49, 0xCC, - 0x80, 0xCD, 0x03, 0x49, 0xCC, 0x81, 0xCD, 0x03, - 0x49, 0xCC, 0x82, 0xCD, 0x03, 0x49, 0xCC, 0x83, - 0xCD, 0x03, 0x49, 0xCC, 0x84, 0xCD, 0x03, 0x49, - 0xCC, 0x86, 0xCD, 0x03, 0x49, 0xCC, 0x87, 0xCD, - 0x03, 0x49, 0xCC, 0x89, 0xCD, 0x03, 0x49, 0xCC, - 0x8C, 0xCD, 0x03, 0x49, 0xCC, 0x8F, 0xCD, 0x03, - // Bytes 3000 - 303f - 0x49, 0xCC, 0x91, 0xCD, 0x03, 0x49, 0xCC, 0xA3, - 0xB9, 0x03, 0x49, 0xCC, 0xA8, 0xA9, 0x03, 0x49, - 0xCC, 0xB0, 0xB9, 0x03, 0x4A, 0xCC, 0x82, 0xCD, - 0x03, 0x4B, 0xCC, 0x81, 0xCD, 0x03, 0x4B, 0xCC, - 0x8C, 0xCD, 0x03, 0x4B, 0xCC, 0xA3, 0xB9, 0x03, - 0x4B, 0xCC, 0xA7, 0xA9, 0x03, 0x4B, 0xCC, 0xB1, - 0xB9, 0x03, 0x4C, 0xCC, 0x81, 0xCD, 0x03, 0x4C, - 0xCC, 0x8C, 0xCD, 0x03, 0x4C, 0xCC, 0xA7, 0xA9, - // Bytes 3040 - 307f - 0x03, 0x4C, 0xCC, 0xAD, 0xB9, 0x03, 0x4C, 0xCC, - 0xB1, 0xB9, 0x03, 0x4D, 0xCC, 0x81, 0xCD, 0x03, - 0x4D, 0xCC, 0x87, 0xCD, 0x03, 0x4D, 0xCC, 0xA3, - 0xB9, 0x03, 0x4E, 0xCC, 0x80, 0xCD, 0x03, 0x4E, - 0xCC, 0x81, 0xCD, 0x03, 0x4E, 0xCC, 0x83, 0xCD, - 0x03, 0x4E, 0xCC, 0x87, 0xCD, 0x03, 0x4E, 0xCC, - 0x8C, 0xCD, 0x03, 0x4E, 0xCC, 0xA3, 0xB9, 0x03, - 0x4E, 0xCC, 0xA7, 0xA9, 0x03, 0x4E, 0xCC, 0xAD, - // Bytes 3080 - 30bf - 0xB9, 0x03, 0x4E, 0xCC, 0xB1, 0xB9, 0x03, 0x4F, - 0xCC, 0x80, 0xCD, 0x03, 0x4F, 0xCC, 0x81, 0xCD, - 0x03, 0x4F, 0xCC, 0x86, 0xCD, 0x03, 0x4F, 0xCC, - 0x89, 0xCD, 0x03, 0x4F, 0xCC, 0x8B, 0xCD, 0x03, - 0x4F, 0xCC, 0x8C, 0xCD, 0x03, 0x4F, 0xCC, 0x8F, - 0xCD, 0x03, 0x4F, 0xCC, 0x91, 0xCD, 0x03, 0x50, - 0xCC, 0x81, 0xCD, 0x03, 0x50, 0xCC, 0x87, 0xCD, - 0x03, 0x52, 0xCC, 0x81, 0xCD, 0x03, 0x52, 0xCC, - // Bytes 30c0 - 30ff - 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x8C, 0xCD, 0x03, - 0x52, 0xCC, 0x8F, 0xCD, 0x03, 0x52, 0xCC, 0x91, - 0xCD, 0x03, 0x52, 0xCC, 0xA7, 0xA9, 0x03, 0x52, - 0xCC, 0xB1, 0xB9, 0x03, 0x53, 0xCC, 0x82, 0xCD, - 0x03, 0x53, 0xCC, 0x87, 0xCD, 0x03, 0x53, 0xCC, - 0xA6, 0xB9, 0x03, 0x53, 0xCC, 0xA7, 0xA9, 0x03, - 0x54, 0xCC, 0x87, 0xCD, 0x03, 0x54, 0xCC, 0x8C, - 0xCD, 0x03, 0x54, 0xCC, 0xA3, 0xB9, 0x03, 0x54, - // Bytes 3100 - 313f - 0xCC, 0xA6, 0xB9, 0x03, 0x54, 0xCC, 0xA7, 0xA9, - 0x03, 0x54, 0xCC, 0xAD, 0xB9, 0x03, 0x54, 0xCC, - 0xB1, 0xB9, 0x03, 0x55, 0xCC, 0x80, 0xCD, 0x03, - 0x55, 0xCC, 0x81, 0xCD, 0x03, 0x55, 0xCC, 0x82, - 0xCD, 0x03, 0x55, 0xCC, 0x86, 0xCD, 0x03, 0x55, - 0xCC, 0x89, 0xCD, 0x03, 0x55, 0xCC, 0x8A, 0xCD, - 0x03, 0x55, 0xCC, 0x8B, 0xCD, 0x03, 0x55, 0xCC, - 0x8C, 0xCD, 0x03, 0x55, 0xCC, 0x8F, 0xCD, 0x03, - // Bytes 3140 - 317f - 0x55, 0xCC, 0x91, 0xCD, 0x03, 0x55, 0xCC, 0xA3, - 0xB9, 0x03, 0x55, 0xCC, 0xA4, 0xB9, 0x03, 0x55, - 0xCC, 0xA8, 0xA9, 0x03, 0x55, 0xCC, 0xAD, 0xB9, - 0x03, 0x55, 0xCC, 0xB0, 0xB9, 0x03, 0x56, 0xCC, - 0x83, 0xCD, 0x03, 0x56, 0xCC, 0xA3, 0xB9, 0x03, - 0x57, 0xCC, 0x80, 0xCD, 0x03, 0x57, 0xCC, 0x81, - 0xCD, 0x03, 0x57, 0xCC, 0x82, 0xCD, 0x03, 0x57, - 0xCC, 0x87, 0xCD, 0x03, 0x57, 0xCC, 0x88, 0xCD, - // Bytes 3180 - 31bf - 0x03, 0x57, 0xCC, 0xA3, 0xB9, 0x03, 0x58, 0xCC, - 0x87, 0xCD, 0x03, 0x58, 0xCC, 0x88, 0xCD, 0x03, - 0x59, 0xCC, 0x80, 0xCD, 0x03, 0x59, 0xCC, 0x81, - 0xCD, 0x03, 0x59, 0xCC, 0x82, 0xCD, 0x03, 0x59, - 0xCC, 0x83, 0xCD, 0x03, 0x59, 0xCC, 0x84, 0xCD, - 0x03, 0x59, 0xCC, 0x87, 0xCD, 0x03, 0x59, 0xCC, - 0x88, 0xCD, 0x03, 0x59, 0xCC, 0x89, 0xCD, 0x03, - 0x59, 0xCC, 0xA3, 0xB9, 0x03, 0x5A, 0xCC, 0x81, - // Bytes 31c0 - 31ff - 0xCD, 0x03, 0x5A, 0xCC, 0x82, 0xCD, 0x03, 0x5A, - 0xCC, 0x87, 0xCD, 0x03, 0x5A, 0xCC, 0x8C, 0xCD, - 0x03, 0x5A, 0xCC, 0xA3, 0xB9, 0x03, 0x5A, 0xCC, - 0xB1, 0xB9, 0x03, 0x61, 0xCC, 0x80, 0xCD, 0x03, - 0x61, 0xCC, 0x81, 0xCD, 0x03, 0x61, 0xCC, 0x83, - 0xCD, 0x03, 0x61, 0xCC, 0x84, 0xCD, 0x03, 0x61, - 0xCC, 0x89, 0xCD, 0x03, 0x61, 0xCC, 0x8C, 0xCD, - 0x03, 0x61, 0xCC, 0x8F, 0xCD, 0x03, 0x61, 0xCC, - // Bytes 3200 - 323f - 0x91, 0xCD, 0x03, 0x61, 0xCC, 0xA5, 0xB9, 0x03, - 0x61, 0xCC, 0xA8, 0xA9, 0x03, 0x62, 0xCC, 0x87, - 0xCD, 0x03, 0x62, 0xCC, 0xA3, 0xB9, 0x03, 0x62, - 0xCC, 0xB1, 0xB9, 0x03, 0x63, 0xCC, 0x81, 0xCD, - 0x03, 0x63, 0xCC, 0x82, 0xCD, 0x03, 0x63, 0xCC, - 0x87, 0xCD, 0x03, 0x63, 0xCC, 0x8C, 0xCD, 0x03, - 0x64, 0xCC, 0x87, 0xCD, 0x03, 0x64, 0xCC, 0x8C, - 0xCD, 0x03, 0x64, 0xCC, 0xA3, 0xB9, 0x03, 0x64, - // Bytes 3240 - 327f - 0xCC, 0xA7, 0xA9, 0x03, 0x64, 0xCC, 0xAD, 0xB9, - 0x03, 0x64, 0xCC, 0xB1, 0xB9, 0x03, 0x65, 0xCC, - 0x80, 0xCD, 0x03, 0x65, 0xCC, 0x81, 0xCD, 0x03, - 0x65, 0xCC, 0x83, 0xCD, 0x03, 0x65, 0xCC, 0x86, - 0xCD, 0x03, 0x65, 0xCC, 0x87, 0xCD, 0x03, 0x65, - 0xCC, 0x88, 0xCD, 0x03, 0x65, 0xCC, 0x89, 0xCD, - 0x03, 0x65, 0xCC, 0x8C, 0xCD, 0x03, 0x65, 0xCC, - 0x8F, 0xCD, 0x03, 0x65, 0xCC, 0x91, 0xCD, 0x03, - // Bytes 3280 - 32bf - 0x65, 0xCC, 0xA8, 0xA9, 0x03, 0x65, 0xCC, 0xAD, - 0xB9, 0x03, 0x65, 0xCC, 0xB0, 0xB9, 0x03, 0x66, - 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC, 0x81, 0xCD, - 0x03, 0x67, 0xCC, 0x82, 0xCD, 0x03, 0x67, 0xCC, - 0x84, 0xCD, 0x03, 0x67, 0xCC, 0x86, 0xCD, 0x03, - 0x67, 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC, 0x8C, - 0xCD, 0x03, 0x67, 0xCC, 0xA7, 0xA9, 0x03, 0x68, - 0xCC, 0x82, 0xCD, 0x03, 0x68, 0xCC, 0x87, 0xCD, - // Bytes 32c0 - 32ff - 0x03, 0x68, 0xCC, 0x88, 0xCD, 0x03, 0x68, 0xCC, - 0x8C, 0xCD, 0x03, 0x68, 0xCC, 0xA3, 0xB9, 0x03, - 0x68, 0xCC, 0xA7, 0xA9, 0x03, 0x68, 0xCC, 0xAE, - 0xB9, 0x03, 0x68, 0xCC, 0xB1, 0xB9, 0x03, 0x69, - 0xCC, 0x80, 0xCD, 0x03, 0x69, 0xCC, 0x81, 0xCD, - 0x03, 0x69, 0xCC, 0x82, 0xCD, 0x03, 0x69, 0xCC, - 0x83, 0xCD, 0x03, 0x69, 0xCC, 0x84, 0xCD, 0x03, - 0x69, 0xCC, 0x86, 0xCD, 0x03, 0x69, 0xCC, 0x89, - // Bytes 3300 - 333f - 0xCD, 0x03, 0x69, 0xCC, 0x8C, 0xCD, 0x03, 0x69, - 0xCC, 0x8F, 0xCD, 0x03, 0x69, 0xCC, 0x91, 0xCD, - 0x03, 0x69, 0xCC, 0xA3, 0xB9, 0x03, 0x69, 0xCC, - 0xA8, 0xA9, 0x03, 0x69, 0xCC, 0xB0, 0xB9, 0x03, - 0x6A, 0xCC, 0x82, 0xCD, 0x03, 0x6A, 0xCC, 0x8C, - 0xCD, 0x03, 0x6B, 0xCC, 0x81, 0xCD, 0x03, 0x6B, - 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, 0xA3, 0xB9, - 0x03, 0x6B, 0xCC, 0xA7, 0xA9, 0x03, 0x6B, 0xCC, - // Bytes 3340 - 337f - 0xB1, 0xB9, 0x03, 0x6C, 0xCC, 0x81, 0xCD, 0x03, - 0x6C, 0xCC, 0x8C, 0xCD, 0x03, 0x6C, 0xCC, 0xA7, - 0xA9, 0x03, 0x6C, 0xCC, 0xAD, 0xB9, 0x03, 0x6C, - 0xCC, 0xB1, 0xB9, 0x03, 0x6D, 0xCC, 0x81, 0xCD, - 0x03, 0x6D, 0xCC, 0x87, 0xCD, 0x03, 0x6D, 0xCC, - 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0x80, 0xCD, 0x03, - 0x6E, 0xCC, 0x81, 0xCD, 0x03, 0x6E, 0xCC, 0x83, - 0xCD, 0x03, 0x6E, 0xCC, 0x87, 0xCD, 0x03, 0x6E, - // Bytes 3380 - 33bf - 0xCC, 0x8C, 0xCD, 0x03, 0x6E, 0xCC, 0xA3, 0xB9, - 0x03, 0x6E, 0xCC, 0xA7, 0xA9, 0x03, 0x6E, 0xCC, - 0xAD, 0xB9, 0x03, 0x6E, 0xCC, 0xB1, 0xB9, 0x03, - 0x6F, 0xCC, 0x80, 0xCD, 0x03, 0x6F, 0xCC, 0x81, - 0xCD, 0x03, 0x6F, 0xCC, 0x86, 0xCD, 0x03, 0x6F, - 0xCC, 0x89, 0xCD, 0x03, 0x6F, 0xCC, 0x8B, 0xCD, - 0x03, 0x6F, 0xCC, 0x8C, 0xCD, 0x03, 0x6F, 0xCC, - 0x8F, 0xCD, 0x03, 0x6F, 0xCC, 0x91, 0xCD, 0x03, - // Bytes 33c0 - 33ff - 0x70, 0xCC, 0x81, 0xCD, 0x03, 0x70, 0xCC, 0x87, - 0xCD, 0x03, 0x72, 0xCC, 0x81, 0xCD, 0x03, 0x72, - 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, 0x8C, 0xCD, - 0x03, 0x72, 0xCC, 0x8F, 0xCD, 0x03, 0x72, 0xCC, - 0x91, 0xCD, 0x03, 0x72, 0xCC, 0xA7, 0xA9, 0x03, - 0x72, 0xCC, 0xB1, 0xB9, 0x03, 0x73, 0xCC, 0x82, - 0xCD, 0x03, 0x73, 0xCC, 0x87, 0xCD, 0x03, 0x73, - 0xCC, 0xA6, 0xB9, 0x03, 0x73, 0xCC, 0xA7, 0xA9, - // Bytes 3400 - 343f - 0x03, 0x74, 0xCC, 0x87, 0xCD, 0x03, 0x74, 0xCC, - 0x88, 0xCD, 0x03, 0x74, 0xCC, 0x8C, 0xCD, 0x03, - 0x74, 0xCC, 0xA3, 0xB9, 0x03, 0x74, 0xCC, 0xA6, - 0xB9, 0x03, 0x74, 0xCC, 0xA7, 0xA9, 0x03, 0x74, - 0xCC, 0xAD, 0xB9, 0x03, 0x74, 0xCC, 0xB1, 0xB9, - 0x03, 0x75, 0xCC, 0x80, 0xCD, 0x03, 0x75, 0xCC, - 0x81, 0xCD, 0x03, 0x75, 0xCC, 0x82, 0xCD, 0x03, - 0x75, 0xCC, 0x86, 0xCD, 0x03, 0x75, 0xCC, 0x89, - // Bytes 3440 - 347f - 0xCD, 0x03, 0x75, 0xCC, 0x8A, 0xCD, 0x03, 0x75, - 0xCC, 0x8B, 0xCD, 0x03, 0x75, 0xCC, 0x8C, 0xCD, - 0x03, 0x75, 0xCC, 0x8F, 0xCD, 0x03, 0x75, 0xCC, - 0x91, 0xCD, 0x03, 0x75, 0xCC, 0xA3, 0xB9, 0x03, - 0x75, 0xCC, 0xA4, 0xB9, 0x03, 0x75, 0xCC, 0xA8, - 0xA9, 0x03, 0x75, 0xCC, 0xAD, 0xB9, 0x03, 0x75, - 0xCC, 0xB0, 0xB9, 0x03, 0x76, 0xCC, 0x83, 0xCD, - 0x03, 0x76, 0xCC, 0xA3, 0xB9, 0x03, 0x77, 0xCC, - // Bytes 3480 - 34bf - 0x80, 0xCD, 0x03, 0x77, 0xCC, 0x81, 0xCD, 0x03, - 0x77, 0xCC, 0x82, 0xCD, 0x03, 0x77, 0xCC, 0x87, - 0xCD, 0x03, 0x77, 0xCC, 0x88, 0xCD, 0x03, 0x77, - 0xCC, 0x8A, 0xCD, 0x03, 0x77, 0xCC, 0xA3, 0xB9, - 0x03, 0x78, 0xCC, 0x87, 0xCD, 0x03, 0x78, 0xCC, - 0x88, 0xCD, 0x03, 0x79, 0xCC, 0x80, 0xCD, 0x03, - 0x79, 0xCC, 0x81, 0xCD, 0x03, 0x79, 0xCC, 0x82, - 0xCD, 0x03, 0x79, 0xCC, 0x83, 0xCD, 0x03, 0x79, - // Bytes 34c0 - 34ff - 0xCC, 0x84, 0xCD, 0x03, 0x79, 0xCC, 0x87, 0xCD, - 0x03, 0x79, 0xCC, 0x88, 0xCD, 0x03, 0x79, 0xCC, - 0x89, 0xCD, 0x03, 0x79, 0xCC, 0x8A, 0xCD, 0x03, - 0x79, 0xCC, 0xA3, 0xB9, 0x03, 0x7A, 0xCC, 0x81, - 0xCD, 0x03, 0x7A, 0xCC, 0x82, 0xCD, 0x03, 0x7A, - 0xCC, 0x87, 0xCD, 0x03, 0x7A, 0xCC, 0x8C, 0xCD, - 0x03, 0x7A, 0xCC, 0xA3, 0xB9, 0x03, 0x7A, 0xCC, - 0xB1, 0xB9, 0x04, 0xC2, 0xA8, 0xCC, 0x80, 0xCE, - // Bytes 3500 - 353f - 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x04, 0xC2, - 0xA8, 0xCD, 0x82, 0xCE, 0x04, 0xC3, 0x86, 0xCC, - 0x81, 0xCD, 0x04, 0xC3, 0x86, 0xCC, 0x84, 0xCD, - 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xCD, 0x04, 0xC3, - 0xA6, 0xCC, 0x81, 0xCD, 0x04, 0xC3, 0xA6, 0xCC, - 0x84, 0xCD, 0x04, 0xC3, 0xB8, 0xCC, 0x81, 0xCD, - 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xCD, 0x04, 0xC6, - 0xB7, 0xCC, 0x8C, 0xCD, 0x04, 0xCA, 0x92, 0xCC, - // Bytes 3540 - 357f - 0x8C, 0xCD, 0x04, 0xCE, 0x91, 0xCC, 0x80, 0xCD, - 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xCD, 0x04, 0xCE, - 0x91, 0xCC, 0x84, 0xCD, 0x04, 0xCE, 0x91, 0xCC, - 0x86, 0xCD, 0x04, 0xCE, 0x91, 0xCD, 0x85, 0xDD, - 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xCD, 0x04, 0xCE, - 0x95, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0x97, 0xCC, - 0x80, 0xCD, 0x04, 0xCE, 0x97, 0xCC, 0x81, 0xCD, - 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xDD, 0x04, 0xCE, - // Bytes 3580 - 35bf - 0x99, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x99, 0xCC, - 0x81, 0xCD, 0x04, 0xCE, 0x99, 0xCC, 0x84, 0xCD, - 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xCD, 0x04, 0xCE, - 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xCE, 0x9F, 0xCC, - 0x80, 0xCD, 0x04, 0xCE, 0x9F, 0xCC, 0x81, 0xCD, - 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xCD, 0x04, 0xCE, - 0xA5, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, - 0x81, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, 0x84, 0xCD, - // Bytes 35c0 - 35ff - 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xCD, 0x04, 0xCE, - 0xA5, 0xCC, 0x88, 0xCD, 0x04, 0xCE, 0xA9, 0xCC, - 0x80, 0xCD, 0x04, 0xCE, 0xA9, 0xCC, 0x81, 0xCD, - 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xDD, 0x04, 0xCE, - 0xB1, 0xCC, 0x84, 0xCD, 0x04, 0xCE, 0xB1, 0xCC, - 0x86, 0xCD, 0x04, 0xCE, 0xB1, 0xCD, 0x85, 0xDD, - 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xCD, 0x04, 0xCE, - 0xB5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0xB7, 0xCD, - // Bytes 3600 - 363f - 0x85, 0xDD, 0x04, 0xCE, 0xB9, 0xCC, 0x80, 0xCD, - 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x04, 0xCE, - 0xB9, 0xCC, 0x84, 0xCD, 0x04, 0xCE, 0xB9, 0xCC, - 0x86, 0xCD, 0x04, 0xCE, 0xB9, 0xCD, 0x82, 0xCD, - 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xCD, 0x04, 0xCE, - 0xBF, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x81, 0xCC, - 0x93, 0xCD, 0x04, 0xCF, 0x81, 0xCC, 0x94, 0xCD, - 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xCD, 0x04, 0xCF, - // Bytes 3640 - 367f - 0x85, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x85, 0xCC, - 0x84, 0xCD, 0x04, 0xCF, 0x85, 0xCC, 0x86, 0xCD, - 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xCD, 0x04, 0xCF, - 0x89, 0xCD, 0x85, 0xDD, 0x04, 0xCF, 0x92, 0xCC, - 0x81, 0xCD, 0x04, 0xCF, 0x92, 0xCC, 0x88, 0xCD, - 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xCD, 0x04, 0xD0, - 0x90, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0x90, 0xCC, - 0x88, 0xCD, 0x04, 0xD0, 0x93, 0xCC, 0x81, 0xCD, - // Bytes 3680 - 36bf - 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xCD, 0x04, 0xD0, - 0x95, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0x95, 0xCC, - 0x88, 0xCD, 0x04, 0xD0, 0x96, 0xCC, 0x86, 0xCD, - 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD0, - 0x97, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x98, 0xCC, - 0x80, 0xCD, 0x04, 0xD0, 0x98, 0xCC, 0x84, 0xCD, - 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xCD, 0x04, 0xD0, - 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x9A, 0xCC, - // Bytes 36c0 - 36ff - 0x81, 0xCD, 0x04, 0xD0, 0x9E, 0xCC, 0x88, 0xCD, - 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xCD, 0x04, 0xD0, - 0xA3, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, - 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, 0x8B, 0xCD, - 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xCD, 0x04, 0xD0, - 0xAB, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xAD, 0xCC, - 0x88, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, 0x86, 0xCD, - 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xCD, 0x04, 0xD0, - // Bytes 3700 - 373f - 0xB3, 0xCC, 0x81, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, - 0x80, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, 0x86, 0xCD, - 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xCD, 0x04, 0xD0, - 0xB6, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xB6, 0xCC, - 0x88, 0xCD, 0x04, 0xD0, 0xB7, 0xCC, 0x88, 0xCD, - 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xCD, 0x04, 0xD0, - 0xB8, 0xCC, 0x84, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, - 0x86, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, 0x88, 0xCD, - // Bytes 3740 - 377f - 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xCD, 0x04, 0xD0, - 0xBE, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0x83, 0xCC, - 0x84, 0xCD, 0x04, 0xD1, 0x83, 0xCC, 0x86, 0xCD, - 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xCD, 0x04, 0xD1, - 0x83, 0xCC, 0x8B, 0xCD, 0x04, 0xD1, 0x87, 0xCC, - 0x88, 0xCD, 0x04, 0xD1, 0x8B, 0xCC, 0x88, 0xCD, - 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xCD, 0x04, 0xD1, - 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0xB4, 0xCC, - // Bytes 3780 - 37bf - 0x8F, 0xCD, 0x04, 0xD1, 0xB5, 0xCC, 0x8F, 0xCD, - 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD3, - 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xD3, 0xA8, 0xCC, - 0x88, 0xCD, 0x04, 0xD3, 0xA9, 0xCC, 0x88, 0xCD, - 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x04, 0xD8, - 0xA7, 0xD9, 0x94, 0xCD, 0x04, 0xD8, 0xA7, 0xD9, - 0x95, 0xB9, 0x04, 0xD9, 0x88, 0xD9, 0x94, 0xCD, - 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xCD, 0x04, 0xDB, - // Bytes 37c0 - 37ff - 0x81, 0xD9, 0x94, 0xCD, 0x04, 0xDB, 0x92, 0xD9, - 0x94, 0xCD, 0x04, 0xDB, 0x95, 0xD9, 0x94, 0xCD, - 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, 0xCE, 0x05, - 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, 0x41, - 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x41, 0xCC, - 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x41, 0xCC, 0x86, - 0xCC, 0x80, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, - 0x81, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, 0x83, - // Bytes 3800 - 383f - 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, 0x89, 0xCE, - 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, - 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x41, - 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x41, 0xCC, - 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x41, 0xCC, 0xA3, - 0xCC, 0x86, 0xCE, 0x05, 0x43, 0xCC, 0xA7, 0xCC, - 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x80, - 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x81, 0xCE, - // Bytes 3840 - 387f - 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, - 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x45, - 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x45, 0xCC, - 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x45, 0xCC, 0xA3, - 0xCC, 0x82, 0xCE, 0x05, 0x45, 0xCC, 0xA7, 0xCC, - 0x86, 0xCE, 0x05, 0x49, 0xCC, 0x88, 0xCC, 0x81, - 0xCE, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, - 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, 0xCE, 0x05, - // Bytes 3880 - 38bf - 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, 0x4F, - 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x4F, 0xCC, - 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x4F, 0xCC, 0x83, - 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, 0x83, 0xCC, - 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x83, 0xCC, 0x88, - 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x80, 0xCE, - 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, - 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, 0x4F, - // Bytes 38c0 - 38ff - 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x4F, 0xCC, - 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, - 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, - 0x83, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, 0x89, - 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, - 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, - 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05, 0x52, - 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x53, 0xCC, - // Bytes 3900 - 393f - 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC, 0x8C, - 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC, 0xA3, 0xCC, - 0x87, 0xCE, 0x05, 0x55, 0xCC, 0x83, 0xCC, 0x81, - 0xCE, 0x05, 0x55, 0xCC, 0x84, 0xCC, 0x88, 0xCE, - 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, 0xCE, 0x05, - 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05, 0x55, - 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x55, 0xCC, - 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x55, 0xCC, 0x9B, - // Bytes 3940 - 397f - 0xCC, 0x80, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, - 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0x83, - 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0x89, 0xCE, - 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, 0x05, - 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCE, 0x05, 0x61, - 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, - 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x61, 0xCC, 0x82, - 0xCC, 0x89, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, - // Bytes 3980 - 39bf - 0x80, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x81, - 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x83, 0xCE, - 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, 0xCE, 0x05, - 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, 0x61, - 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x61, 0xCC, - 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, 0xA3, - 0xCC, 0x82, 0xCE, 0x05, 0x61, 0xCC, 0xA3, 0xCC, - 0x86, 0xCE, 0x05, 0x63, 0xCC, 0xA7, 0xCC, 0x81, - // Bytes 39c0 - 39ff - 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x80, 0xCE, - 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, - 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x65, - 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x65, 0xCC, - 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x65, 0xCC, 0x84, - 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, 0xA3, 0xCC, - 0x82, 0xCE, 0x05, 0x65, 0xCC, 0xA7, 0xCC, 0x86, - 0xCE, 0x05, 0x69, 0xCC, 0x88, 0xCC, 0x81, 0xCE, - // Bytes 3a00 - 3a3f - 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, - 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCE, 0x05, 0x6F, - 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, - 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x6F, 0xCC, 0x82, - 0xCC, 0x89, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, - 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, 0x84, - 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, 0x88, 0xCE, - 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, - // Bytes 3a40 - 3a7f - 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x6F, - 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, - 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, - 0xCC, 0x80, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, - 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0x83, - 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0x89, 0xCE, - 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, 0x05, - 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x6F, - // Bytes 3a80 - 3abf - 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05, 0x72, 0xCC, - 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x73, 0xCC, 0x81, - 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, 0x8C, 0xCC, - 0x87, 0xCE, 0x05, 0x73, 0xCC, 0xA3, 0xCC, 0x87, - 0xCE, 0x05, 0x75, 0xCC, 0x83, 0xCC, 0x81, 0xCE, - 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, 0xCE, 0x05, - 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCE, 0x05, 0x75, - 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05, 0x75, 0xCC, - // Bytes 3ac0 - 3aff - 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x75, 0xCC, 0x88, - 0xCC, 0x8C, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, - 0x80, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x81, - 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x83, 0xCE, - 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, 0xCE, 0x05, - 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, 0x05, 0xE1, - 0xBE, 0xBF, 0xCC, 0x80, 0xCE, 0x05, 0xE1, 0xBE, - 0xBF, 0xCC, 0x81, 0xCE, 0x05, 0xE1, 0xBE, 0xBF, - // Bytes 3b00 - 3b3f - 0xCD, 0x82, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCC, - 0x80, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCC, 0x81, - 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, 0x82, 0xCE, - 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, 0x05, 0x05, - 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, - 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, - 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, 0x92, - 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, 0x94, 0xCC, - // Bytes 3b40 - 3b7f - 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, 0xCC, 0xB8, - 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, 0xB8, 0x05, - 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, 0x05, 0x05, - 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, - 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, - 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x83, - 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x85, 0xCC, - 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, 0xCC, 0xB8, - // Bytes 3b80 - 3bbf - 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, 0xB8, 0x05, - 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, 0x05, 0x05, - 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, 0x05, 0xE2, - 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, - 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB3, - 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB6, 0xCC, - 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, 0xCC, 0xB8, - 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, 0xB8, 0x05, - // Bytes 3bc0 - 3bff - 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, 0x05, 0x05, - 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, - 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, - 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x83, - 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x86, 0xCC, - 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, 0xCC, 0xB8, - 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, 0xB8, 0x05, - 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, 0x05, 0x05, - // Bytes 3c00 - 3c3f - 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, - 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, - 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xAB, - 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB2, 0xCC, - 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, 0xCC, 0xB8, - 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, 0xB8, 0x05, - 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, 0x05, 0x06, - 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - // Bytes 3c40 - 3c7f - 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - // Bytes 3c80 - 3cbf - 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - // Bytes 3cc0 - 3cff - 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, 0xDE, 0x06, - // Bytes 3d00 - 3d3f - 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, 0xDE, 0x06, - // Bytes 3d40 - 3d7f - 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - // Bytes 3d80 - 3dbf - 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - // Bytes 3dc0 - 3dff - 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - // Bytes 3e00 - 3e3f - 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x06, - 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, 0xDE, 0x06, - 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, 0xDE, 0x06, - 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, 0xDE, 0x06, - 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, 0x0D, 0x06, - // Bytes 3e40 - 3e7f - 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, 0x0D, 0x06, - 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, 0x0D, 0x06, - 0xE0, 0xA7, 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, - 0xE0, 0xA7, 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, - 0xE0, 0xAD, 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, - 0xE0, 0xAD, 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, - 0xE0, 0xAD, 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, - 0xE0, 0xAE, 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, - // Bytes 3e80 - 3ebf - 0xE0, 0xAF, 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, - 0xE0, 0xAF, 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, - 0xE0, 0xAF, 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, - 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, 0x89, 0x06, - 0xE0, 0xB2, 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, - 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, - 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, - 0xE0, 0xB5, 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, - // Bytes 3ec0 - 3eff - 0xE0, 0xB5, 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, - 0xE0, 0xB5, 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, - 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, 0x15, 0x06, - 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, - 0xE1, 0x80, 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, - 0xE1, 0xAC, 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - // Bytes 3f00 - 3f3f - 0xE1, 0xAC, 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAD, 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - // Bytes 3f40 - 3f7f - 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 3f80 - 3fbf - 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 3fc0 - 3fff - 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, 0x11, 0x06, - // Bytes 4000 - 403f - 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 4040 - 407f - 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 4080 - 40bf - 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 40c0 - 40ff - 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 4100 - 413f - 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, 0x11, 0x08, - 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x81, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93, - 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, - 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, - // Bytes 4140 - 417f - 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x82, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x93, - 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, - 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x80, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94, - 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, - // Bytes 4180 - 41bf - 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x81, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, - 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, - 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x82, - // Bytes 41c0 - 41ff - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x93, - 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, - 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x80, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94, - 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, - 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, - // Bytes 4200 - 423f - 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x81, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, - 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, - 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x82, - 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x93, - // Bytes 4240 - 427f - 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, - 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, - 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, - 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x80, - 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94, - 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, - 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, - 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, 0x82, 0xBA, - // Bytes 4280 - 42bf - 0x0D, 0x08, 0xF0, 0x91, 0x82, 0x9B, 0xF0, 0x91, - 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, 0x82, 0xA5, - 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, - 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, 0x08, - 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, 0xA7, - 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, 0x91, - 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, - 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, 0x91, - // Bytes 42c0 - 42ff - 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, 0x08, - 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xBA, - 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, - 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, 0xB8, - 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, 0x91, - 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, - 0xF0, 0x91, 0xA4, 0xB5, 0xF0, 0x91, 0xA4, 0xB0, - 0x01, 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, - // Bytes 4300 - 433f - 0xE0, 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, - 0xE0, 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x16, 0x42, - 0xC2, 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xCD, - 0x43, 0x20, 0xCC, 0x83, 0xCD, 0x43, 0x20, 0xCC, - 0x84, 0xCD, 0x43, 0x20, 0xCC, 0x85, 0xCD, 0x43, - 0x20, 0xCC, 0x86, 0xCD, 0x43, 0x20, 0xCC, 0x87, - 0xCD, 0x43, 0x20, 0xCC, 0x88, 0xCD, 0x43, 0x20, - 0xCC, 0x8A, 0xCD, 0x43, 0x20, 0xCC, 0x8B, 0xCD, - // Bytes 4340 - 437f - 0x43, 0x20, 0xCC, 0x93, 0xCD, 0x43, 0x20, 0xCC, - 0x94, 0xCD, 0x43, 0x20, 0xCC, 0xA7, 0xA9, 0x43, - 0x20, 0xCC, 0xA8, 0xA9, 0x43, 0x20, 0xCC, 0xB3, - 0xB9, 0x43, 0x20, 0xCD, 0x82, 0xCD, 0x43, 0x20, - 0xCD, 0x85, 0xDD, 0x43, 0x20, 0xD9, 0x8B, 0x5D, - 0x43, 0x20, 0xD9, 0x8C, 0x61, 0x43, 0x20, 0xD9, - 0x8D, 0x65, 0x43, 0x20, 0xD9, 0x8E, 0x69, 0x43, - 0x20, 0xD9, 0x8F, 0x6D, 0x43, 0x20, 0xD9, 0x90, - // Bytes 4380 - 43bf - 0x71, 0x43, 0x20, 0xD9, 0x91, 0x75, 0x43, 0x20, - 0xD9, 0x92, 0x79, 0x43, 0x41, 0xCC, 0x8A, 0xCD, - 0x43, 0x73, 0xCC, 0x87, 0xCD, 0x44, 0x20, 0xE3, - 0x82, 0x99, 0x11, 0x44, 0x20, 0xE3, 0x82, 0x9A, - 0x11, 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x44, - 0xCE, 0x91, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x95, - 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x97, 0xCC, 0x81, - 0xCD, 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xCD, 0x44, - // Bytes 43c0 - 43ff - 0xCE, 0x9F, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, - 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, 0xCC, 0x88, - 0xCD, 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xCD, 0x44, - 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB5, - 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB7, 0xCC, 0x81, - 0xCD, 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x44, - 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x85, - 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x89, 0xCC, 0x81, - // Bytes 4400 - 443f - 0xCD, 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x35, 0x44, - 0xD7, 0x90, 0xD6, 0xB8, 0x39, 0x44, 0xD7, 0x90, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x4D, 0x44, - 0xD7, 0x92, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x93, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x94, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x3D, 0x44, - 0xD7, 0x95, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x96, - // Bytes 4440 - 447f - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x98, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x29, 0x44, - 0xD7, 0x99, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9A, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x4D, 0x44, - 0xD7, 0x9C, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9E, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x45, 0x44, - // Bytes 4480 - 44bf - 0xD7, 0xA3, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, - 0x4D, 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x45, 0x44, - 0xD7, 0xA7, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA8, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x51, 0x44, - 0xD7, 0xA9, 0xD7, 0x82, 0x55, 0x44, 0xD7, 0xAA, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, - // Bytes 44c0 - 44ff - 0x35, 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x5D, 0x44, - 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x44, 0xD8, 0xA7, - 0xD9, 0x94, 0xCD, 0x44, 0xD8, 0xA7, 0xD9, 0x95, - 0xB9, 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x7D, 0x44, - 0xD8, 0xB1, 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x80, - 0xD9, 0x8B, 0x5D, 0x44, 0xD9, 0x80, 0xD9, 0x8E, - 0x69, 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x6D, 0x44, - 0xD9, 0x80, 0xD9, 0x90, 0x71, 0x44, 0xD9, 0x80, - // Bytes 4500 - 453f - 0xD9, 0x91, 0x75, 0x44, 0xD9, 0x80, 0xD9, 0x92, - 0x79, 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x7D, 0x44, - 0xD9, 0x88, 0xD9, 0x94, 0xCD, 0x44, 0xD9, 0x89, - 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x8A, 0xD9, 0x94, - 0xCD, 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xCD, 0x44, - 0xDB, 0x95, 0xD9, 0x94, 0xCD, 0x45, 0x20, 0xCC, - 0x88, 0xCC, 0x80, 0xCE, 0x45, 0x20, 0xCC, 0x88, - 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, 0x88, 0xCD, - // Bytes 4540 - 457f - 0x82, 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, - 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCE, - 0x45, 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x45, - 0x20, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x45, 0x20, - 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, - 0x94, 0xCD, 0x82, 0xCE, 0x45, 0x20, 0xD9, 0x8C, - 0xD9, 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8D, 0xD9, - 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, - // Bytes 4580 - 45bf - 0x76, 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x76, - 0x45, 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x45, - 0x20, 0xD9, 0x91, 0xD9, 0xB0, 0x7E, 0x45, 0xE2, - 0xAB, 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, - 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xCF, 0x85, - 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xD7, 0xA9, - 0xD6, 0xBC, 0xD7, 0x81, 0x52, 0x46, 0xD7, 0xA9, - 0xD6, 0xBC, 0xD7, 0x82, 0x56, 0x46, 0xD9, 0x80, - // Bytes 45c0 - 45ff - 0xD9, 0x8E, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, - 0xD9, 0x8F, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, - 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x46, 0xE0, 0xA4, - 0x95, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, - 0x96, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, - 0x97, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, - 0x9C, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, - 0xA1, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, - // Bytes 4600 - 463f - 0xA2, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, - 0xAB, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, - 0xAF, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, - 0xA1, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, - 0xA2, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, - 0xAF, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, - 0x96, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, - 0x97, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, - // Bytes 4640 - 467f - 0x9C, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, - 0xAB, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, - 0xB2, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, - 0xB8, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, - 0xA1, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, - 0xA2, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xBE, - 0xB2, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE0, 0xBE, - 0xB3, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE1, 0x84, - // Bytes 4680 - 46bf - 0x80, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x82, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x83, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x85, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x86, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x87, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x89, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x8B, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - // Bytes 46c0 - 46ff - 0x8B, 0xE1, 0x85, 0xAE, 0x01, 0x46, 0xE1, 0x84, - 0x8C, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x8E, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x8F, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x90, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x91, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, - 0x92, 0xE1, 0x85, 0xA1, 0x01, 0x46, 0xE3, 0x83, - 0x86, 0xE3, 0x82, 0x99, 0x11, 0x48, 0xF0, 0x9D, - // Bytes 4700 - 473f - 0x85, 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x48, - 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, - 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, - 0x85, 0xA5, 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xBA, - 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x49, 0xE0, 0xBE, - 0xB2, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, - 0x49, 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, - 0xBE, 0x80, 0xA2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, - // Bytes 4740 - 477f - 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, - 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, - 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, - 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, - 0xF0, 0x9D, 0x85, 0xB0, 0xB2, 0x4C, 0xF0, 0x9D, - 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, - 0x85, 0xB1, 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, - 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, - // Bytes 4780 - 47bf - 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, - 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xB2, 0x4C, - 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, - 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, 0xF0, 0x9D, - 0x86, 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, - 0x85, 0xAE, 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, - 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, - 0xB2, 0x83, 0x41, 0xCC, 0x82, 0xCD, 0x83, 0x41, - // Bytes 47c0 - 47ff - 0xCC, 0x86, 0xCD, 0x83, 0x41, 0xCC, 0x87, 0xCD, - 0x83, 0x41, 0xCC, 0x88, 0xCD, 0x83, 0x41, 0xCC, - 0x8A, 0xCD, 0x83, 0x41, 0xCC, 0xA3, 0xB9, 0x83, - 0x43, 0xCC, 0xA7, 0xA9, 0x83, 0x45, 0xCC, 0x82, - 0xCD, 0x83, 0x45, 0xCC, 0x84, 0xCD, 0x83, 0x45, - 0xCC, 0xA3, 0xB9, 0x83, 0x45, 0xCC, 0xA7, 0xA9, - 0x83, 0x49, 0xCC, 0x88, 0xCD, 0x83, 0x4C, 0xCC, - 0xA3, 0xB9, 0x83, 0x4F, 0xCC, 0x82, 0xCD, 0x83, - // Bytes 4800 - 483f - 0x4F, 0xCC, 0x83, 0xCD, 0x83, 0x4F, 0xCC, 0x84, - 0xCD, 0x83, 0x4F, 0xCC, 0x87, 0xCD, 0x83, 0x4F, - 0xCC, 0x88, 0xCD, 0x83, 0x4F, 0xCC, 0x9B, 0xB1, - 0x83, 0x4F, 0xCC, 0xA3, 0xB9, 0x83, 0x4F, 0xCC, - 0xA8, 0xA9, 0x83, 0x52, 0xCC, 0xA3, 0xB9, 0x83, - 0x53, 0xCC, 0x81, 0xCD, 0x83, 0x53, 0xCC, 0x8C, - 0xCD, 0x83, 0x53, 0xCC, 0xA3, 0xB9, 0x83, 0x55, - 0xCC, 0x83, 0xCD, 0x83, 0x55, 0xCC, 0x84, 0xCD, - // Bytes 4840 - 487f - 0x83, 0x55, 0xCC, 0x88, 0xCD, 0x83, 0x55, 0xCC, - 0x9B, 0xB1, 0x83, 0x61, 0xCC, 0x82, 0xCD, 0x83, - 0x61, 0xCC, 0x86, 0xCD, 0x83, 0x61, 0xCC, 0x87, - 0xCD, 0x83, 0x61, 0xCC, 0x88, 0xCD, 0x83, 0x61, - 0xCC, 0x8A, 0xCD, 0x83, 0x61, 0xCC, 0xA3, 0xB9, - 0x83, 0x63, 0xCC, 0xA7, 0xA9, 0x83, 0x65, 0xCC, - 0x82, 0xCD, 0x83, 0x65, 0xCC, 0x84, 0xCD, 0x83, - 0x65, 0xCC, 0xA3, 0xB9, 0x83, 0x65, 0xCC, 0xA7, - // Bytes 4880 - 48bf - 0xA9, 0x83, 0x69, 0xCC, 0x88, 0xCD, 0x83, 0x6C, - 0xCC, 0xA3, 0xB9, 0x83, 0x6F, 0xCC, 0x82, 0xCD, - 0x83, 0x6F, 0xCC, 0x83, 0xCD, 0x83, 0x6F, 0xCC, - 0x84, 0xCD, 0x83, 0x6F, 0xCC, 0x87, 0xCD, 0x83, - 0x6F, 0xCC, 0x88, 0xCD, 0x83, 0x6F, 0xCC, 0x9B, - 0xB1, 0x83, 0x6F, 0xCC, 0xA3, 0xB9, 0x83, 0x6F, - 0xCC, 0xA8, 0xA9, 0x83, 0x72, 0xCC, 0xA3, 0xB9, - 0x83, 0x73, 0xCC, 0x81, 0xCD, 0x83, 0x73, 0xCC, - // Bytes 48c0 - 48ff - 0x8C, 0xCD, 0x83, 0x73, 0xCC, 0xA3, 0xB9, 0x83, - 0x75, 0xCC, 0x83, 0xCD, 0x83, 0x75, 0xCC, 0x84, - 0xCD, 0x83, 0x75, 0xCC, 0x88, 0xCD, 0x83, 0x75, - 0xCC, 0x9B, 0xB1, 0x84, 0xCE, 0x91, 0xCC, 0x93, - 0xCD, 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x84, - 0xCE, 0x95, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x95, - 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x93, - 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x84, - // Bytes 4900 - 493f - 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x99, - 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x93, - 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xCD, 0x84, - 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xA9, - 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xA9, 0xCC, 0x94, - 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x84, - 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x84, 0xCE, 0xB1, - 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x94, - // Bytes 4940 - 497f - 0xCD, 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x84, - 0xCE, 0xB5, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB5, - 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x80, - 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x84, - 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB7, - 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCD, 0x82, - 0xCD, 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x84, - 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB9, - // Bytes 4980 - 49bf - 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x93, - 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xCD, 0x84, - 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x84, 0xCF, 0x85, - 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x85, 0xCC, 0x94, - 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x84, - 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x84, 0xCF, 0x89, - 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x94, - 0xCD, 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x86, - // Bytes 49c0 - 49ff - 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, - 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, - 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, - 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, - 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, - 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, - 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, - 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, - // Bytes 4a00 - 4a3f - 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, - 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, - 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, - 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, - 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, - 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, - 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, - 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, - // Bytes 4a40 - 4a7f - 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, - 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, - 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, - 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, - 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, - 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, - 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, - 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, - // Bytes 4a80 - 4abf - 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, - 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, - 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, - 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, - 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, - 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, - 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, - 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, - // Bytes 4ac0 - 4aff - 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, - 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, - 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, - 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, - 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, 0x01, 0x86, - 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, 0x01, 0x42, - 0xCC, 0x80, 0xCD, 0x33, 0x42, 0xCC, 0x81, 0xCD, - 0x33, 0x42, 0xCC, 0x93, 0xCD, 0x33, 0x43, 0xE1, - // Bytes 4b00 - 4b3f - 0x85, 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, - 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, - 0x43, 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, - 0x85, 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, - 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, - 0x43, 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, - 0x85, 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, - 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, - // Bytes 4b40 - 4b7f - 0x43, 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, - 0x85, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, - 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, - 0x43, 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, - 0x85, 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, - 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, - 0x43, 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, - 0x85, 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, - // Bytes 4b80 - 4bbf - 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, - 0x43, 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, - 0x86, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, - 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, - 0x43, 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, - 0x86, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, - 0x01, 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCE, - 0x33, 0x43, 0xE3, 0x82, 0x99, 0x11, 0x04, 0x43, - // Bytes 4bc0 - 4bff - 0xE3, 0x82, 0x9A, 0x11, 0x04, 0x46, 0xE0, 0xBD, - 0xB1, 0xE0, 0xBD, 0xB2, 0xA2, 0x27, 0x46, 0xE0, - 0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA6, 0x27, 0x46, - 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, 0x27, - 0x00, 0x01, -} - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return nfcValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = nfcIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *nfcTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return nfcValues[c0] - } - i := nfcIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = nfcIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = nfcIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *nfcTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return nfcValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = nfcIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return nfcValues[c0] - } - i := nfcIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = nfcIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = nfcIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// nfcTrie. Total size: 10798 bytes (10.54 KiB). Checksum: 721e0f15a4524bda. -type nfcTrie struct{} - -func newNfcTrie(i int) *nfcTrie { - return &nfcTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 46: - return uint16(nfcValues[n<<6+uint32(b)]) - default: - n -= 46 - return uint16(nfcSparse.lookup(n, b)) - } -} - -// nfcValues: 48 blocks, 3072 entries, 6144 bytes -// The third block is the zero block. -var nfcValues = [3072]uint16{ - // Block 0x0, offset 0x0 - 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, - // Block 0x1, offset 0x40 - 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, - 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, - 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, - 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, - 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, - 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, - 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, - 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, - 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, - 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x2ece, 0xc1: 0x2ed3, 0xc2: 0x47b9, 0xc3: 0x2ed8, 0xc4: 0x47c8, 0xc5: 0x47cd, - 0xc6: 0xa000, 0xc7: 0x47d7, 0xc8: 0x2f41, 0xc9: 0x2f46, 0xca: 0x47dc, 0xcb: 0x2f5a, - 0xcc: 0x2fcd, 0xcd: 0x2fd2, 0xce: 0x2fd7, 0xcf: 0x47f0, 0xd1: 0x3063, - 0xd2: 0x3086, 0xd3: 0x308b, 0xd4: 0x47fa, 0xd5: 0x47ff, 0xd6: 0x480e, - 0xd8: 0xa000, 0xd9: 0x3112, 0xda: 0x3117, 0xdb: 0x311c, 0xdc: 0x4840, 0xdd: 0x3194, - 0xe0: 0x31da, 0xe1: 0x31df, 0xe2: 0x484a, 0xe3: 0x31e4, - 0xe4: 0x4859, 0xe5: 0x485e, 0xe6: 0xa000, 0xe7: 0x4868, 0xe8: 0x324d, 0xe9: 0x3252, - 0xea: 0x486d, 0xeb: 0x3266, 0xec: 0x32de, 0xed: 0x32e3, 0xee: 0x32e8, 0xef: 0x4881, - 0xf1: 0x3374, 0xf2: 0x3397, 0xf3: 0x339c, 0xf4: 0x488b, 0xf5: 0x4890, - 0xf6: 0x489f, 0xf8: 0xa000, 0xf9: 0x3428, 0xfa: 0x342d, 0xfb: 0x3432, - 0xfc: 0x48d1, 0xfd: 0x34af, 0xff: 0x34c8, - // Block 0x4, offset 0x100 - 0x100: 0x2edd, 0x101: 0x31e9, 0x102: 0x47be, 0x103: 0x484f, 0x104: 0x2efb, 0x105: 0x3207, - 0x106: 0x2f0f, 0x107: 0x321b, 0x108: 0x2f14, 0x109: 0x3220, 0x10a: 0x2f19, 0x10b: 0x3225, - 0x10c: 0x2f1e, 0x10d: 0x322a, 0x10e: 0x2f28, 0x10f: 0x3234, - 0x112: 0x47e1, 0x113: 0x4872, 0x114: 0x2f50, 0x115: 0x325c, 0x116: 0x2f55, 0x117: 0x3261, - 0x118: 0x2f73, 0x119: 0x327f, 0x11a: 0x2f64, 0x11b: 0x3270, 0x11c: 0x2f8c, 0x11d: 0x3298, - 0x11e: 0x2f96, 0x11f: 0x32a2, 0x120: 0x2f9b, 0x121: 0x32a7, 0x122: 0x2fa5, 0x123: 0x32b1, - 0x124: 0x2faa, 0x125: 0x32b6, 0x128: 0x2fdc, 0x129: 0x32ed, - 0x12a: 0x2fe1, 0x12b: 0x32f2, 0x12c: 0x2fe6, 0x12d: 0x32f7, 0x12e: 0x3009, 0x12f: 0x3315, - 0x130: 0x2feb, 0x134: 0x3013, 0x135: 0x331f, - 0x136: 0x3027, 0x137: 0x3338, 0x139: 0x3031, 0x13a: 0x3342, 0x13b: 0x303b, - 0x13c: 0x334c, 0x13d: 0x3036, 0x13e: 0x3347, - // Block 0x5, offset 0x140 - 0x143: 0x305e, 0x144: 0x336f, 0x145: 0x3077, - 0x146: 0x3388, 0x147: 0x306d, 0x148: 0x337e, - 0x14c: 0x4804, 0x14d: 0x4895, 0x14e: 0x3090, 0x14f: 0x33a1, 0x150: 0x309a, 0x151: 0x33ab, - 0x154: 0x30b8, 0x155: 0x33c9, 0x156: 0x30d1, 0x157: 0x33e2, - 0x158: 0x30c2, 0x159: 0x33d3, 0x15a: 0x4827, 0x15b: 0x48b8, 0x15c: 0x30db, 0x15d: 0x33ec, - 0x15e: 0x30ea, 0x15f: 0x33fb, 0x160: 0x482c, 0x161: 0x48bd, 0x162: 0x3103, 0x163: 0x3419, - 0x164: 0x30f4, 0x165: 0x340a, 0x168: 0x4836, 0x169: 0x48c7, - 0x16a: 0x483b, 0x16b: 0x48cc, 0x16c: 0x3121, 0x16d: 0x3437, 0x16e: 0x312b, 0x16f: 0x3441, - 0x170: 0x3130, 0x171: 0x3446, 0x172: 0x314e, 0x173: 0x3464, 0x174: 0x3171, 0x175: 0x3487, - 0x176: 0x3199, 0x177: 0x34b4, 0x178: 0x31ad, 0x179: 0x31bc, 0x17a: 0x34dc, 0x17b: 0x31c6, - 0x17c: 0x34e6, 0x17d: 0x31cb, 0x17e: 0x34eb, 0x17f: 0xa000, - // Block 0x6, offset 0x180 - 0x184: 0x8100, 0x185: 0x8100, - 0x186: 0x8100, - 0x18d: 0x2ee7, 0x18e: 0x31f3, 0x18f: 0x2ff5, 0x190: 0x3301, 0x191: 0x309f, - 0x192: 0x33b0, 0x193: 0x3135, 0x194: 0x344b, 0x195: 0x392e, 0x196: 0x3abd, 0x197: 0x3927, - 0x198: 0x3ab6, 0x199: 0x3935, 0x19a: 0x3ac4, 0x19b: 0x3920, 0x19c: 0x3aaf, - 0x19e: 0x380f, 0x19f: 0x399e, 0x1a0: 0x3808, 0x1a1: 0x3997, 0x1a2: 0x3512, 0x1a3: 0x3524, - 0x1a6: 0x2fa0, 0x1a7: 0x32ac, 0x1a8: 0x301d, 0x1a9: 0x332e, - 0x1aa: 0x481d, 0x1ab: 0x48ae, 0x1ac: 0x38ef, 0x1ad: 0x3a7e, 0x1ae: 0x3536, 0x1af: 0x353c, - 0x1b0: 0x3324, 0x1b4: 0x2f87, 0x1b5: 0x3293, - 0x1b8: 0x3059, 0x1b9: 0x336a, 0x1ba: 0x3816, 0x1bb: 0x39a5, - 0x1bc: 0x350c, 0x1bd: 0x351e, 0x1be: 0x3518, 0x1bf: 0x352a, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x2eec, 0x1c1: 0x31f8, 0x1c2: 0x2ef1, 0x1c3: 0x31fd, 0x1c4: 0x2f69, 0x1c5: 0x3275, - 0x1c6: 0x2f6e, 0x1c7: 0x327a, 0x1c8: 0x2ffa, 0x1c9: 0x3306, 0x1ca: 0x2fff, 0x1cb: 0x330b, - 0x1cc: 0x30a4, 0x1cd: 0x33b5, 0x1ce: 0x30a9, 0x1cf: 0x33ba, 0x1d0: 0x30c7, 0x1d1: 0x33d8, - 0x1d2: 0x30cc, 0x1d3: 0x33dd, 0x1d4: 0x313a, 0x1d5: 0x3450, 0x1d6: 0x313f, 0x1d7: 0x3455, - 0x1d8: 0x30e5, 0x1d9: 0x33f6, 0x1da: 0x30fe, 0x1db: 0x3414, - 0x1de: 0x2fb9, 0x1df: 0x32c5, - 0x1e6: 0x47c3, 0x1e7: 0x4854, 0x1e8: 0x47eb, 0x1e9: 0x487c, - 0x1ea: 0x38be, 0x1eb: 0x3a4d, 0x1ec: 0x389b, 0x1ed: 0x3a2a, 0x1ee: 0x4809, 0x1ef: 0x489a, - 0x1f0: 0x38b7, 0x1f1: 0x3a46, 0x1f2: 0x31a3, 0x1f3: 0x34be, - // Block 0x8, offset 0x200 - 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, - 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, - 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, - 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, - 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, - 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, - 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, - 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, - 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, - 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, - 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, - // Block 0x9, offset 0x240 - 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, - 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, - 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, - 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, - 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, - 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, - 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, - 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, - 0x274: 0x01ee, - 0x27a: 0x8100, - 0x27e: 0x0037, - // Block 0xa, offset 0x280 - 0x284: 0x8100, 0x285: 0x3500, - 0x286: 0x3548, 0x287: 0x00ce, 0x288: 0x3566, 0x289: 0x3572, 0x28a: 0x3584, - 0x28c: 0x35a2, 0x28e: 0x35b4, 0x28f: 0x35d2, 0x290: 0x3d67, 0x291: 0xa000, - 0x295: 0xa000, 0x297: 0xa000, - 0x299: 0xa000, - 0x29f: 0xa000, 0x2a1: 0xa000, - 0x2a5: 0xa000, 0x2a9: 0xa000, - 0x2aa: 0x3596, 0x2ab: 0x35c6, 0x2ac: 0x492f, 0x2ad: 0x35f6, 0x2ae: 0x4959, 0x2af: 0x3608, - 0x2b0: 0x3dcf, 0x2b1: 0xa000, 0x2b5: 0xa000, - 0x2b7: 0xa000, 0x2b9: 0xa000, - 0x2bf: 0xa000, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x3680, 0x2c1: 0x368c, 0x2c3: 0x367a, - 0x2c6: 0xa000, 0x2c7: 0x3668, - 0x2cc: 0x36bc, 0x2cd: 0x36a4, 0x2ce: 0x36ce, 0x2d0: 0xa000, - 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000, - 0x2d8: 0xa000, 0x2d9: 0x36b0, 0x2da: 0xa000, - 0x2de: 0xa000, 0x2e3: 0xa000, - 0x2e7: 0xa000, - 0x2eb: 0xa000, 0x2ed: 0xa000, - 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000, - 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x3734, 0x2fa: 0xa000, - 0x2fe: 0xa000, - // Block 0xc, offset 0x300 - 0x301: 0x3692, 0x302: 0x3716, - 0x310: 0x366e, 0x311: 0x36f2, - 0x312: 0x3674, 0x313: 0x36f8, 0x316: 0x3686, 0x317: 0x370a, - 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x3788, 0x31b: 0x378e, 0x31c: 0x3698, 0x31d: 0x371c, - 0x31e: 0x369e, 0x31f: 0x3722, 0x322: 0x36aa, 0x323: 0x372e, - 0x324: 0x36b6, 0x325: 0x373a, 0x326: 0x36c2, 0x327: 0x3746, 0x328: 0xa000, 0x329: 0xa000, - 0x32a: 0x3794, 0x32b: 0x379a, 0x32c: 0x36ec, 0x32d: 0x3770, 0x32e: 0x36c8, 0x32f: 0x374c, - 0x330: 0x36d4, 0x331: 0x3758, 0x332: 0x36da, 0x333: 0x375e, 0x334: 0x36e0, 0x335: 0x3764, - 0x338: 0x36e6, 0x339: 0x376a, - // Block 0xd, offset 0x340 - 0x351: 0x812e, - 0x352: 0x8133, 0x353: 0x8133, 0x354: 0x8133, 0x355: 0x8133, 0x356: 0x812e, 0x357: 0x8133, - 0x358: 0x8133, 0x359: 0x8133, 0x35a: 0x812f, 0x35b: 0x812e, 0x35c: 0x8133, 0x35d: 0x8133, - 0x35e: 0x8133, 0x35f: 0x8133, 0x360: 0x8133, 0x361: 0x8133, 0x362: 0x812e, 0x363: 0x812e, - 0x364: 0x812e, 0x365: 0x812e, 0x366: 0x812e, 0x367: 0x812e, 0x368: 0x8133, 0x369: 0x8133, - 0x36a: 0x812e, 0x36b: 0x8133, 0x36c: 0x8133, 0x36d: 0x812f, 0x36e: 0x8132, 0x36f: 0x8133, - 0x370: 0x8106, 0x371: 0x8107, 0x372: 0x8108, 0x373: 0x8109, 0x374: 0x810a, 0x375: 0x810b, - 0x376: 0x810c, 0x377: 0x810d, 0x378: 0x810e, 0x379: 0x810f, 0x37a: 0x810f, 0x37b: 0x8110, - 0x37c: 0x8111, 0x37d: 0x8112, 0x37f: 0x8113, - // Block 0xe, offset 0x380 - 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8117, - 0x38c: 0x8118, 0x38d: 0x8119, 0x38e: 0x811a, 0x38f: 0x811b, 0x390: 0x811c, 0x391: 0x811d, - 0x392: 0x811e, 0x393: 0x9933, 0x394: 0x9933, 0x395: 0x992e, 0x396: 0x812e, 0x397: 0x8133, - 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x8133, 0x39b: 0x8133, 0x39c: 0x812e, 0x39d: 0x8133, - 0x39e: 0x8133, 0x39f: 0x812e, - 0x3b0: 0x811f, - // Block 0xf, offset 0x3c0 - 0x3ca: 0x8133, 0x3cb: 0x8133, - 0x3cc: 0x8133, 0x3cd: 0x8133, 0x3ce: 0x8133, 0x3cf: 0x812e, 0x3d0: 0x812e, 0x3d1: 0x812e, - 0x3d2: 0x812e, 0x3d3: 0x812e, 0x3d4: 0x8133, 0x3d5: 0x8133, 0x3d6: 0x8133, 0x3d7: 0x8133, - 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x8133, 0x3dd: 0x8133, - 0x3de: 0x8133, 0x3df: 0x8133, 0x3e0: 0x8133, 0x3e1: 0x8133, 0x3e3: 0x812e, - 0x3e4: 0x8133, 0x3e5: 0x8133, 0x3e6: 0x812e, 0x3e7: 0x8133, 0x3e8: 0x8133, 0x3e9: 0x812e, - 0x3ea: 0x8133, 0x3eb: 0x8133, 0x3ec: 0x8133, 0x3ed: 0x812e, 0x3ee: 0x812e, 0x3ef: 0x812e, - 0x3f0: 0x8117, 0x3f1: 0x8118, 0x3f2: 0x8119, 0x3f3: 0x8133, 0x3f4: 0x8133, 0x3f5: 0x8133, - 0x3f6: 0x812e, 0x3f7: 0x8133, 0x3f8: 0x8133, 0x3f9: 0x812e, 0x3fa: 0x812e, 0x3fb: 0x8133, - 0x3fc: 0x8133, 0x3fd: 0x8133, 0x3fe: 0x8133, 0x3ff: 0x8133, - // Block 0x10, offset 0x400 - 0x405: 0xa000, - 0x406: 0x3ee7, 0x407: 0xa000, 0x408: 0x3eef, 0x409: 0xa000, 0x40a: 0x3ef7, 0x40b: 0xa000, - 0x40c: 0x3eff, 0x40d: 0xa000, 0x40e: 0x3f07, 0x411: 0xa000, - 0x412: 0x3f0f, - 0x434: 0x8103, 0x435: 0x9900, - 0x43a: 0xa000, 0x43b: 0x3f17, - 0x43c: 0xa000, 0x43d: 0x3f1f, 0x43e: 0xa000, 0x43f: 0xa000, - // Block 0x11, offset 0x440 - 0x440: 0x8133, 0x441: 0x8133, 0x442: 0x812e, 0x443: 0x8133, 0x444: 0x8133, 0x445: 0x8133, - 0x446: 0x8133, 0x447: 0x8133, 0x448: 0x8133, 0x449: 0x8133, 0x44a: 0x812e, 0x44b: 0x8133, - 0x44c: 0x8133, 0x44d: 0x8136, 0x44e: 0x812b, 0x44f: 0x812e, 0x450: 0x812a, 0x451: 0x8133, - 0x452: 0x8133, 0x453: 0x8133, 0x454: 0x8133, 0x455: 0x8133, 0x456: 0x8133, 0x457: 0x8133, - 0x458: 0x8133, 0x459: 0x8133, 0x45a: 0x8133, 0x45b: 0x8133, 0x45c: 0x8133, 0x45d: 0x8133, - 0x45e: 0x8133, 0x45f: 0x8133, 0x460: 0x8133, 0x461: 0x8133, 0x462: 0x8133, 0x463: 0x8133, - 0x464: 0x8133, 0x465: 0x8133, 0x466: 0x8133, 0x467: 0x8133, 0x468: 0x8133, 0x469: 0x8133, - 0x46a: 0x8133, 0x46b: 0x8133, 0x46c: 0x8133, 0x46d: 0x8133, 0x46e: 0x8133, 0x46f: 0x8133, - 0x470: 0x8133, 0x471: 0x8133, 0x472: 0x8133, 0x473: 0x8133, 0x474: 0x8133, 0x475: 0x8133, - 0x476: 0x8134, 0x477: 0x8132, 0x478: 0x8132, 0x479: 0x812e, 0x47a: 0x812d, 0x47b: 0x8133, - 0x47c: 0x8135, 0x47d: 0x812e, 0x47e: 0x8133, 0x47f: 0x812e, - // Block 0x12, offset 0x480 - 0x480: 0x2ef6, 0x481: 0x3202, 0x482: 0x2f00, 0x483: 0x320c, 0x484: 0x2f05, 0x485: 0x3211, - 0x486: 0x2f0a, 0x487: 0x3216, 0x488: 0x382b, 0x489: 0x39ba, 0x48a: 0x2f23, 0x48b: 0x322f, - 0x48c: 0x2f2d, 0x48d: 0x3239, 0x48e: 0x2f3c, 0x48f: 0x3248, 0x490: 0x2f32, 0x491: 0x323e, - 0x492: 0x2f37, 0x493: 0x3243, 0x494: 0x384e, 0x495: 0x39dd, 0x496: 0x3855, 0x497: 0x39e4, - 0x498: 0x2f78, 0x499: 0x3284, 0x49a: 0x2f7d, 0x49b: 0x3289, 0x49c: 0x3863, 0x49d: 0x39f2, - 0x49e: 0x2f82, 0x49f: 0x328e, 0x4a0: 0x2f91, 0x4a1: 0x329d, 0x4a2: 0x2faf, 0x4a3: 0x32bb, - 0x4a4: 0x2fbe, 0x4a5: 0x32ca, 0x4a6: 0x2fb4, 0x4a7: 0x32c0, 0x4a8: 0x2fc3, 0x4a9: 0x32cf, - 0x4aa: 0x2fc8, 0x4ab: 0x32d4, 0x4ac: 0x300e, 0x4ad: 0x331a, 0x4ae: 0x386a, 0x4af: 0x39f9, - 0x4b0: 0x3018, 0x4b1: 0x3329, 0x4b2: 0x3022, 0x4b3: 0x3333, 0x4b4: 0x302c, 0x4b5: 0x333d, - 0x4b6: 0x47f5, 0x4b7: 0x4886, 0x4b8: 0x3871, 0x4b9: 0x3a00, 0x4ba: 0x3045, 0x4bb: 0x3356, - 0x4bc: 0x3040, 0x4bd: 0x3351, 0x4be: 0x304a, 0x4bf: 0x335b, - // Block 0x13, offset 0x4c0 - 0x4c0: 0x304f, 0x4c1: 0x3360, 0x4c2: 0x3054, 0x4c3: 0x3365, 0x4c4: 0x3068, 0x4c5: 0x3379, - 0x4c6: 0x3072, 0x4c7: 0x3383, 0x4c8: 0x3081, 0x4c9: 0x3392, 0x4ca: 0x307c, 0x4cb: 0x338d, - 0x4cc: 0x3894, 0x4cd: 0x3a23, 0x4ce: 0x38a2, 0x4cf: 0x3a31, 0x4d0: 0x38a9, 0x4d1: 0x3a38, - 0x4d2: 0x38b0, 0x4d3: 0x3a3f, 0x4d4: 0x30ae, 0x4d5: 0x33bf, 0x4d6: 0x30b3, 0x4d7: 0x33c4, - 0x4d8: 0x30bd, 0x4d9: 0x33ce, 0x4da: 0x4822, 0x4db: 0x48b3, 0x4dc: 0x38f6, 0x4dd: 0x3a85, - 0x4de: 0x30d6, 0x4df: 0x33e7, 0x4e0: 0x30e0, 0x4e1: 0x33f1, 0x4e2: 0x4831, 0x4e3: 0x48c2, - 0x4e4: 0x38fd, 0x4e5: 0x3a8c, 0x4e6: 0x3904, 0x4e7: 0x3a93, 0x4e8: 0x390b, 0x4e9: 0x3a9a, - 0x4ea: 0x30ef, 0x4eb: 0x3400, 0x4ec: 0x30f9, 0x4ed: 0x340f, 0x4ee: 0x310d, 0x4ef: 0x3423, - 0x4f0: 0x3108, 0x4f1: 0x341e, 0x4f2: 0x3149, 0x4f3: 0x345f, 0x4f4: 0x3158, 0x4f5: 0x346e, - 0x4f6: 0x3153, 0x4f7: 0x3469, 0x4f8: 0x3912, 0x4f9: 0x3aa1, 0x4fa: 0x3919, 0x4fb: 0x3aa8, - 0x4fc: 0x315d, 0x4fd: 0x3473, 0x4fe: 0x3162, 0x4ff: 0x3478, - // Block 0x14, offset 0x500 - 0x500: 0x3167, 0x501: 0x347d, 0x502: 0x316c, 0x503: 0x3482, 0x504: 0x317b, 0x505: 0x3491, - 0x506: 0x3176, 0x507: 0x348c, 0x508: 0x3180, 0x509: 0x349b, 0x50a: 0x3185, 0x50b: 0x34a0, - 0x50c: 0x318a, 0x50d: 0x34a5, 0x50e: 0x31a8, 0x50f: 0x34c3, 0x510: 0x31c1, 0x511: 0x34e1, - 0x512: 0x31d0, 0x513: 0x34f0, 0x514: 0x31d5, 0x515: 0x34f5, 0x516: 0x32d9, 0x517: 0x3405, - 0x518: 0x3496, 0x519: 0x34d2, 0x51b: 0x3530, - 0x520: 0x47d2, 0x521: 0x4863, 0x522: 0x2ee2, 0x523: 0x31ee, - 0x524: 0x37d7, 0x525: 0x3966, 0x526: 0x37d0, 0x527: 0x395f, 0x528: 0x37e5, 0x529: 0x3974, - 0x52a: 0x37de, 0x52b: 0x396d, 0x52c: 0x381d, 0x52d: 0x39ac, 0x52e: 0x37f3, 0x52f: 0x3982, - 0x530: 0x37ec, 0x531: 0x397b, 0x532: 0x3801, 0x533: 0x3990, 0x534: 0x37fa, 0x535: 0x3989, - 0x536: 0x3824, 0x537: 0x39b3, 0x538: 0x47e6, 0x539: 0x4877, 0x53a: 0x2f5f, 0x53b: 0x326b, - 0x53c: 0x2f4b, 0x53d: 0x3257, 0x53e: 0x3839, 0x53f: 0x39c8, - // Block 0x15, offset 0x540 - 0x540: 0x3832, 0x541: 0x39c1, 0x542: 0x3847, 0x543: 0x39d6, 0x544: 0x3840, 0x545: 0x39cf, - 0x546: 0x385c, 0x547: 0x39eb, 0x548: 0x2ff0, 0x549: 0x32fc, 0x54a: 0x3004, 0x54b: 0x3310, - 0x54c: 0x4818, 0x54d: 0x48a9, 0x54e: 0x3095, 0x54f: 0x33a6, 0x550: 0x387f, 0x551: 0x3a0e, - 0x552: 0x3878, 0x553: 0x3a07, 0x554: 0x388d, 0x555: 0x3a1c, 0x556: 0x3886, 0x557: 0x3a15, - 0x558: 0x38e8, 0x559: 0x3a77, 0x55a: 0x38cc, 0x55b: 0x3a5b, 0x55c: 0x38c5, 0x55d: 0x3a54, - 0x55e: 0x38da, 0x55f: 0x3a69, 0x560: 0x38d3, 0x561: 0x3a62, 0x562: 0x38e1, 0x563: 0x3a70, - 0x564: 0x3144, 0x565: 0x345a, 0x566: 0x3126, 0x567: 0x343c, 0x568: 0x3943, 0x569: 0x3ad2, - 0x56a: 0x393c, 0x56b: 0x3acb, 0x56c: 0x3951, 0x56d: 0x3ae0, 0x56e: 0x394a, 0x56f: 0x3ad9, - 0x570: 0x3958, 0x571: 0x3ae7, 0x572: 0x318f, 0x573: 0x34aa, 0x574: 0x31b7, 0x575: 0x34d7, - 0x576: 0x31b2, 0x577: 0x34cd, 0x578: 0x319e, 0x579: 0x34b9, - // Block 0x16, offset 0x580 - 0x580: 0x4935, 0x581: 0x493b, 0x582: 0x4a4f, 0x583: 0x4a67, 0x584: 0x4a57, 0x585: 0x4a6f, - 0x586: 0x4a5f, 0x587: 0x4a77, 0x588: 0x48db, 0x589: 0x48e1, 0x58a: 0x49bf, 0x58b: 0x49d7, - 0x58c: 0x49c7, 0x58d: 0x49df, 0x58e: 0x49cf, 0x58f: 0x49e7, 0x590: 0x4947, 0x591: 0x494d, - 0x592: 0x3d17, 0x593: 0x3d27, 0x594: 0x3d1f, 0x595: 0x3d2f, - 0x598: 0x48e7, 0x599: 0x48ed, 0x59a: 0x3c47, 0x59b: 0x3c57, 0x59c: 0x3c4f, 0x59d: 0x3c5f, - 0x5a0: 0x495f, 0x5a1: 0x4965, 0x5a2: 0x4a7f, 0x5a3: 0x4a97, - 0x5a4: 0x4a87, 0x5a5: 0x4a9f, 0x5a6: 0x4a8f, 0x5a7: 0x4aa7, 0x5a8: 0x48f3, 0x5a9: 0x48f9, - 0x5aa: 0x49ef, 0x5ab: 0x4a07, 0x5ac: 0x49f7, 0x5ad: 0x4a0f, 0x5ae: 0x49ff, 0x5af: 0x4a17, - 0x5b0: 0x4977, 0x5b1: 0x497d, 0x5b2: 0x3d77, 0x5b3: 0x3d8f, 0x5b4: 0x3d7f, 0x5b5: 0x3d97, - 0x5b6: 0x3d87, 0x5b7: 0x3d9f, 0x5b8: 0x48ff, 0x5b9: 0x4905, 0x5ba: 0x3c77, 0x5bb: 0x3c8f, - 0x5bc: 0x3c7f, 0x5bd: 0x3c97, 0x5be: 0x3c87, 0x5bf: 0x3c9f, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x4983, 0x5c1: 0x4989, 0x5c2: 0x3da7, 0x5c3: 0x3db7, 0x5c4: 0x3daf, 0x5c5: 0x3dbf, - 0x5c8: 0x490b, 0x5c9: 0x4911, 0x5ca: 0x3ca7, 0x5cb: 0x3cb7, - 0x5cc: 0x3caf, 0x5cd: 0x3cbf, 0x5d0: 0x4995, 0x5d1: 0x499b, - 0x5d2: 0x3ddf, 0x5d3: 0x3df7, 0x5d4: 0x3de7, 0x5d5: 0x3dff, 0x5d6: 0x3def, 0x5d7: 0x3e07, - 0x5d9: 0x4917, 0x5db: 0x3cc7, 0x5dd: 0x3ccf, - 0x5df: 0x3cd7, 0x5e0: 0x49ad, 0x5e1: 0x49b3, 0x5e2: 0x4aaf, 0x5e3: 0x4ac7, - 0x5e4: 0x4ab7, 0x5e5: 0x4acf, 0x5e6: 0x4abf, 0x5e7: 0x4ad7, 0x5e8: 0x491d, 0x5e9: 0x4923, - 0x5ea: 0x4a1f, 0x5eb: 0x4a37, 0x5ec: 0x4a27, 0x5ed: 0x4a3f, 0x5ee: 0x4a2f, 0x5ef: 0x4a47, - 0x5f0: 0x4929, 0x5f1: 0x43d7, 0x5f2: 0x35f0, 0x5f3: 0x43dd, 0x5f4: 0x4953, 0x5f5: 0x43e3, - 0x5f6: 0x3602, 0x5f7: 0x43e9, 0x5f8: 0x3620, 0x5f9: 0x43ef, 0x5fa: 0x3638, 0x5fb: 0x43f5, - 0x5fc: 0x49a1, 0x5fd: 0x43fb, - // Block 0x18, offset 0x600 - 0x600: 0x3cff, 0x601: 0x3d07, 0x602: 0x41c3, 0x603: 0x41e1, 0x604: 0x41cd, 0x605: 0x41eb, - 0x606: 0x41d7, 0x607: 0x41f5, 0x608: 0x3c37, 0x609: 0x3c3f, 0x60a: 0x410f, 0x60b: 0x412d, - 0x60c: 0x4119, 0x60d: 0x4137, 0x60e: 0x4123, 0x60f: 0x4141, 0x610: 0x3d47, 0x611: 0x3d4f, - 0x612: 0x41ff, 0x613: 0x421d, 0x614: 0x4209, 0x615: 0x4227, 0x616: 0x4213, 0x617: 0x4231, - 0x618: 0x3c67, 0x619: 0x3c6f, 0x61a: 0x414b, 0x61b: 0x4169, 0x61c: 0x4155, 0x61d: 0x4173, - 0x61e: 0x415f, 0x61f: 0x417d, 0x620: 0x3e1f, 0x621: 0x3e27, 0x622: 0x423b, 0x623: 0x4259, - 0x624: 0x4245, 0x625: 0x4263, 0x626: 0x424f, 0x627: 0x426d, 0x628: 0x3cdf, 0x629: 0x3ce7, - 0x62a: 0x4187, 0x62b: 0x41a5, 0x62c: 0x4191, 0x62d: 0x41af, 0x62e: 0x419b, 0x62f: 0x41b9, - 0x630: 0x35e4, 0x631: 0x35de, 0x632: 0x3cef, 0x633: 0x35ea, 0x634: 0x3cf7, - 0x636: 0x4941, 0x637: 0x3d0f, 0x638: 0x3554, 0x639: 0x354e, 0x63a: 0x3542, 0x63b: 0x43a7, - 0x63c: 0x355a, 0x63d: 0x8100, 0x63e: 0x0257, 0x63f: 0xa100, - // Block 0x19, offset 0x640 - 0x640: 0x8100, 0x641: 0x3506, 0x642: 0x3d37, 0x643: 0x35fc, 0x644: 0x3d3f, - 0x646: 0x496b, 0x647: 0x3d57, 0x648: 0x3560, 0x649: 0x43ad, 0x64a: 0x356c, 0x64b: 0x43b3, - 0x64c: 0x3578, 0x64d: 0x3aee, 0x64e: 0x3af5, 0x64f: 0x3afc, 0x650: 0x3614, 0x651: 0x360e, - 0x652: 0x3d5f, 0x653: 0x459d, 0x656: 0x361a, 0x657: 0x3d6f, - 0x658: 0x3590, 0x659: 0x358a, 0x65a: 0x357e, 0x65b: 0x43b9, 0x65d: 0x3b03, - 0x65e: 0x3b0a, 0x65f: 0x3b11, 0x660: 0x364a, 0x661: 0x3644, 0x662: 0x3dc7, 0x663: 0x45a5, - 0x664: 0x362c, 0x665: 0x3632, 0x666: 0x3650, 0x667: 0x3dd7, 0x668: 0x35c0, 0x669: 0x35ba, - 0x66a: 0x35ae, 0x66b: 0x43c5, 0x66c: 0x35a8, 0x66d: 0x34fa, 0x66e: 0x43a1, 0x66f: 0x0081, - 0x672: 0x3e0f, 0x673: 0x3656, 0x674: 0x3e17, - 0x676: 0x49b9, 0x677: 0x3e2f, 0x678: 0x359c, 0x679: 0x43bf, 0x67a: 0x35cc, 0x67b: 0x43d1, - 0x67c: 0x35d8, 0x67d: 0x430f, 0x67e: 0xa100, - // Block 0x1a, offset 0x680 - 0x681: 0x3b65, 0x683: 0xa000, 0x684: 0x3b6c, 0x685: 0xa000, - 0x687: 0x3b73, 0x688: 0xa000, 0x689: 0x3b7a, - 0x68d: 0xa000, - 0x6a0: 0x2ec4, 0x6a1: 0xa000, 0x6a2: 0x3b88, - 0x6a4: 0xa000, 0x6a5: 0xa000, - 0x6ad: 0x3b81, 0x6ae: 0x2ebf, 0x6af: 0x2ec9, - 0x6b0: 0x3b8f, 0x6b1: 0x3b96, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3b9d, 0x6b5: 0x3ba4, - 0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3bab, 0x6b9: 0x3bb2, 0x6ba: 0xa000, 0x6bb: 0xa000, - 0x6bc: 0xa000, 0x6bd: 0xa000, - // Block 0x1b, offset 0x6c0 - 0x6c0: 0x3bb9, 0x6c1: 0x3bc0, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3bd5, 0x6c5: 0x3bdc, - 0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3be3, 0x6c9: 0x3bea, - 0x6d1: 0xa000, - 0x6d2: 0xa000, - 0x6e2: 0xa000, - 0x6e8: 0xa000, 0x6e9: 0xa000, - 0x6eb: 0xa000, 0x6ec: 0x3bff, 0x6ed: 0x3c06, 0x6ee: 0x3c0d, 0x6ef: 0x3c14, - 0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000, - // Block 0x1c, offset 0x700 - 0x706: 0xa000, 0x70b: 0xa000, - 0x70c: 0x3f47, 0x70d: 0xa000, 0x70e: 0x3f4f, 0x70f: 0xa000, 0x710: 0x3f57, 0x711: 0xa000, - 0x712: 0x3f5f, 0x713: 0xa000, 0x714: 0x3f67, 0x715: 0xa000, 0x716: 0x3f6f, 0x717: 0xa000, - 0x718: 0x3f77, 0x719: 0xa000, 0x71a: 0x3f7f, 0x71b: 0xa000, 0x71c: 0x3f87, 0x71d: 0xa000, - 0x71e: 0x3f8f, 0x71f: 0xa000, 0x720: 0x3f97, 0x721: 0xa000, 0x722: 0x3f9f, - 0x724: 0xa000, 0x725: 0x3fa7, 0x726: 0xa000, 0x727: 0x3faf, 0x728: 0xa000, 0x729: 0x3fb7, - 0x72f: 0xa000, - 0x730: 0x3fbf, 0x731: 0x3fc7, 0x732: 0xa000, 0x733: 0x3fcf, 0x734: 0x3fd7, 0x735: 0xa000, - 0x736: 0x3fdf, 0x737: 0x3fe7, 0x738: 0xa000, 0x739: 0x3fef, 0x73a: 0x3ff7, 0x73b: 0xa000, - 0x73c: 0x3fff, 0x73d: 0x4007, - // Block 0x1d, offset 0x740 - 0x754: 0x3f3f, - 0x759: 0x9904, 0x75a: 0x9904, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000, - 0x75e: 0x400f, - 0x766: 0xa000, - 0x76b: 0xa000, 0x76c: 0x401f, 0x76d: 0xa000, 0x76e: 0x4027, 0x76f: 0xa000, - 0x770: 0x402f, 0x771: 0xa000, 0x772: 0x4037, 0x773: 0xa000, 0x774: 0x403f, 0x775: 0xa000, - 0x776: 0x4047, 0x777: 0xa000, 0x778: 0x404f, 0x779: 0xa000, 0x77a: 0x4057, 0x77b: 0xa000, - 0x77c: 0x405f, 0x77d: 0xa000, 0x77e: 0x4067, 0x77f: 0xa000, - // Block 0x1e, offset 0x780 - 0x780: 0x406f, 0x781: 0xa000, 0x782: 0x4077, 0x784: 0xa000, 0x785: 0x407f, - 0x786: 0xa000, 0x787: 0x4087, 0x788: 0xa000, 0x789: 0x408f, - 0x78f: 0xa000, 0x790: 0x4097, 0x791: 0x409f, - 0x792: 0xa000, 0x793: 0x40a7, 0x794: 0x40af, 0x795: 0xa000, 0x796: 0x40b7, 0x797: 0x40bf, - 0x798: 0xa000, 0x799: 0x40c7, 0x79a: 0x40cf, 0x79b: 0xa000, 0x79c: 0x40d7, 0x79d: 0x40df, - 0x7af: 0xa000, - 0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x4017, - 0x7b7: 0x40e7, 0x7b8: 0x40ef, 0x7b9: 0x40f7, 0x7ba: 0x40ff, - 0x7bd: 0xa000, 0x7be: 0x4107, - // Block 0x1f, offset 0x7c0 - 0x7c0: 0x1472, 0x7c1: 0x0df6, 0x7c2: 0x14ce, 0x7c3: 0x149a, 0x7c4: 0x0f52, 0x7c5: 0x07e6, - 0x7c6: 0x09da, 0x7c7: 0x1726, 0x7c8: 0x1726, 0x7c9: 0x0b06, 0x7ca: 0x155a, 0x7cb: 0x0a3e, - 0x7cc: 0x0b02, 0x7cd: 0x0cea, 0x7ce: 0x10ca, 0x7cf: 0x125a, 0x7d0: 0x1392, 0x7d1: 0x13ce, - 0x7d2: 0x1402, 0x7d3: 0x1516, 0x7d4: 0x0e6e, 0x7d5: 0x0efa, 0x7d6: 0x0fa6, 0x7d7: 0x103e, - 0x7d8: 0x135a, 0x7d9: 0x1542, 0x7da: 0x166e, 0x7db: 0x080a, 0x7dc: 0x09ae, 0x7dd: 0x0e82, - 0x7de: 0x0fca, 0x7df: 0x138e, 0x7e0: 0x16be, 0x7e1: 0x0bae, 0x7e2: 0x0f72, 0x7e3: 0x137e, - 0x7e4: 0x1412, 0x7e5: 0x0d1e, 0x7e6: 0x12b6, 0x7e7: 0x13da, 0x7e8: 0x0c1a, 0x7e9: 0x0e0a, - 0x7ea: 0x0f12, 0x7eb: 0x1016, 0x7ec: 0x1522, 0x7ed: 0x084a, 0x7ee: 0x08e2, 0x7ef: 0x094e, - 0x7f0: 0x0d86, 0x7f1: 0x0e7a, 0x7f2: 0x0fc6, 0x7f3: 0x10ea, 0x7f4: 0x1272, 0x7f5: 0x1386, - 0x7f6: 0x139e, 0x7f7: 0x14c2, 0x7f8: 0x15ea, 0x7f9: 0x169e, 0x7fa: 0x16ba, 0x7fb: 0x1126, - 0x7fc: 0x1166, 0x7fd: 0x121e, 0x7fe: 0x133e, 0x7ff: 0x1576, - // Block 0x20, offset 0x800 - 0x800: 0x16c6, 0x801: 0x1446, 0x802: 0x0ac2, 0x803: 0x0c36, 0x804: 0x11d6, 0x805: 0x1296, - 0x806: 0x0ffa, 0x807: 0x112e, 0x808: 0x1492, 0x809: 0x15e2, 0x80a: 0x0abe, 0x80b: 0x0b8a, - 0x80c: 0x0e72, 0x80d: 0x0f26, 0x80e: 0x0f5a, 0x80f: 0x120e, 0x810: 0x1236, 0x811: 0x15a2, - 0x812: 0x094a, 0x813: 0x12a2, 0x814: 0x08ee, 0x815: 0x08ea, 0x816: 0x1192, 0x817: 0x1222, - 0x818: 0x1356, 0x819: 0x15aa, 0x81a: 0x1462, 0x81b: 0x0d22, 0x81c: 0x0e6e, 0x81d: 0x1452, - 0x81e: 0x07f2, 0x81f: 0x0b5e, 0x820: 0x0c8e, 0x821: 0x102a, 0x822: 0x10aa, 0x823: 0x096e, - 0x824: 0x1136, 0x825: 0x085a, 0x826: 0x0c72, 0x827: 0x07d2, 0x828: 0x0ee6, 0x829: 0x0d9e, - 0x82a: 0x120a, 0x82b: 0x09c2, 0x82c: 0x0aae, 0x82d: 0x10f6, 0x82e: 0x135e, 0x82f: 0x1436, - 0x830: 0x0eb2, 0x831: 0x14f2, 0x832: 0x0ede, 0x833: 0x0d32, 0x834: 0x1316, 0x835: 0x0d52, - 0x836: 0x10a6, 0x837: 0x0826, 0x838: 0x08a2, 0x839: 0x08e6, 0x83a: 0x0e4e, 0x83b: 0x11f6, - 0x83c: 0x12ee, 0x83d: 0x1442, 0x83e: 0x1556, 0x83f: 0x0956, - // Block 0x21, offset 0x840 - 0x840: 0x0a0a, 0x841: 0x0b12, 0x842: 0x0c2a, 0x843: 0x0dba, 0x844: 0x0f76, 0x845: 0x113a, - 0x846: 0x1592, 0x847: 0x1676, 0x848: 0x16ca, 0x849: 0x16e2, 0x84a: 0x0932, 0x84b: 0x0dee, - 0x84c: 0x0e9e, 0x84d: 0x14e6, 0x84e: 0x0bf6, 0x84f: 0x0cd2, 0x850: 0x0cee, 0x851: 0x0d7e, - 0x852: 0x0f66, 0x853: 0x0fb2, 0x854: 0x1062, 0x855: 0x1186, 0x856: 0x122a, 0x857: 0x128e, - 0x858: 0x14d6, 0x859: 0x1366, 0x85a: 0x14fe, 0x85b: 0x157a, 0x85c: 0x090a, 0x85d: 0x0936, - 0x85e: 0x0a1e, 0x85f: 0x0fa2, 0x860: 0x13ee, 0x861: 0x1436, 0x862: 0x0c16, 0x863: 0x0c86, - 0x864: 0x0d4a, 0x865: 0x0eaa, 0x866: 0x11d2, 0x867: 0x101e, 0x868: 0x0836, 0x869: 0x0a7a, - 0x86a: 0x0b5e, 0x86b: 0x0bc2, 0x86c: 0x0c92, 0x86d: 0x103a, 0x86e: 0x1056, 0x86f: 0x1266, - 0x870: 0x1286, 0x871: 0x155e, 0x872: 0x15de, 0x873: 0x15ee, 0x874: 0x162a, 0x875: 0x084e, - 0x876: 0x117a, 0x877: 0x154a, 0x878: 0x15c6, 0x879: 0x0caa, 0x87a: 0x0812, 0x87b: 0x0872, - 0x87c: 0x0b62, 0x87d: 0x0b82, 0x87e: 0x0daa, 0x87f: 0x0e6e, - // Block 0x22, offset 0x880 - 0x880: 0x0fbe, 0x881: 0x10c6, 0x882: 0x1372, 0x883: 0x1512, 0x884: 0x171e, 0x885: 0x0dde, - 0x886: 0x159e, 0x887: 0x092e, 0x888: 0x0e2a, 0x889: 0x0e36, 0x88a: 0x0f0a, 0x88b: 0x0f42, - 0x88c: 0x1046, 0x88d: 0x10a2, 0x88e: 0x1122, 0x88f: 0x1206, 0x890: 0x1636, 0x891: 0x08aa, - 0x892: 0x0cfe, 0x893: 0x15ae, 0x894: 0x0862, 0x895: 0x0ba6, 0x896: 0x0f2a, 0x897: 0x14da, - 0x898: 0x0c62, 0x899: 0x0cb2, 0x89a: 0x0e3e, 0x89b: 0x102a, 0x89c: 0x15b6, 0x89d: 0x0912, - 0x89e: 0x09fa, 0x89f: 0x0b92, 0x8a0: 0x0dce, 0x8a1: 0x0e1a, 0x8a2: 0x0e5a, 0x8a3: 0x0eee, - 0x8a4: 0x1042, 0x8a5: 0x10b6, 0x8a6: 0x1252, 0x8a7: 0x13f2, 0x8a8: 0x13fe, 0x8a9: 0x1552, - 0x8aa: 0x15d2, 0x8ab: 0x097e, 0x8ac: 0x0f46, 0x8ad: 0x09fe, 0x8ae: 0x0fc2, 0x8af: 0x1066, - 0x8b0: 0x1382, 0x8b1: 0x15ba, 0x8b2: 0x16a6, 0x8b3: 0x16ce, 0x8b4: 0x0e32, 0x8b5: 0x0f22, - 0x8b6: 0x12be, 0x8b7: 0x11b2, 0x8b8: 0x11be, 0x8b9: 0x11e2, 0x8ba: 0x1012, 0x8bb: 0x0f9a, - 0x8bc: 0x145e, 0x8bd: 0x082e, 0x8be: 0x1326, 0x8bf: 0x0916, - // Block 0x23, offset 0x8c0 - 0x8c0: 0x0906, 0x8c1: 0x0c06, 0x8c2: 0x0d26, 0x8c3: 0x11ee, 0x8c4: 0x0b4e, 0x8c5: 0x0efe, - 0x8c6: 0x0dea, 0x8c7: 0x14e2, 0x8c8: 0x13e2, 0x8c9: 0x15a6, 0x8ca: 0x141e, 0x8cb: 0x0c22, - 0x8cc: 0x0882, 0x8cd: 0x0a56, 0x8d0: 0x0aaa, - 0x8d2: 0x0dda, 0x8d5: 0x08f2, 0x8d6: 0x101a, 0x8d7: 0x10de, - 0x8d8: 0x1142, 0x8d9: 0x115e, 0x8da: 0x1162, 0x8db: 0x1176, 0x8dc: 0x15f6, 0x8dd: 0x11e6, - 0x8de: 0x126a, 0x8e0: 0x138a, 0x8e2: 0x144e, - 0x8e5: 0x1502, 0x8e6: 0x152e, - 0x8ea: 0x164a, 0x8eb: 0x164e, 0x8ec: 0x1652, 0x8ed: 0x16b6, 0x8ee: 0x1526, 0x8ef: 0x15c2, - 0x8f0: 0x0852, 0x8f1: 0x0876, 0x8f2: 0x088a, 0x8f3: 0x0946, 0x8f4: 0x0952, 0x8f5: 0x0992, - 0x8f6: 0x0a46, 0x8f7: 0x0a62, 0x8f8: 0x0a6a, 0x8f9: 0x0aa6, 0x8fa: 0x0ab2, 0x8fb: 0x0b8e, - 0x8fc: 0x0b96, 0x8fd: 0x0c9e, 0x8fe: 0x0cc6, 0x8ff: 0x0cce, - // Block 0x24, offset 0x900 - 0x900: 0x0ce6, 0x901: 0x0d92, 0x902: 0x0dc2, 0x903: 0x0de2, 0x904: 0x0e52, 0x905: 0x0f16, - 0x906: 0x0f32, 0x907: 0x0f62, 0x908: 0x0fb6, 0x909: 0x0fd6, 0x90a: 0x104a, 0x90b: 0x112a, - 0x90c: 0x1146, 0x90d: 0x114e, 0x90e: 0x114a, 0x90f: 0x1152, 0x910: 0x1156, 0x911: 0x115a, - 0x912: 0x116e, 0x913: 0x1172, 0x914: 0x1196, 0x915: 0x11aa, 0x916: 0x11c6, 0x917: 0x122a, - 0x918: 0x1232, 0x919: 0x123a, 0x91a: 0x124e, 0x91b: 0x1276, 0x91c: 0x12c6, 0x91d: 0x12fa, - 0x91e: 0x12fa, 0x91f: 0x1362, 0x920: 0x140a, 0x921: 0x1422, 0x922: 0x1456, 0x923: 0x145a, - 0x924: 0x149e, 0x925: 0x14a2, 0x926: 0x14fa, 0x927: 0x1502, 0x928: 0x15d6, 0x929: 0x161a, - 0x92a: 0x1632, 0x92b: 0x0c96, 0x92c: 0x184b, 0x92d: 0x12de, - 0x930: 0x07da, 0x931: 0x08de, 0x932: 0x089e, 0x933: 0x0846, 0x934: 0x0886, 0x935: 0x08b2, - 0x936: 0x0942, 0x937: 0x095e, 0x938: 0x0a46, 0x939: 0x0a32, 0x93a: 0x0a42, 0x93b: 0x0a5e, - 0x93c: 0x0aaa, 0x93d: 0x0aba, 0x93e: 0x0afe, 0x93f: 0x0b0a, - // Block 0x25, offset 0x940 - 0x940: 0x0b26, 0x941: 0x0b36, 0x942: 0x0c1e, 0x943: 0x0c26, 0x944: 0x0c56, 0x945: 0x0c76, - 0x946: 0x0ca6, 0x947: 0x0cbe, 0x948: 0x0cae, 0x949: 0x0cce, 0x94a: 0x0cc2, 0x94b: 0x0ce6, - 0x94c: 0x0d02, 0x94d: 0x0d5a, 0x94e: 0x0d66, 0x94f: 0x0d6e, 0x950: 0x0d96, 0x951: 0x0dda, - 0x952: 0x0e0a, 0x953: 0x0e0e, 0x954: 0x0e22, 0x955: 0x0ea2, 0x956: 0x0eb2, 0x957: 0x0f0a, - 0x958: 0x0f56, 0x959: 0x0f4e, 0x95a: 0x0f62, 0x95b: 0x0f7e, 0x95c: 0x0fb6, 0x95d: 0x110e, - 0x95e: 0x0fda, 0x95f: 0x100e, 0x960: 0x101a, 0x961: 0x105a, 0x962: 0x1076, 0x963: 0x109a, - 0x964: 0x10be, 0x965: 0x10c2, 0x966: 0x10de, 0x967: 0x10e2, 0x968: 0x10f2, 0x969: 0x1106, - 0x96a: 0x1102, 0x96b: 0x1132, 0x96c: 0x11ae, 0x96d: 0x11c6, 0x96e: 0x11de, 0x96f: 0x1216, - 0x970: 0x122a, 0x971: 0x1246, 0x972: 0x1276, 0x973: 0x132a, 0x974: 0x1352, 0x975: 0x13c6, - 0x976: 0x140e, 0x977: 0x141a, 0x978: 0x1422, 0x979: 0x143a, 0x97a: 0x144e, 0x97b: 0x143e, - 0x97c: 0x1456, 0x97d: 0x1452, 0x97e: 0x144a, 0x97f: 0x145a, - // Block 0x26, offset 0x980 - 0x980: 0x1466, 0x981: 0x14a2, 0x982: 0x14de, 0x983: 0x150e, 0x984: 0x1546, 0x985: 0x1566, - 0x986: 0x15b2, 0x987: 0x15d6, 0x988: 0x15f6, 0x989: 0x160a, 0x98a: 0x161a, 0x98b: 0x1626, - 0x98c: 0x1632, 0x98d: 0x1686, 0x98e: 0x1726, 0x98f: 0x17e2, 0x990: 0x17dd, 0x991: 0x180f, - 0x992: 0x0702, 0x993: 0x072a, 0x994: 0x072e, 0x995: 0x1891, 0x996: 0x18be, 0x997: 0x1936, - 0x998: 0x1712, 0x999: 0x1722, - // Block 0x27, offset 0x9c0 - 0x9c0: 0x07f6, 0x9c1: 0x07ee, 0x9c2: 0x07fe, 0x9c3: 0x1774, 0x9c4: 0x0842, 0x9c5: 0x0852, - 0x9c6: 0x0856, 0x9c7: 0x085e, 0x9c8: 0x0866, 0x9c9: 0x086a, 0x9ca: 0x0876, 0x9cb: 0x086e, - 0x9cc: 0x06ae, 0x9cd: 0x1788, 0x9ce: 0x088a, 0x9cf: 0x088e, 0x9d0: 0x0892, 0x9d1: 0x08ae, - 0x9d2: 0x1779, 0x9d3: 0x06b2, 0x9d4: 0x089a, 0x9d5: 0x08ba, 0x9d6: 0x1783, 0x9d7: 0x08ca, - 0x9d8: 0x08d2, 0x9d9: 0x0832, 0x9da: 0x08da, 0x9db: 0x08de, 0x9dc: 0x195e, 0x9dd: 0x08fa, - 0x9de: 0x0902, 0x9df: 0x06ba, 0x9e0: 0x091a, 0x9e1: 0x091e, 0x9e2: 0x0926, 0x9e3: 0x092a, - 0x9e4: 0x06be, 0x9e5: 0x0942, 0x9e6: 0x0946, 0x9e7: 0x0952, 0x9e8: 0x095e, 0x9e9: 0x0962, - 0x9ea: 0x0966, 0x9eb: 0x096e, 0x9ec: 0x098e, 0x9ed: 0x0992, 0x9ee: 0x099a, 0x9ef: 0x09aa, - 0x9f0: 0x09b2, 0x9f1: 0x09b6, 0x9f2: 0x09b6, 0x9f3: 0x09b6, 0x9f4: 0x1797, 0x9f5: 0x0f8e, - 0x9f6: 0x09ca, 0x9f7: 0x09d2, 0x9f8: 0x179c, 0x9f9: 0x09de, 0x9fa: 0x09e6, 0x9fb: 0x09ee, - 0x9fc: 0x0a16, 0x9fd: 0x0a02, 0x9fe: 0x0a0e, 0x9ff: 0x0a12, - // Block 0x28, offset 0xa00 - 0xa00: 0x0a1a, 0xa01: 0x0a22, 0xa02: 0x0a26, 0xa03: 0x0a2e, 0xa04: 0x0a36, 0xa05: 0x0a3a, - 0xa06: 0x0a3a, 0xa07: 0x0a42, 0xa08: 0x0a4a, 0xa09: 0x0a4e, 0xa0a: 0x0a5a, 0xa0b: 0x0a7e, - 0xa0c: 0x0a62, 0xa0d: 0x0a82, 0xa0e: 0x0a66, 0xa0f: 0x0a6e, 0xa10: 0x0906, 0xa11: 0x0aca, - 0xa12: 0x0a92, 0xa13: 0x0a96, 0xa14: 0x0a9a, 0xa15: 0x0a8e, 0xa16: 0x0aa2, 0xa17: 0x0a9e, - 0xa18: 0x0ab6, 0xa19: 0x17a1, 0xa1a: 0x0ad2, 0xa1b: 0x0ad6, 0xa1c: 0x0ade, 0xa1d: 0x0aea, - 0xa1e: 0x0af2, 0xa1f: 0x0b0e, 0xa20: 0x17a6, 0xa21: 0x17ab, 0xa22: 0x0b1a, 0xa23: 0x0b1e, - 0xa24: 0x0b22, 0xa25: 0x0b16, 0xa26: 0x0b2a, 0xa27: 0x06c2, 0xa28: 0x06c6, 0xa29: 0x0b32, - 0xa2a: 0x0b3a, 0xa2b: 0x0b3a, 0xa2c: 0x17b0, 0xa2d: 0x0b56, 0xa2e: 0x0b5a, 0xa2f: 0x0b5e, - 0xa30: 0x0b66, 0xa31: 0x17b5, 0xa32: 0x0b6e, 0xa33: 0x0b72, 0xa34: 0x0c4a, 0xa35: 0x0b7a, - 0xa36: 0x06ca, 0xa37: 0x0b86, 0xa38: 0x0b96, 0xa39: 0x0ba2, 0xa3a: 0x0b9e, 0xa3b: 0x17bf, - 0xa3c: 0x0baa, 0xa3d: 0x17c4, 0xa3e: 0x0bb6, 0xa3f: 0x0bb2, - // Block 0x29, offset 0xa40 - 0xa40: 0x0bba, 0xa41: 0x0bca, 0xa42: 0x0bce, 0xa43: 0x06ce, 0xa44: 0x0bde, 0xa45: 0x0be6, - 0xa46: 0x0bea, 0xa47: 0x0bee, 0xa48: 0x06d2, 0xa49: 0x17c9, 0xa4a: 0x06d6, 0xa4b: 0x0c0a, - 0xa4c: 0x0c0e, 0xa4d: 0x0c12, 0xa4e: 0x0c1a, 0xa4f: 0x1990, 0xa50: 0x0c32, 0xa51: 0x17d3, - 0xa52: 0x17d3, 0xa53: 0x12d2, 0xa54: 0x0c42, 0xa55: 0x0c42, 0xa56: 0x06da, 0xa57: 0x17f6, - 0xa58: 0x18c8, 0xa59: 0x0c52, 0xa5a: 0x0c5a, 0xa5b: 0x06de, 0xa5c: 0x0c6e, 0xa5d: 0x0c7e, - 0xa5e: 0x0c82, 0xa5f: 0x0c8a, 0xa60: 0x0c9a, 0xa61: 0x06e6, 0xa62: 0x06e2, 0xa63: 0x0c9e, - 0xa64: 0x17d8, 0xa65: 0x0ca2, 0xa66: 0x0cb6, 0xa67: 0x0cba, 0xa68: 0x0cbe, 0xa69: 0x0cba, - 0xa6a: 0x0cca, 0xa6b: 0x0cce, 0xa6c: 0x0cde, 0xa6d: 0x0cd6, 0xa6e: 0x0cda, 0xa6f: 0x0ce2, - 0xa70: 0x0ce6, 0xa71: 0x0cea, 0xa72: 0x0cf6, 0xa73: 0x0cfa, 0xa74: 0x0d12, 0xa75: 0x0d1a, - 0xa76: 0x0d2a, 0xa77: 0x0d3e, 0xa78: 0x17e7, 0xa79: 0x0d3a, 0xa7a: 0x0d2e, 0xa7b: 0x0d46, - 0xa7c: 0x0d4e, 0xa7d: 0x0d62, 0xa7e: 0x17ec, 0xa7f: 0x0d6a, - // Block 0x2a, offset 0xa80 - 0xa80: 0x0d5e, 0xa81: 0x0d56, 0xa82: 0x06ea, 0xa83: 0x0d72, 0xa84: 0x0d7a, 0xa85: 0x0d82, - 0xa86: 0x0d76, 0xa87: 0x06ee, 0xa88: 0x0d92, 0xa89: 0x0d9a, 0xa8a: 0x17f1, 0xa8b: 0x0dc6, - 0xa8c: 0x0dfa, 0xa8d: 0x0dd6, 0xa8e: 0x06fa, 0xa8f: 0x0de2, 0xa90: 0x06f6, 0xa91: 0x06f2, - 0xa92: 0x08be, 0xa93: 0x08c2, 0xa94: 0x0dfe, 0xa95: 0x0de6, 0xa96: 0x12a6, 0xa97: 0x075e, - 0xa98: 0x0e0a, 0xa99: 0x0e0e, 0xa9a: 0x0e12, 0xa9b: 0x0e26, 0xa9c: 0x0e1e, 0xa9d: 0x180a, - 0xa9e: 0x06fe, 0xa9f: 0x0e3a, 0xaa0: 0x0e2e, 0xaa1: 0x0e4a, 0xaa2: 0x0e52, 0xaa3: 0x1814, - 0xaa4: 0x0e56, 0xaa5: 0x0e42, 0xaa6: 0x0e5e, 0xaa7: 0x0702, 0xaa8: 0x0e62, 0xaa9: 0x0e66, - 0xaaa: 0x0e6a, 0xaab: 0x0e76, 0xaac: 0x1819, 0xaad: 0x0e7e, 0xaae: 0x0706, 0xaaf: 0x0e8a, - 0xab0: 0x181e, 0xab1: 0x0e8e, 0xab2: 0x070a, 0xab3: 0x0e9a, 0xab4: 0x0ea6, 0xab5: 0x0eb2, - 0xab6: 0x0eb6, 0xab7: 0x1823, 0xab8: 0x17ba, 0xab9: 0x1828, 0xaba: 0x0ed6, 0xabb: 0x182d, - 0xabc: 0x0ee2, 0xabd: 0x0eea, 0xabe: 0x0eda, 0xabf: 0x0ef6, - // Block 0x2b, offset 0xac0 - 0xac0: 0x0f06, 0xac1: 0x0f16, 0xac2: 0x0f0a, 0xac3: 0x0f0e, 0xac4: 0x0f1a, 0xac5: 0x0f1e, - 0xac6: 0x1832, 0xac7: 0x0f02, 0xac8: 0x0f36, 0xac9: 0x0f3a, 0xaca: 0x070e, 0xacb: 0x0f4e, - 0xacc: 0x0f4a, 0xacd: 0x1837, 0xace: 0x0f2e, 0xacf: 0x0f6a, 0xad0: 0x183c, 0xad1: 0x1841, - 0xad2: 0x0f6e, 0xad3: 0x0f82, 0xad4: 0x0f7e, 0xad5: 0x0f7a, 0xad6: 0x0712, 0xad7: 0x0f86, - 0xad8: 0x0f96, 0xad9: 0x0f92, 0xada: 0x0f9e, 0xadb: 0x177e, 0xadc: 0x0fae, 0xadd: 0x1846, - 0xade: 0x0fba, 0xadf: 0x1850, 0xae0: 0x0fce, 0xae1: 0x0fda, 0xae2: 0x0fee, 0xae3: 0x1855, - 0xae4: 0x1002, 0xae5: 0x1006, 0xae6: 0x185a, 0xae7: 0x185f, 0xae8: 0x1022, 0xae9: 0x1032, - 0xaea: 0x0716, 0xaeb: 0x1036, 0xaec: 0x071a, 0xaed: 0x071a, 0xaee: 0x104e, 0xaef: 0x1052, - 0xaf0: 0x105a, 0xaf1: 0x105e, 0xaf2: 0x106a, 0xaf3: 0x071e, 0xaf4: 0x1082, 0xaf5: 0x1864, - 0xaf6: 0x109e, 0xaf7: 0x1869, 0xaf8: 0x10aa, 0xaf9: 0x17ce, 0xafa: 0x10ba, 0xafb: 0x186e, - 0xafc: 0x1873, 0xafd: 0x1878, 0xafe: 0x0722, 0xaff: 0x0726, - // Block 0x2c, offset 0xb00 - 0xb00: 0x10f2, 0xb01: 0x1882, 0xb02: 0x187d, 0xb03: 0x1887, 0xb04: 0x188c, 0xb05: 0x10fa, - 0xb06: 0x10fe, 0xb07: 0x10fe, 0xb08: 0x1106, 0xb09: 0x072e, 0xb0a: 0x110a, 0xb0b: 0x0732, - 0xb0c: 0x0736, 0xb0d: 0x1896, 0xb0e: 0x111e, 0xb0f: 0x1126, 0xb10: 0x1132, 0xb11: 0x073a, - 0xb12: 0x189b, 0xb13: 0x1156, 0xb14: 0x18a0, 0xb15: 0x18a5, 0xb16: 0x1176, 0xb17: 0x118e, - 0xb18: 0x073e, 0xb19: 0x1196, 0xb1a: 0x119a, 0xb1b: 0x119e, 0xb1c: 0x18aa, 0xb1d: 0x18af, - 0xb1e: 0x18af, 0xb1f: 0x11b6, 0xb20: 0x0742, 0xb21: 0x18b4, 0xb22: 0x11ca, 0xb23: 0x11ce, - 0xb24: 0x0746, 0xb25: 0x18b9, 0xb26: 0x11ea, 0xb27: 0x074a, 0xb28: 0x11fa, 0xb29: 0x11f2, - 0xb2a: 0x1202, 0xb2b: 0x18c3, 0xb2c: 0x121a, 0xb2d: 0x074e, 0xb2e: 0x1226, 0xb2f: 0x122e, - 0xb30: 0x123e, 0xb31: 0x0752, 0xb32: 0x18cd, 0xb33: 0x18d2, 0xb34: 0x0756, 0xb35: 0x18d7, - 0xb36: 0x1256, 0xb37: 0x18dc, 0xb38: 0x1262, 0xb39: 0x126e, 0xb3a: 0x1276, 0xb3b: 0x18e1, - 0xb3c: 0x18e6, 0xb3d: 0x128a, 0xb3e: 0x18eb, 0xb3f: 0x1292, - // Block 0x2d, offset 0xb40 - 0xb40: 0x17fb, 0xb41: 0x075a, 0xb42: 0x12aa, 0xb43: 0x12ae, 0xb44: 0x0762, 0xb45: 0x12b2, - 0xb46: 0x0b2e, 0xb47: 0x18f0, 0xb48: 0x18f5, 0xb49: 0x1800, 0xb4a: 0x1805, 0xb4b: 0x12d2, - 0xb4c: 0x12d6, 0xb4d: 0x14ee, 0xb4e: 0x0766, 0xb4f: 0x1302, 0xb50: 0x12fe, 0xb51: 0x1306, - 0xb52: 0x093a, 0xb53: 0x130a, 0xb54: 0x130e, 0xb55: 0x1312, 0xb56: 0x131a, 0xb57: 0x18fa, - 0xb58: 0x1316, 0xb59: 0x131e, 0xb5a: 0x1332, 0xb5b: 0x1336, 0xb5c: 0x1322, 0xb5d: 0x133a, - 0xb5e: 0x134e, 0xb5f: 0x1362, 0xb60: 0x132e, 0xb61: 0x1342, 0xb62: 0x1346, 0xb63: 0x134a, - 0xb64: 0x18ff, 0xb65: 0x1909, 0xb66: 0x1904, 0xb67: 0x076a, 0xb68: 0x136a, 0xb69: 0x136e, - 0xb6a: 0x1376, 0xb6b: 0x191d, 0xb6c: 0x137a, 0xb6d: 0x190e, 0xb6e: 0x076e, 0xb6f: 0x0772, - 0xb70: 0x1913, 0xb71: 0x1918, 0xb72: 0x0776, 0xb73: 0x139a, 0xb74: 0x139e, 0xb75: 0x13a2, - 0xb76: 0x13a6, 0xb77: 0x13b2, 0xb78: 0x13ae, 0xb79: 0x13ba, 0xb7a: 0x13b6, 0xb7b: 0x13c6, - 0xb7c: 0x13be, 0xb7d: 0x13c2, 0xb7e: 0x13ca, 0xb7f: 0x077a, - // Block 0x2e, offset 0xb80 - 0xb80: 0x13d2, 0xb81: 0x13d6, 0xb82: 0x077e, 0xb83: 0x13e6, 0xb84: 0x13ea, 0xb85: 0x1922, - 0xb86: 0x13f6, 0xb87: 0x13fa, 0xb88: 0x0782, 0xb89: 0x1406, 0xb8a: 0x06b6, 0xb8b: 0x1927, - 0xb8c: 0x192c, 0xb8d: 0x0786, 0xb8e: 0x078a, 0xb8f: 0x1432, 0xb90: 0x144a, 0xb91: 0x1466, - 0xb92: 0x1476, 0xb93: 0x1931, 0xb94: 0x148a, 0xb95: 0x148e, 0xb96: 0x14a6, 0xb97: 0x14b2, - 0xb98: 0x193b, 0xb99: 0x178d, 0xb9a: 0x14be, 0xb9b: 0x14ba, 0xb9c: 0x14c6, 0xb9d: 0x1792, - 0xb9e: 0x14d2, 0xb9f: 0x14de, 0xba0: 0x1940, 0xba1: 0x1945, 0xba2: 0x151e, 0xba3: 0x152a, - 0xba4: 0x1532, 0xba5: 0x194a, 0xba6: 0x1536, 0xba7: 0x1562, 0xba8: 0x156e, 0xba9: 0x1572, - 0xbaa: 0x156a, 0xbab: 0x157e, 0xbac: 0x1582, 0xbad: 0x194f, 0xbae: 0x158e, 0xbaf: 0x078e, - 0xbb0: 0x1596, 0xbb1: 0x1954, 0xbb2: 0x0792, 0xbb3: 0x15ce, 0xbb4: 0x0bbe, 0xbb5: 0x15e6, - 0xbb6: 0x1959, 0xbb7: 0x1963, 0xbb8: 0x0796, 0xbb9: 0x079a, 0xbba: 0x160e, 0xbbb: 0x1968, - 0xbbc: 0x079e, 0xbbd: 0x196d, 0xbbe: 0x1626, 0xbbf: 0x1626, - // Block 0x2f, offset 0xbc0 - 0xbc0: 0x162e, 0xbc1: 0x1972, 0xbc2: 0x1646, 0xbc3: 0x07a2, 0xbc4: 0x1656, 0xbc5: 0x1662, - 0xbc6: 0x166a, 0xbc7: 0x1672, 0xbc8: 0x07a6, 0xbc9: 0x1977, 0xbca: 0x1686, 0xbcb: 0x16a2, - 0xbcc: 0x16ae, 0xbcd: 0x07aa, 0xbce: 0x07ae, 0xbcf: 0x16b2, 0xbd0: 0x197c, 0xbd1: 0x07b2, - 0xbd2: 0x1981, 0xbd3: 0x1986, 0xbd4: 0x198b, 0xbd5: 0x16d6, 0xbd6: 0x07b6, 0xbd7: 0x16ea, - 0xbd8: 0x16f2, 0xbd9: 0x16f6, 0xbda: 0x16fe, 0xbdb: 0x1706, 0xbdc: 0x170e, 0xbdd: 0x1995, -} - -// nfcIndex: 22 blocks, 1408 entries, 1408 bytes -// Block 0 is the zero block. -var nfcIndex = [1408]uint8{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04, - 0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32, - 0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35, - 0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, - 0xf0: 0x13, - // Block 0x4, offset 0x100 - 0x120: 0x3b, 0x121: 0x3c, 0x122: 0x3d, 0x123: 0x0d, 0x124: 0x3e, 0x125: 0x3f, 0x126: 0x40, 0x127: 0x41, - 0x128: 0x42, 0x129: 0x43, 0x12a: 0x44, 0x12b: 0x45, 0x12c: 0x40, 0x12d: 0x46, 0x12e: 0x47, 0x12f: 0x48, - 0x130: 0x44, 0x131: 0x49, 0x132: 0x4a, 0x133: 0x4b, 0x134: 0x4c, 0x135: 0x4d, 0x137: 0x4e, - 0x138: 0x4f, 0x139: 0x50, 0x13a: 0x51, 0x13b: 0x52, 0x13c: 0x53, 0x13d: 0x54, 0x13e: 0x55, 0x13f: 0x56, - // Block 0x5, offset 0x140 - 0x140: 0x57, 0x142: 0x58, 0x144: 0x59, 0x145: 0x5a, 0x146: 0x5b, 0x147: 0x5c, - 0x14d: 0x5d, - 0x15c: 0x5e, 0x15f: 0x5f, - 0x162: 0x60, 0x164: 0x61, - 0x168: 0x62, 0x169: 0x63, 0x16a: 0x64, 0x16b: 0x65, 0x16c: 0x0e, 0x16d: 0x66, 0x16e: 0x67, 0x16f: 0x68, - 0x170: 0x69, 0x173: 0x6a, 0x177: 0x0f, - 0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17, - // Block 0x6, offset 0x180 - 0x180: 0x6b, 0x183: 0x6c, 0x184: 0x6d, 0x186: 0x6e, 0x187: 0x6f, - 0x188: 0x70, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x71, 0x18c: 0x72, - 0x1ab: 0x73, - 0x1b3: 0x74, 0x1b5: 0x75, 0x1b7: 0x76, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x77, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x78, 0x1c5: 0x79, - 0x1c9: 0x7a, 0x1cc: 0x7b, 0x1cd: 0x7c, - // Block 0x8, offset 0x200 - 0x219: 0x7d, 0x21a: 0x7e, 0x21b: 0x7f, - 0x220: 0x80, 0x223: 0x81, 0x224: 0x82, 0x225: 0x83, 0x226: 0x84, 0x227: 0x85, - 0x22a: 0x86, 0x22b: 0x87, 0x22f: 0x88, - 0x230: 0x89, 0x231: 0x8a, 0x232: 0x8b, 0x233: 0x8c, 0x234: 0x8d, 0x235: 0x8e, 0x236: 0x8f, 0x237: 0x89, - 0x238: 0x8a, 0x239: 0x8b, 0x23a: 0x8c, 0x23b: 0x8d, 0x23c: 0x8e, 0x23d: 0x8f, 0x23e: 0x89, 0x23f: 0x8a, - // Block 0x9, offset 0x240 - 0x240: 0x8b, 0x241: 0x8c, 0x242: 0x8d, 0x243: 0x8e, 0x244: 0x8f, 0x245: 0x89, 0x246: 0x8a, 0x247: 0x8b, - 0x248: 0x8c, 0x249: 0x8d, 0x24a: 0x8e, 0x24b: 0x8f, 0x24c: 0x89, 0x24d: 0x8a, 0x24e: 0x8b, 0x24f: 0x8c, - 0x250: 0x8d, 0x251: 0x8e, 0x252: 0x8f, 0x253: 0x89, 0x254: 0x8a, 0x255: 0x8b, 0x256: 0x8c, 0x257: 0x8d, - 0x258: 0x8e, 0x259: 0x8f, 0x25a: 0x89, 0x25b: 0x8a, 0x25c: 0x8b, 0x25d: 0x8c, 0x25e: 0x8d, 0x25f: 0x8e, - 0x260: 0x8f, 0x261: 0x89, 0x262: 0x8a, 0x263: 0x8b, 0x264: 0x8c, 0x265: 0x8d, 0x266: 0x8e, 0x267: 0x8f, - 0x268: 0x89, 0x269: 0x8a, 0x26a: 0x8b, 0x26b: 0x8c, 0x26c: 0x8d, 0x26d: 0x8e, 0x26e: 0x8f, 0x26f: 0x89, - 0x270: 0x8a, 0x271: 0x8b, 0x272: 0x8c, 0x273: 0x8d, 0x274: 0x8e, 0x275: 0x8f, 0x276: 0x89, 0x277: 0x8a, - 0x278: 0x8b, 0x279: 0x8c, 0x27a: 0x8d, 0x27b: 0x8e, 0x27c: 0x8f, 0x27d: 0x89, 0x27e: 0x8a, 0x27f: 0x8b, - // Block 0xa, offset 0x280 - 0x280: 0x8c, 0x281: 0x8d, 0x282: 0x8e, 0x283: 0x8f, 0x284: 0x89, 0x285: 0x8a, 0x286: 0x8b, 0x287: 0x8c, - 0x288: 0x8d, 0x289: 0x8e, 0x28a: 0x8f, 0x28b: 0x89, 0x28c: 0x8a, 0x28d: 0x8b, 0x28e: 0x8c, 0x28f: 0x8d, - 0x290: 0x8e, 0x291: 0x8f, 0x292: 0x89, 0x293: 0x8a, 0x294: 0x8b, 0x295: 0x8c, 0x296: 0x8d, 0x297: 0x8e, - 0x298: 0x8f, 0x299: 0x89, 0x29a: 0x8a, 0x29b: 0x8b, 0x29c: 0x8c, 0x29d: 0x8d, 0x29e: 0x8e, 0x29f: 0x8f, - 0x2a0: 0x89, 0x2a1: 0x8a, 0x2a2: 0x8b, 0x2a3: 0x8c, 0x2a4: 0x8d, 0x2a5: 0x8e, 0x2a6: 0x8f, 0x2a7: 0x89, - 0x2a8: 0x8a, 0x2a9: 0x8b, 0x2aa: 0x8c, 0x2ab: 0x8d, 0x2ac: 0x8e, 0x2ad: 0x8f, 0x2ae: 0x89, 0x2af: 0x8a, - 0x2b0: 0x8b, 0x2b1: 0x8c, 0x2b2: 0x8d, 0x2b3: 0x8e, 0x2b4: 0x8f, 0x2b5: 0x89, 0x2b6: 0x8a, 0x2b7: 0x8b, - 0x2b8: 0x8c, 0x2b9: 0x8d, 0x2ba: 0x8e, 0x2bb: 0x8f, 0x2bc: 0x89, 0x2bd: 0x8a, 0x2be: 0x8b, 0x2bf: 0x8c, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x8d, 0x2c1: 0x8e, 0x2c2: 0x8f, 0x2c3: 0x89, 0x2c4: 0x8a, 0x2c5: 0x8b, 0x2c6: 0x8c, 0x2c7: 0x8d, - 0x2c8: 0x8e, 0x2c9: 0x8f, 0x2ca: 0x89, 0x2cb: 0x8a, 0x2cc: 0x8b, 0x2cd: 0x8c, 0x2ce: 0x8d, 0x2cf: 0x8e, - 0x2d0: 0x8f, 0x2d1: 0x89, 0x2d2: 0x8a, 0x2d3: 0x8b, 0x2d4: 0x8c, 0x2d5: 0x8d, 0x2d6: 0x8e, 0x2d7: 0x8f, - 0x2d8: 0x89, 0x2d9: 0x8a, 0x2da: 0x8b, 0x2db: 0x8c, 0x2dc: 0x8d, 0x2dd: 0x8e, 0x2de: 0x90, - // Block 0xc, offset 0x300 - 0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20, - 0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x91, 0x32d: 0x92, 0x32e: 0x93, - 0x331: 0x94, 0x332: 0x95, 0x333: 0x96, 0x334: 0x97, - 0x338: 0x98, 0x339: 0x99, 0x33a: 0x9a, 0x33b: 0x9b, 0x33e: 0x9c, 0x33f: 0x9d, - // Block 0xd, offset 0x340 - 0x347: 0x9e, - 0x34b: 0x9f, 0x34d: 0xa0, - 0x368: 0xa1, 0x36b: 0xa2, - 0x374: 0xa3, - 0x37a: 0xa4, 0x37b: 0xa5, 0x37d: 0xa6, 0x37e: 0xa7, - // Block 0xe, offset 0x380 - 0x381: 0xa8, 0x382: 0xa9, 0x384: 0xaa, 0x385: 0x84, 0x387: 0xab, - 0x388: 0xac, 0x38b: 0xad, 0x38c: 0xae, 0x38d: 0xaf, - 0x391: 0xb0, 0x392: 0xb1, 0x393: 0xb2, 0x396: 0xb3, 0x397: 0xb4, - 0x398: 0x75, 0x39a: 0xb5, 0x39c: 0xb6, - 0x3a0: 0xb7, 0x3a4: 0xb8, 0x3a5: 0xb9, 0x3a7: 0xba, - 0x3a8: 0xbb, 0x3a9: 0xbc, 0x3aa: 0xbd, - 0x3b0: 0x75, 0x3b5: 0xbe, 0x3b6: 0xbf, - 0x3bd: 0xc0, - // Block 0xf, offset 0x3c0 - 0x3eb: 0xc1, 0x3ec: 0xc2, - 0x3ff: 0xc3, - // Block 0x10, offset 0x400 - 0x432: 0xc4, - // Block 0x11, offset 0x440 - 0x445: 0xc5, 0x446: 0xc6, 0x447: 0xc7, - 0x449: 0xc8, - // Block 0x12, offset 0x480 - 0x480: 0xc9, 0x482: 0xca, 0x484: 0xc2, - 0x48a: 0xcb, 0x48b: 0xcc, - 0x493: 0xcd, - 0x4a3: 0xce, 0x4a5: 0xcf, - // Block 0x13, offset 0x4c0 - 0x4c8: 0xd0, - // Block 0x14, offset 0x500 - 0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c, - 0x528: 0x2d, - // Block 0x15, offset 0x540 - 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, - 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, - 0x56f: 0x12, -} - -// nfcSparseOffset: 163 entries, 326 bytes -var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x6e, 0x76, 0x7d, 0x80, 0x88, 0x8c, 0x90, 0x92, 0x94, 0x9d, 0xa1, 0xa8, 0xad, 0xb0, 0xba, 0xbd, 0xc4, 0xcc, 0xcf, 0xd1, 0xd4, 0xd6, 0xdb, 0xec, 0xf8, 0xfa, 0x100, 0x102, 0x104, 0x106, 0x108, 0x10a, 0x10c, 0x10f, 0x112, 0x114, 0x117, 0x11a, 0x11e, 0x124, 0x12b, 0x134, 0x136, 0x139, 0x13b, 0x146, 0x14a, 0x158, 0x15b, 0x161, 0x167, 0x172, 0x176, 0x178, 0x17a, 0x17c, 0x17e, 0x180, 0x186, 0x18a, 0x18c, 0x18e, 0x196, 0x19a, 0x19d, 0x19f, 0x1a1, 0x1a4, 0x1a7, 0x1a9, 0x1ab, 0x1ad, 0x1af, 0x1b5, 0x1b8, 0x1ba, 0x1c1, 0x1c7, 0x1cd, 0x1d5, 0x1db, 0x1e1, 0x1e7, 0x1eb, 0x1f9, 0x202, 0x205, 0x208, 0x20a, 0x20d, 0x20f, 0x213, 0x218, 0x21a, 0x21c, 0x221, 0x227, 0x229, 0x22b, 0x22d, 0x233, 0x236, 0x238, 0x23a, 0x23c, 0x242, 0x246, 0x24a, 0x252, 0x259, 0x25c, 0x25f, 0x261, 0x264, 0x26c, 0x270, 0x277, 0x27a, 0x280, 0x282, 0x285, 0x287, 0x28a, 0x28f, 0x291, 0x293, 0x295, 0x297, 0x299, 0x29c, 0x29e, 0x2a0, 0x2a2, 0x2a4, 0x2a6, 0x2a8, 0x2b5, 0x2bf, 0x2c1, 0x2c3, 0x2c9, 0x2cb, 0x2cd, 0x2cf, 0x2d3, 0x2d5, 0x2d8} - -// nfcSparseValues: 730 entries, 2920 bytes -var nfcSparseValues = [730]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0000, lo: 0x04}, - {value: 0xa100, lo: 0xa8, hi: 0xa8}, - {value: 0x8100, lo: 0xaf, hi: 0xaf}, - {value: 0x8100, lo: 0xb4, hi: 0xb4}, - {value: 0x8100, lo: 0xb8, hi: 0xb8}, - // Block 0x1, offset 0x5 - {value: 0x0091, lo: 0x03}, - {value: 0x4813, lo: 0xa0, hi: 0xa1}, - {value: 0x4845, lo: 0xaf, hi: 0xb0}, - {value: 0xa000, lo: 0xb7, hi: 0xb7}, - // Block 0x2, offset 0x9 - {value: 0x0000, lo: 0x01}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - // Block 0x3, offset 0xb - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0x98, hi: 0x9d}, - // Block 0x4, offset 0xd - {value: 0x0006, lo: 0x0a}, - {value: 0xa000, lo: 0x81, hi: 0x81}, - {value: 0xa000, lo: 0x85, hi: 0x85}, - {value: 0xa000, lo: 0x89, hi: 0x89}, - {value: 0x4971, lo: 0x8a, hi: 0x8a}, - {value: 0x498f, lo: 0x8b, hi: 0x8b}, - {value: 0x3626, lo: 0x8c, hi: 0x8c}, - {value: 0x363e, lo: 0x8d, hi: 0x8d}, - {value: 0x49a7, lo: 0x8e, hi: 0x8e}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x365c, lo: 0x93, hi: 0x94}, - // Block 0x5, offset 0x18 - {value: 0x0000, lo: 0x0f}, - {value: 0xa000, lo: 0x83, hi: 0x83}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0xa000, lo: 0x8b, hi: 0x8b}, - {value: 0xa000, lo: 0x8d, hi: 0x8d}, - {value: 0x3704, lo: 0x90, hi: 0x90}, - {value: 0x3710, lo: 0x91, hi: 0x91}, - {value: 0x36fe, lo: 0x93, hi: 0x93}, - {value: 0xa000, lo: 0x96, hi: 0x96}, - {value: 0x3776, lo: 0x97, hi: 0x97}, - {value: 0x3740, lo: 0x9c, hi: 0x9c}, - {value: 0x3728, lo: 0x9d, hi: 0x9d}, - {value: 0x3752, lo: 0x9e, hi: 0x9e}, - {value: 0xa000, lo: 0xb4, hi: 0xb5}, - {value: 0x377c, lo: 0xb6, hi: 0xb6}, - {value: 0x3782, lo: 0xb7, hi: 0xb7}, - // Block 0x6, offset 0x28 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x83, hi: 0x87}, - // Block 0x7, offset 0x2a - {value: 0x0001, lo: 0x04}, - {value: 0x8114, lo: 0x81, hi: 0x82}, - {value: 0x8133, lo: 0x84, hi: 0x84}, - {value: 0x812e, lo: 0x85, hi: 0x85}, - {value: 0x810e, lo: 0x87, hi: 0x87}, - // Block 0x8, offset 0x2f - {value: 0x0000, lo: 0x0a}, - {value: 0x8133, lo: 0x90, hi: 0x97}, - {value: 0x811a, lo: 0x98, hi: 0x98}, - {value: 0x811b, lo: 0x99, hi: 0x99}, - {value: 0x811c, lo: 0x9a, hi: 0x9a}, - {value: 0x37a0, lo: 0xa2, hi: 0xa2}, - {value: 0x37a6, lo: 0xa3, hi: 0xa3}, - {value: 0x37b2, lo: 0xa4, hi: 0xa4}, - {value: 0x37ac, lo: 0xa5, hi: 0xa5}, - {value: 0x37b8, lo: 0xa6, hi: 0xa6}, - {value: 0xa000, lo: 0xa7, hi: 0xa7}, - // Block 0x9, offset 0x3a - {value: 0x0000, lo: 0x0e}, - {value: 0x37ca, lo: 0x80, hi: 0x80}, - {value: 0xa000, lo: 0x81, hi: 0x81}, - {value: 0x37be, lo: 0x82, hi: 0x82}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x37c4, lo: 0x93, hi: 0x93}, - {value: 0xa000, lo: 0x95, hi: 0x95}, - {value: 0x8133, lo: 0x96, hi: 0x9c}, - {value: 0x8133, lo: 0x9f, hi: 0xa2}, - {value: 0x812e, lo: 0xa3, hi: 0xa3}, - {value: 0x8133, lo: 0xa4, hi: 0xa4}, - {value: 0x8133, lo: 0xa7, hi: 0xa8}, - {value: 0x812e, lo: 0xaa, hi: 0xaa}, - {value: 0x8133, lo: 0xab, hi: 0xac}, - {value: 0x812e, lo: 0xad, hi: 0xad}, - // Block 0xa, offset 0x49 - {value: 0x0000, lo: 0x0c}, - {value: 0x8120, lo: 0x91, hi: 0x91}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - {value: 0x812e, lo: 0xb1, hi: 0xb1}, - {value: 0x8133, lo: 0xb2, hi: 0xb3}, - {value: 0x812e, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb5, hi: 0xb6}, - {value: 0x812e, lo: 0xb7, hi: 0xb9}, - {value: 0x8133, lo: 0xba, hi: 0xba}, - {value: 0x812e, lo: 0xbb, hi: 0xbc}, - {value: 0x8133, lo: 0xbd, hi: 0xbd}, - {value: 0x812e, lo: 0xbe, hi: 0xbe}, - {value: 0x8133, lo: 0xbf, hi: 0xbf}, - // Block 0xb, offset 0x56 - {value: 0x0005, lo: 0x07}, - {value: 0x8133, lo: 0x80, hi: 0x80}, - {value: 0x8133, lo: 0x81, hi: 0x81}, - {value: 0x812e, lo: 0x82, hi: 0x83}, - {value: 0x812e, lo: 0x84, hi: 0x85}, - {value: 0x812e, lo: 0x86, hi: 0x87}, - {value: 0x812e, lo: 0x88, hi: 0x89}, - {value: 0x8133, lo: 0x8a, hi: 0x8a}, - // Block 0xc, offset 0x5e - {value: 0x0000, lo: 0x04}, - {value: 0x8133, lo: 0xab, hi: 0xb1}, - {value: 0x812e, lo: 0xb2, hi: 0xb2}, - {value: 0x8133, lo: 0xb3, hi: 0xb3}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - // Block 0xd, offset 0x63 - {value: 0x0000, lo: 0x04}, - {value: 0x8133, lo: 0x96, hi: 0x99}, - {value: 0x8133, lo: 0x9b, hi: 0xa3}, - {value: 0x8133, lo: 0xa5, hi: 0xa7}, - {value: 0x8133, lo: 0xa9, hi: 0xad}, - // Block 0xe, offset 0x68 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x99, hi: 0x9b}, - // Block 0xf, offset 0x6a - {value: 0x0000, lo: 0x03}, - {value: 0x8133, lo: 0x98, hi: 0x98}, - {value: 0x812e, lo: 0x99, hi: 0x9b}, - {value: 0x8133, lo: 0x9c, hi: 0x9f}, - // Block 0x10, offset 0x6e - {value: 0x0000, lo: 0x07}, - {value: 0xa000, lo: 0xa8, hi: 0xa8}, - {value: 0x3e37, lo: 0xa9, hi: 0xa9}, - {value: 0xa000, lo: 0xb0, hi: 0xb0}, - {value: 0x3e3f, lo: 0xb1, hi: 0xb1}, - {value: 0xa000, lo: 0xb3, hi: 0xb3}, - {value: 0x3e47, lo: 0xb4, hi: 0xb4}, - {value: 0x9903, lo: 0xbc, hi: 0xbc}, - // Block 0x11, offset 0x76 - {value: 0x0008, lo: 0x06}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x8133, lo: 0x91, hi: 0x91}, - {value: 0x812e, lo: 0x92, hi: 0x92}, - {value: 0x8133, lo: 0x93, hi: 0x93}, - {value: 0x8133, lo: 0x94, hi: 0x94}, - {value: 0x45d5, lo: 0x98, hi: 0x9f}, - // Block 0x12, offset 0x7d - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x13, offset 0x80 - {value: 0x0008, lo: 0x07}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x3e4f, lo: 0x8b, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x4615, lo: 0x9c, hi: 0x9d}, - {value: 0x4625, lo: 0x9f, hi: 0x9f}, - {value: 0x8133, lo: 0xbe, hi: 0xbe}, - // Block 0x14, offset 0x88 - {value: 0x0000, lo: 0x03}, - {value: 0x464d, lo: 0xb3, hi: 0xb3}, - {value: 0x4655, lo: 0xb6, hi: 0xb6}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - // Block 0x15, offset 0x8c - {value: 0x0008, lo: 0x03}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x462d, lo: 0x99, hi: 0x9b}, - {value: 0x4645, lo: 0x9e, hi: 0x9e}, - // Block 0x16, offset 0x90 - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - // Block 0x17, offset 0x92 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - // Block 0x18, offset 0x94 - {value: 0x0000, lo: 0x08}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x3e67, lo: 0x88, hi: 0x88}, - {value: 0x3e5f, lo: 0x8b, hi: 0x8b}, - {value: 0x3e6f, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x96, hi: 0x97}, - {value: 0x465d, lo: 0x9c, hi: 0x9c}, - {value: 0x4665, lo: 0x9d, hi: 0x9d}, - // Block 0x19, offset 0x9d - {value: 0x0000, lo: 0x03}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x3e77, lo: 0x94, hi: 0x94}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x1a, offset 0xa1 - {value: 0x0000, lo: 0x06}, - {value: 0xa000, lo: 0x86, hi: 0x87}, - {value: 0x3e7f, lo: 0x8a, hi: 0x8a}, - {value: 0x3e8f, lo: 0x8b, hi: 0x8b}, - {value: 0x3e87, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - // Block 0x1b, offset 0xa8 - {value: 0x1801, lo: 0x04}, - {value: 0xa000, lo: 0x86, hi: 0x86}, - {value: 0x3e97, lo: 0x88, hi: 0x88}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x8121, lo: 0x95, hi: 0x96}, - // Block 0x1c, offset 0xad - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - {value: 0xa000, lo: 0xbf, hi: 0xbf}, - // Block 0x1d, offset 0xb0 - {value: 0x0000, lo: 0x09}, - {value: 0x3e9f, lo: 0x80, hi: 0x80}, - {value: 0x9900, lo: 0x82, hi: 0x82}, - {value: 0xa000, lo: 0x86, hi: 0x86}, - {value: 0x3ea7, lo: 0x87, hi: 0x87}, - {value: 0x3eaf, lo: 0x88, hi: 0x88}, - {value: 0x4adf, lo: 0x8a, hi: 0x8a}, - {value: 0x42f9, lo: 0x8b, hi: 0x8b}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x95, hi: 0x96}, - // Block 0x1e, offset 0xba - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xbb, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x1f, offset 0xbd - {value: 0x0000, lo: 0x06}, - {value: 0xa000, lo: 0x86, hi: 0x87}, - {value: 0x3eb7, lo: 0x8a, hi: 0x8a}, - {value: 0x3ec7, lo: 0x8b, hi: 0x8b}, - {value: 0x3ebf, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - // Block 0x20, offset 0xc4 - {value: 0x5a29, lo: 0x07}, - {value: 0x9905, lo: 0x8a, hi: 0x8a}, - {value: 0x9900, lo: 0x8f, hi: 0x8f}, - {value: 0xa000, lo: 0x99, hi: 0x99}, - {value: 0x3ecf, lo: 0x9a, hi: 0x9a}, - {value: 0x4ae7, lo: 0x9c, hi: 0x9c}, - {value: 0x4304, lo: 0x9d, hi: 0x9d}, - {value: 0x3ed7, lo: 0x9e, hi: 0x9f}, - // Block 0x21, offset 0xcc - {value: 0x0000, lo: 0x02}, - {value: 0x8123, lo: 0xb8, hi: 0xb9}, - {value: 0x8105, lo: 0xba, hi: 0xba}, - // Block 0x22, offset 0xcf - {value: 0x0000, lo: 0x01}, - {value: 0x8124, lo: 0x88, hi: 0x8b}, - // Block 0x23, offset 0xd1 - {value: 0x0000, lo: 0x02}, - {value: 0x8125, lo: 0xb8, hi: 0xb9}, - {value: 0x8105, lo: 0xba, hi: 0xba}, - // Block 0x24, offset 0xd4 - {value: 0x0000, lo: 0x01}, - {value: 0x8126, lo: 0x88, hi: 0x8b}, - // Block 0x25, offset 0xd6 - {value: 0x0000, lo: 0x04}, - {value: 0x812e, lo: 0x98, hi: 0x99}, - {value: 0x812e, lo: 0xb5, hi: 0xb5}, - {value: 0x812e, lo: 0xb7, hi: 0xb7}, - {value: 0x812c, lo: 0xb9, hi: 0xb9}, - // Block 0x26, offset 0xdb - {value: 0x0000, lo: 0x10}, - {value: 0x2774, lo: 0x83, hi: 0x83}, - {value: 0x277b, lo: 0x8d, hi: 0x8d}, - {value: 0x2782, lo: 0x92, hi: 0x92}, - {value: 0x2789, lo: 0x97, hi: 0x97}, - {value: 0x2790, lo: 0x9c, hi: 0x9c}, - {value: 0x276d, lo: 0xa9, hi: 0xa9}, - {value: 0x8127, lo: 0xb1, hi: 0xb1}, - {value: 0x8128, lo: 0xb2, hi: 0xb2}, - {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, - {value: 0x8129, lo: 0xb4, hi: 0xb4}, - {value: 0x4bce, lo: 0xb5, hi: 0xb5}, - {value: 0x466d, lo: 0xb6, hi: 0xb6}, - {value: 0x8200, lo: 0xb7, hi: 0xb7}, - {value: 0x4675, lo: 0xb8, hi: 0xb8}, - {value: 0x8200, lo: 0xb9, hi: 0xb9}, - {value: 0x8128, lo: 0xba, hi: 0xbd}, - // Block 0x27, offset 0xec - {value: 0x0000, lo: 0x0b}, - {value: 0x8128, lo: 0x80, hi: 0x80}, - {value: 0x4bd7, lo: 0x81, hi: 0x81}, - {value: 0x8133, lo: 0x82, hi: 0x83}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0x86, hi: 0x87}, - {value: 0x279e, lo: 0x93, hi: 0x93}, - {value: 0x27a5, lo: 0x9d, hi: 0x9d}, - {value: 0x27ac, lo: 0xa2, hi: 0xa2}, - {value: 0x27b3, lo: 0xa7, hi: 0xa7}, - {value: 0x27ba, lo: 0xac, hi: 0xac}, - {value: 0x2797, lo: 0xb9, hi: 0xb9}, - // Block 0x28, offset 0xf8 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x86, hi: 0x86}, - // Block 0x29, offset 0xfa - {value: 0x0000, lo: 0x05}, - {value: 0xa000, lo: 0xa5, hi: 0xa5}, - {value: 0x3edf, lo: 0xa6, hi: 0xa6}, - {value: 0x9900, lo: 0xae, hi: 0xae}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - {value: 0x8105, lo: 0xb9, hi: 0xba}, - // Block 0x2a, offset 0x100 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x8d, hi: 0x8d}, - // Block 0x2b, offset 0x102 - {value: 0x0000, lo: 0x01}, - {value: 0xa000, lo: 0x80, hi: 0x92}, - // Block 0x2c, offset 0x104 - {value: 0x0000, lo: 0x01}, - {value: 0xb900, lo: 0xa1, hi: 0xb5}, - // Block 0x2d, offset 0x106 - {value: 0x0000, lo: 0x01}, - {value: 0x9900, lo: 0xa8, hi: 0xbf}, - // Block 0x2e, offset 0x108 - {value: 0x0000, lo: 0x01}, - {value: 0x9900, lo: 0x80, hi: 0x82}, - // Block 0x2f, offset 0x10a - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x9d, hi: 0x9f}, - // Block 0x30, offset 0x10c - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x94, hi: 0x95}, - {value: 0x8105, lo: 0xb4, hi: 0xb4}, - // Block 0x31, offset 0x10f - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x92, hi: 0x92}, - {value: 0x8133, lo: 0x9d, hi: 0x9d}, - // Block 0x32, offset 0x112 - {value: 0x0000, lo: 0x01}, - {value: 0x8132, lo: 0xa9, hi: 0xa9}, - // Block 0x33, offset 0x114 - {value: 0x0004, lo: 0x02}, - {value: 0x812f, lo: 0xb9, hi: 0xba}, - {value: 0x812e, lo: 0xbb, hi: 0xbb}, - // Block 0x34, offset 0x117 - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x97, hi: 0x97}, - {value: 0x812e, lo: 0x98, hi: 0x98}, - // Block 0x35, offset 0x11a - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0xa0, hi: 0xa0}, - {value: 0x8133, lo: 0xb5, hi: 0xbc}, - {value: 0x812e, lo: 0xbf, hi: 0xbf}, - // Block 0x36, offset 0x11e - {value: 0x0000, lo: 0x05}, - {value: 0x8133, lo: 0xb0, hi: 0xb4}, - {value: 0x812e, lo: 0xb5, hi: 0xba}, - {value: 0x8133, lo: 0xbb, hi: 0xbc}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - {value: 0x812e, lo: 0xbf, hi: 0xbf}, - // Block 0x37, offset 0x124 - {value: 0x0000, lo: 0x06}, - {value: 0x812e, lo: 0x80, hi: 0x80}, - {value: 0x8133, lo: 0x81, hi: 0x82}, - {value: 0x812e, lo: 0x83, hi: 0x84}, - {value: 0x8133, lo: 0x85, hi: 0x89}, - {value: 0x812e, lo: 0x8a, hi: 0x8a}, - {value: 0x8133, lo: 0x8b, hi: 0x8e}, - // Block 0x38, offset 0x12b - {value: 0x0000, lo: 0x08}, - {value: 0x3f27, lo: 0x80, hi: 0x80}, - {value: 0x3f2f, lo: 0x81, hi: 0x81}, - {value: 0xa000, lo: 0x82, hi: 0x82}, - {value: 0x3f37, lo: 0x83, hi: 0x83}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0xab, hi: 0xab}, - {value: 0x812e, lo: 0xac, hi: 0xac}, - {value: 0x8133, lo: 0xad, hi: 0xb3}, - // Block 0x39, offset 0x134 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xaa, hi: 0xab}, - // Block 0x3a, offset 0x136 - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xa6, hi: 0xa6}, - {value: 0x8105, lo: 0xb2, hi: 0xb3}, - // Block 0x3b, offset 0x139 - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - // Block 0x3c, offset 0x13b - {value: 0x0000, lo: 0x0a}, - {value: 0x8133, lo: 0x90, hi: 0x92}, - {value: 0x8101, lo: 0x94, hi: 0x94}, - {value: 0x812e, lo: 0x95, hi: 0x99}, - {value: 0x8133, lo: 0x9a, hi: 0x9b}, - {value: 0x812e, lo: 0x9c, hi: 0x9f}, - {value: 0x8133, lo: 0xa0, hi: 0xa0}, - {value: 0x8101, lo: 0xa2, hi: 0xa8}, - {value: 0x812e, lo: 0xad, hi: 0xad}, - {value: 0x8133, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb8, hi: 0xb9}, - // Block 0x3d, offset 0x146 - {value: 0x0004, lo: 0x03}, - {value: 0x052a, lo: 0x80, hi: 0x81}, - {value: 0x8100, lo: 0x97, hi: 0x97}, - {value: 0x8100, lo: 0xbe, hi: 0xbe}, - // Block 0x3e, offset 0x14a - {value: 0x0000, lo: 0x0d}, - {value: 0x8133, lo: 0x90, hi: 0x91}, - {value: 0x8101, lo: 0x92, hi: 0x93}, - {value: 0x8133, lo: 0x94, hi: 0x97}, - {value: 0x8101, lo: 0x98, hi: 0x9a}, - {value: 0x8133, lo: 0x9b, hi: 0x9c}, - {value: 0x8133, lo: 0xa1, hi: 0xa1}, - {value: 0x8101, lo: 0xa5, hi: 0xa6}, - {value: 0x8133, lo: 0xa7, hi: 0xa7}, - {value: 0x812e, lo: 0xa8, hi: 0xa8}, - {value: 0x8133, lo: 0xa9, hi: 0xa9}, - {value: 0x8101, lo: 0xaa, hi: 0xab}, - {value: 0x812e, lo: 0xac, hi: 0xaf}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - // Block 0x3f, offset 0x158 - {value: 0x4334, lo: 0x02}, - {value: 0x023c, lo: 0xa6, hi: 0xa6}, - {value: 0x0057, lo: 0xaa, hi: 0xab}, - // Block 0x40, offset 0x15b - {value: 0x0007, lo: 0x05}, - {value: 0xa000, lo: 0x90, hi: 0x90}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0xa000, lo: 0x94, hi: 0x94}, - {value: 0x3b18, lo: 0x9a, hi: 0x9b}, - {value: 0x3b26, lo: 0xae, hi: 0xae}, - // Block 0x41, offset 0x161 - {value: 0x000e, lo: 0x05}, - {value: 0x3b2d, lo: 0x8d, hi: 0x8e}, - {value: 0x3b34, lo: 0x8f, hi: 0x8f}, - {value: 0xa000, lo: 0x90, hi: 0x90}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0xa000, lo: 0x94, hi: 0x94}, - // Block 0x42, offset 0x167 - {value: 0x64a9, lo: 0x0a}, - {value: 0xa000, lo: 0x83, hi: 0x83}, - {value: 0x3b42, lo: 0x84, hi: 0x84}, - {value: 0xa000, lo: 0x88, hi: 0x88}, - {value: 0x3b49, lo: 0x89, hi: 0x89}, - {value: 0xa000, lo: 0x8b, hi: 0x8b}, - {value: 0x3b50, lo: 0x8c, hi: 0x8c}, - {value: 0xa000, lo: 0xa3, hi: 0xa3}, - {value: 0x3b57, lo: 0xa4, hi: 0xa5}, - {value: 0x3b5e, lo: 0xa6, hi: 0xa6}, - {value: 0xa000, lo: 0xbc, hi: 0xbc}, - // Block 0x43, offset 0x172 - {value: 0x0007, lo: 0x03}, - {value: 0x3bc7, lo: 0xa0, hi: 0xa1}, - {value: 0x3bf1, lo: 0xa2, hi: 0xa3}, - {value: 0x3c1b, lo: 0xaa, hi: 0xad}, - // Block 0x44, offset 0x176 - {value: 0x0004, lo: 0x01}, - {value: 0x0586, lo: 0xa9, hi: 0xaa}, - // Block 0x45, offset 0x178 - {value: 0x0000, lo: 0x01}, - {value: 0x4596, lo: 0x9c, hi: 0x9c}, - // Block 0x46, offset 0x17a - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xaf, hi: 0xb1}, - // Block 0x47, offset 0x17c - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x48, offset 0x17e - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xa0, hi: 0xbf}, - // Block 0x49, offset 0x180 - {value: 0x0000, lo: 0x05}, - {value: 0x812d, lo: 0xaa, hi: 0xaa}, - {value: 0x8132, lo: 0xab, hi: 0xab}, - {value: 0x8134, lo: 0xac, hi: 0xac}, - {value: 0x812f, lo: 0xad, hi: 0xad}, - {value: 0x8130, lo: 0xae, hi: 0xaf}, - // Block 0x4a, offset 0x186 - {value: 0x0000, lo: 0x03}, - {value: 0x4be0, lo: 0xb3, hi: 0xb3}, - {value: 0x4be0, lo: 0xb5, hi: 0xb6}, - {value: 0x4be0, lo: 0xba, hi: 0xbf}, - // Block 0x4b, offset 0x18a - {value: 0x0000, lo: 0x01}, - {value: 0x4be0, lo: 0x8f, hi: 0xa3}, - // Block 0x4c, offset 0x18c - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0xae, hi: 0xbe}, - // Block 0x4d, offset 0x18e - {value: 0x0000, lo: 0x07}, - {value: 0x8100, lo: 0x84, hi: 0x84}, - {value: 0x8100, lo: 0x87, hi: 0x87}, - {value: 0x8100, lo: 0x90, hi: 0x90}, - {value: 0x8100, lo: 0x9e, hi: 0x9e}, - {value: 0x8100, lo: 0xa1, hi: 0xa1}, - {value: 0x8100, lo: 0xb2, hi: 0xb2}, - {value: 0x8100, lo: 0xbb, hi: 0xbb}, - // Block 0x4e, offset 0x196 - {value: 0x0000, lo: 0x03}, - {value: 0x8100, lo: 0x80, hi: 0x80}, - {value: 0x8100, lo: 0x8b, hi: 0x8b}, - {value: 0x8100, lo: 0x8e, hi: 0x8e}, - // Block 0x4f, offset 0x19a - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0xaf, hi: 0xaf}, - {value: 0x8133, lo: 0xb4, hi: 0xbd}, - // Block 0x50, offset 0x19d - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x9e, hi: 0x9f}, - // Block 0x51, offset 0x19f - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb0, hi: 0xb1}, - // Block 0x52, offset 0x1a1 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x86, hi: 0x86}, - {value: 0x8105, lo: 0xac, hi: 0xac}, - // Block 0x53, offset 0x1a4 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0xa0, hi: 0xb1}, - // Block 0x54, offset 0x1a7 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xab, hi: 0xad}, - // Block 0x55, offset 0x1a9 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x93, hi: 0x93}, - // Block 0x56, offset 0x1ab - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xb3, hi: 0xb3}, - // Block 0x57, offset 0x1ad - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x80, hi: 0x80}, - // Block 0x58, offset 0x1af - {value: 0x0000, lo: 0x05}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - {value: 0x8133, lo: 0xb2, hi: 0xb3}, - {value: 0x812e, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb7, hi: 0xb8}, - {value: 0x8133, lo: 0xbe, hi: 0xbf}, - // Block 0x59, offset 0x1b5 - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x81, hi: 0x81}, - {value: 0x8105, lo: 0xb6, hi: 0xb6}, - // Block 0x5a, offset 0x1b8 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xad, hi: 0xad}, - // Block 0x5b, offset 0x1ba - {value: 0x0000, lo: 0x06}, - {value: 0xe500, lo: 0x80, hi: 0x80}, - {value: 0xc600, lo: 0x81, hi: 0x9b}, - {value: 0xe500, lo: 0x9c, hi: 0x9c}, - {value: 0xc600, lo: 0x9d, hi: 0xb7}, - {value: 0xe500, lo: 0xb8, hi: 0xb8}, - {value: 0xc600, lo: 0xb9, hi: 0xbf}, - // Block 0x5c, offset 0x1c1 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x93}, - {value: 0xe500, lo: 0x94, hi: 0x94}, - {value: 0xc600, lo: 0x95, hi: 0xaf}, - {value: 0xe500, lo: 0xb0, hi: 0xb0}, - {value: 0xc600, lo: 0xb1, hi: 0xbf}, - // Block 0x5d, offset 0x1c7 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x8b}, - {value: 0xe500, lo: 0x8c, hi: 0x8c}, - {value: 0xc600, lo: 0x8d, hi: 0xa7}, - {value: 0xe500, lo: 0xa8, hi: 0xa8}, - {value: 0xc600, lo: 0xa9, hi: 0xbf}, - // Block 0x5e, offset 0x1cd - {value: 0x0000, lo: 0x07}, - {value: 0xc600, lo: 0x80, hi: 0x83}, - {value: 0xe500, lo: 0x84, hi: 0x84}, - {value: 0xc600, lo: 0x85, hi: 0x9f}, - {value: 0xe500, lo: 0xa0, hi: 0xa0}, - {value: 0xc600, lo: 0xa1, hi: 0xbb}, - {value: 0xe500, lo: 0xbc, hi: 0xbc}, - {value: 0xc600, lo: 0xbd, hi: 0xbf}, - // Block 0x5f, offset 0x1d5 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x97}, - {value: 0xe500, lo: 0x98, hi: 0x98}, - {value: 0xc600, lo: 0x99, hi: 0xb3}, - {value: 0xe500, lo: 0xb4, hi: 0xb4}, - {value: 0xc600, lo: 0xb5, hi: 0xbf}, - // Block 0x60, offset 0x1db - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x8f}, - {value: 0xe500, lo: 0x90, hi: 0x90}, - {value: 0xc600, lo: 0x91, hi: 0xab}, - {value: 0xe500, lo: 0xac, hi: 0xac}, - {value: 0xc600, lo: 0xad, hi: 0xbf}, - // Block 0x61, offset 0x1e1 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x87}, - {value: 0xe500, lo: 0x88, hi: 0x88}, - {value: 0xc600, lo: 0x89, hi: 0xa3}, - {value: 0xe500, lo: 0xa4, hi: 0xa4}, - {value: 0xc600, lo: 0xa5, hi: 0xbf}, - // Block 0x62, offset 0x1e7 - {value: 0x0000, lo: 0x03}, - {value: 0xc600, lo: 0x80, hi: 0x87}, - {value: 0xe500, lo: 0x88, hi: 0x88}, - {value: 0xc600, lo: 0x89, hi: 0xa3}, - // Block 0x63, offset 0x1eb - {value: 0x0006, lo: 0x0d}, - {value: 0x4449, lo: 0x9d, hi: 0x9d}, - {value: 0x8116, lo: 0x9e, hi: 0x9e}, - {value: 0x44bb, lo: 0x9f, hi: 0x9f}, - {value: 0x44a9, lo: 0xaa, hi: 0xab}, - {value: 0x45ad, lo: 0xac, hi: 0xac}, - {value: 0x45b5, lo: 0xad, hi: 0xad}, - {value: 0x4401, lo: 0xae, hi: 0xb1}, - {value: 0x441f, lo: 0xb2, hi: 0xb4}, - {value: 0x4437, lo: 0xb5, hi: 0xb6}, - {value: 0x4443, lo: 0xb8, hi: 0xb8}, - {value: 0x444f, lo: 0xb9, hi: 0xbb}, - {value: 0x4467, lo: 0xbc, hi: 0xbc}, - {value: 0x446d, lo: 0xbe, hi: 0xbe}, - // Block 0x64, offset 0x1f9 - {value: 0x0006, lo: 0x08}, - {value: 0x4473, lo: 0x80, hi: 0x81}, - {value: 0x447f, lo: 0x83, hi: 0x84}, - {value: 0x4491, lo: 0x86, hi: 0x89}, - {value: 0x44b5, lo: 0x8a, hi: 0x8a}, - {value: 0x4431, lo: 0x8b, hi: 0x8b}, - {value: 0x4419, lo: 0x8c, hi: 0x8c}, - {value: 0x4461, lo: 0x8d, hi: 0x8d}, - {value: 0x448b, lo: 0x8e, hi: 0x8e}, - // Block 0x65, offset 0x202 - {value: 0x0000, lo: 0x02}, - {value: 0x8100, lo: 0xa4, hi: 0xa5}, - {value: 0x8100, lo: 0xb0, hi: 0xb1}, - // Block 0x66, offset 0x205 - {value: 0x0000, lo: 0x02}, - {value: 0x8100, lo: 0x9b, hi: 0x9d}, - {value: 0x8200, lo: 0x9e, hi: 0xa3}, - // Block 0x67, offset 0x208 - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0x90, hi: 0x90}, - // Block 0x68, offset 0x20a - {value: 0x0000, lo: 0x02}, - {value: 0x8100, lo: 0x99, hi: 0x99}, - {value: 0x8200, lo: 0xb2, hi: 0xb4}, - // Block 0x69, offset 0x20d - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0xbc, hi: 0xbd}, - // Block 0x6a, offset 0x20f - {value: 0x0000, lo: 0x03}, - {value: 0x8133, lo: 0xa0, hi: 0xa6}, - {value: 0x812e, lo: 0xa7, hi: 0xad}, - {value: 0x8133, lo: 0xae, hi: 0xaf}, - // Block 0x6b, offset 0x213 - {value: 0x0000, lo: 0x04}, - {value: 0x8100, lo: 0x89, hi: 0x8c}, - {value: 0x8100, lo: 0xb0, hi: 0xb2}, - {value: 0x8100, lo: 0xb4, hi: 0xb4}, - {value: 0x8100, lo: 0xb6, hi: 0xbf}, - // Block 0x6c, offset 0x218 - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0x81, hi: 0x8c}, - // Block 0x6d, offset 0x21a - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0xb5, hi: 0xba}, - // Block 0x6e, offset 0x21c - {value: 0x0000, lo: 0x04}, - {value: 0x4be0, lo: 0x9e, hi: 0x9f}, - {value: 0x4be0, lo: 0xa3, hi: 0xa3}, - {value: 0x4be0, lo: 0xa5, hi: 0xa6}, - {value: 0x4be0, lo: 0xaa, hi: 0xaf}, - // Block 0x6f, offset 0x221 - {value: 0x0000, lo: 0x05}, - {value: 0x4be0, lo: 0x82, hi: 0x87}, - {value: 0x4be0, lo: 0x8a, hi: 0x8f}, - {value: 0x4be0, lo: 0x92, hi: 0x97}, - {value: 0x4be0, lo: 0x9a, hi: 0x9c}, - {value: 0x8100, lo: 0xa3, hi: 0xa3}, - // Block 0x70, offset 0x227 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - // Block 0x71, offset 0x229 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xa0, hi: 0xa0}, - // Block 0x72, offset 0x22b - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb6, hi: 0xba}, - // Block 0x73, offset 0x22d - {value: 0x002d, lo: 0x05}, - {value: 0x812e, lo: 0x8d, hi: 0x8d}, - {value: 0x8133, lo: 0x8f, hi: 0x8f}, - {value: 0x8133, lo: 0xb8, hi: 0xb8}, - {value: 0x8101, lo: 0xb9, hi: 0xba}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x74, offset 0x233 - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0xa5, hi: 0xa5}, - {value: 0x812e, lo: 0xa6, hi: 0xa6}, - // Block 0x75, offset 0x236 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xa4, hi: 0xa7}, - // Block 0x76, offset 0x238 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xab, hi: 0xac}, - // Block 0x77, offset 0x23a - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xbd, hi: 0xbf}, - // Block 0x78, offset 0x23c - {value: 0x0000, lo: 0x05}, - {value: 0x812e, lo: 0x86, hi: 0x87}, - {value: 0x8133, lo: 0x88, hi: 0x8a}, - {value: 0x812e, lo: 0x8b, hi: 0x8b}, - {value: 0x8133, lo: 0x8c, hi: 0x8c}, - {value: 0x812e, lo: 0x8d, hi: 0x90}, - // Block 0x79, offset 0x242 - {value: 0x0005, lo: 0x03}, - {value: 0x8133, lo: 0x82, hi: 0x82}, - {value: 0x812e, lo: 0x83, hi: 0x84}, - {value: 0x812e, lo: 0x85, hi: 0x85}, - // Block 0x7a, offset 0x246 - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0x86, hi: 0x86}, - {value: 0x8105, lo: 0xb0, hi: 0xb0}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x7b, offset 0x24a - {value: 0x17fe, lo: 0x07}, - {value: 0xa000, lo: 0x99, hi: 0x99}, - {value: 0x4277, lo: 0x9a, hi: 0x9a}, - {value: 0xa000, lo: 0x9b, hi: 0x9b}, - {value: 0x4281, lo: 0x9c, hi: 0x9c}, - {value: 0xa000, lo: 0xa5, hi: 0xa5}, - {value: 0x428b, lo: 0xab, hi: 0xab}, - {value: 0x8105, lo: 0xb9, hi: 0xba}, - // Block 0x7c, offset 0x252 - {value: 0x0000, lo: 0x06}, - {value: 0x8133, lo: 0x80, hi: 0x82}, - {value: 0x9900, lo: 0xa7, hi: 0xa7}, - {value: 0x4295, lo: 0xae, hi: 0xae}, - {value: 0x429f, lo: 0xaf, hi: 0xaf}, - {value: 0xa000, lo: 0xb1, hi: 0xb2}, - {value: 0x8105, lo: 0xb3, hi: 0xb4}, - // Block 0x7d, offset 0x259 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x80, hi: 0x80}, - {value: 0x8103, lo: 0x8a, hi: 0x8a}, - // Block 0x7e, offset 0x25c - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb5, hi: 0xb5}, - {value: 0x8103, lo: 0xb6, hi: 0xb6}, - // Block 0x7f, offset 0x25f - {value: 0x0002, lo: 0x01}, - {value: 0x8103, lo: 0xa9, hi: 0xaa}, - // Block 0x80, offset 0x261 - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbb, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x81, offset 0x264 - {value: 0x0000, lo: 0x07}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x42a9, lo: 0x8b, hi: 0x8b}, - {value: 0x42b3, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x8133, lo: 0xa6, hi: 0xac}, - {value: 0x8133, lo: 0xb0, hi: 0xb4}, - // Block 0x82, offset 0x26c - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0x82, hi: 0x82}, - {value: 0x8103, lo: 0x86, hi: 0x86}, - {value: 0x8133, lo: 0x9e, hi: 0x9e}, - // Block 0x83, offset 0x270 - {value: 0x5643, lo: 0x06}, - {value: 0x9900, lo: 0xb0, hi: 0xb0}, - {value: 0xa000, lo: 0xb9, hi: 0xb9}, - {value: 0x9900, lo: 0xba, hi: 0xba}, - {value: 0x42c7, lo: 0xbb, hi: 0xbb}, - {value: 0x42bd, lo: 0xbc, hi: 0xbd}, - {value: 0x42d1, lo: 0xbe, hi: 0xbe}, - // Block 0x84, offset 0x277 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x82, hi: 0x82}, - {value: 0x8103, lo: 0x83, hi: 0x83}, - // Block 0x85, offset 0x27a - {value: 0x0000, lo: 0x05}, - {value: 0x9900, lo: 0xaf, hi: 0xaf}, - {value: 0xa000, lo: 0xb8, hi: 0xb9}, - {value: 0x42db, lo: 0xba, hi: 0xba}, - {value: 0x42e5, lo: 0xbb, hi: 0xbb}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x86, offset 0x280 - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0x80, hi: 0x80}, - // Block 0x87, offset 0x282 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb6, hi: 0xb6}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - // Block 0x88, offset 0x285 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xab, hi: 0xab}, - // Block 0x89, offset 0x287 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb9, hi: 0xb9}, - {value: 0x8103, lo: 0xba, hi: 0xba}, - // Block 0x8a, offset 0x28a - {value: 0x0000, lo: 0x04}, - {value: 0x9900, lo: 0xb0, hi: 0xb0}, - {value: 0xa000, lo: 0xb5, hi: 0xb5}, - {value: 0x42ef, lo: 0xb8, hi: 0xb8}, - {value: 0x8105, lo: 0xbd, hi: 0xbe}, - // Block 0x8b, offset 0x28f - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0x83, hi: 0x83}, - // Block 0x8c, offset 0x291 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xa0, hi: 0xa0}, - // Block 0x8d, offset 0x293 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xb4, hi: 0xb4}, - // Block 0x8e, offset 0x295 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x87, hi: 0x87}, - // Block 0x8f, offset 0x297 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x99, hi: 0x99}, - // Block 0x90, offset 0x299 - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0x82, hi: 0x82}, - {value: 0x8105, lo: 0x84, hi: 0x85}, - // Block 0x91, offset 0x29c - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x97, hi: 0x97}, - // Block 0x92, offset 0x29e - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x81, hi: 0x82}, - // Block 0x93, offset 0x2a0 - {value: 0x0000, lo: 0x01}, - {value: 0x8101, lo: 0xb0, hi: 0xb4}, - // Block 0x94, offset 0x2a2 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb0, hi: 0xb6}, - // Block 0x95, offset 0x2a4 - {value: 0x0000, lo: 0x01}, - {value: 0x8102, lo: 0xb0, hi: 0xb1}, - // Block 0x96, offset 0x2a6 - {value: 0x0000, lo: 0x01}, - {value: 0x8101, lo: 0x9e, hi: 0x9e}, - // Block 0x97, offset 0x2a8 - {value: 0x0000, lo: 0x0c}, - {value: 0x46fd, lo: 0x9e, hi: 0x9e}, - {value: 0x4707, lo: 0x9f, hi: 0x9f}, - {value: 0x473b, lo: 0xa0, hi: 0xa0}, - {value: 0x4749, lo: 0xa1, hi: 0xa1}, - {value: 0x4757, lo: 0xa2, hi: 0xa2}, - {value: 0x4765, lo: 0xa3, hi: 0xa3}, - {value: 0x4773, lo: 0xa4, hi: 0xa4}, - {value: 0x812c, lo: 0xa5, hi: 0xa6}, - {value: 0x8101, lo: 0xa7, hi: 0xa9}, - {value: 0x8131, lo: 0xad, hi: 0xad}, - {value: 0x812c, lo: 0xae, hi: 0xb2}, - {value: 0x812e, lo: 0xbb, hi: 0xbf}, - // Block 0x98, offset 0x2b5 - {value: 0x0000, lo: 0x09}, - {value: 0x812e, lo: 0x80, hi: 0x82}, - {value: 0x8133, lo: 0x85, hi: 0x89}, - {value: 0x812e, lo: 0x8a, hi: 0x8b}, - {value: 0x8133, lo: 0xaa, hi: 0xad}, - {value: 0x4711, lo: 0xbb, hi: 0xbb}, - {value: 0x471b, lo: 0xbc, hi: 0xbc}, - {value: 0x4781, lo: 0xbd, hi: 0xbd}, - {value: 0x479d, lo: 0xbe, hi: 0xbe}, - {value: 0x478f, lo: 0xbf, hi: 0xbf}, - // Block 0x99, offset 0x2bf - {value: 0x0000, lo: 0x01}, - {value: 0x47ab, lo: 0x80, hi: 0x80}, - // Block 0x9a, offset 0x2c1 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x82, hi: 0x84}, - // Block 0x9b, offset 0x2c3 - {value: 0x0000, lo: 0x05}, - {value: 0x8133, lo: 0x80, hi: 0x86}, - {value: 0x8133, lo: 0x88, hi: 0x98}, - {value: 0x8133, lo: 0x9b, hi: 0xa1}, - {value: 0x8133, lo: 0xa3, hi: 0xa4}, - {value: 0x8133, lo: 0xa6, hi: 0xaa}, - // Block 0x9c, offset 0x2c9 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x8f, hi: 0x8f}, - // Block 0x9d, offset 0x2cb - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xae, hi: 0xae}, - // Block 0x9e, offset 0x2cd - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xac, hi: 0xaf}, - // Block 0x9f, offset 0x2cf - {value: 0x0000, lo: 0x03}, - {value: 0x8134, lo: 0xac, hi: 0xad}, - {value: 0x812e, lo: 0xae, hi: 0xae}, - {value: 0x8133, lo: 0xaf, hi: 0xaf}, - // Block 0xa0, offset 0x2d3 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x90, hi: 0x96}, - // Block 0xa1, offset 0x2d5 - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x84, hi: 0x89}, - {value: 0x8103, lo: 0x8a, hi: 0x8a}, - // Block 0xa2, offset 0x2d8 - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0x93, hi: 0x93}, -} - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return nfkcValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfkcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfkcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = nfkcIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return nfkcValues[c0] - } - i := nfkcIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = nfkcIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = nfkcIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return nfkcValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfkcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfkcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = nfkcIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return nfkcValues[c0] - } - i := nfkcIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = nfkcIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = nfkcIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// nfkcTrie. Total size: 19260 bytes (18.81 KiB). Checksum: 4d294206c9ae0ba8. -type nfkcTrie struct{} - -func newNfkcTrie(i int) *nfkcTrie { - return &nfkcTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 95: - return uint16(nfkcValues[n<<6+uint32(b)]) - default: - n -= 95 - return uint16(nfkcSparse.lookup(n, b)) - } -} - -// nfkcValues: 97 blocks, 6208 entries, 12416 bytes -// The third block is the zero block. -var nfkcValues = [6208]uint16{ - // Block 0x0, offset 0x0 - 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, - // Block 0x1, offset 0x40 - 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, - 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, - 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, - 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, - 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, - 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, - 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, - 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, - 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, - 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x2ece, 0xc1: 0x2ed3, 0xc2: 0x47b9, 0xc3: 0x2ed8, 0xc4: 0x47c8, 0xc5: 0x47cd, - 0xc6: 0xa000, 0xc7: 0x47d7, 0xc8: 0x2f41, 0xc9: 0x2f46, 0xca: 0x47dc, 0xcb: 0x2f5a, - 0xcc: 0x2fcd, 0xcd: 0x2fd2, 0xce: 0x2fd7, 0xcf: 0x47f0, 0xd1: 0x3063, - 0xd2: 0x3086, 0xd3: 0x308b, 0xd4: 0x47fa, 0xd5: 0x47ff, 0xd6: 0x480e, - 0xd8: 0xa000, 0xd9: 0x3112, 0xda: 0x3117, 0xdb: 0x311c, 0xdc: 0x4840, 0xdd: 0x3194, - 0xe0: 0x31da, 0xe1: 0x31df, 0xe2: 0x484a, 0xe3: 0x31e4, - 0xe4: 0x4859, 0xe5: 0x485e, 0xe6: 0xa000, 0xe7: 0x4868, 0xe8: 0x324d, 0xe9: 0x3252, - 0xea: 0x486d, 0xeb: 0x3266, 0xec: 0x32de, 0xed: 0x32e3, 0xee: 0x32e8, 0xef: 0x4881, - 0xf1: 0x3374, 0xf2: 0x3397, 0xf3: 0x339c, 0xf4: 0x488b, 0xf5: 0x4890, - 0xf6: 0x489f, 0xf8: 0xa000, 0xf9: 0x3428, 0xfa: 0x342d, 0xfb: 0x3432, - 0xfc: 0x48d1, 0xfd: 0x34af, 0xff: 0x34c8, - // Block 0x4, offset 0x100 - 0x100: 0x2edd, 0x101: 0x31e9, 0x102: 0x47be, 0x103: 0x484f, 0x104: 0x2efb, 0x105: 0x3207, - 0x106: 0x2f0f, 0x107: 0x321b, 0x108: 0x2f14, 0x109: 0x3220, 0x10a: 0x2f19, 0x10b: 0x3225, - 0x10c: 0x2f1e, 0x10d: 0x322a, 0x10e: 0x2f28, 0x10f: 0x3234, - 0x112: 0x47e1, 0x113: 0x4872, 0x114: 0x2f50, 0x115: 0x325c, 0x116: 0x2f55, 0x117: 0x3261, - 0x118: 0x2f73, 0x119: 0x327f, 0x11a: 0x2f64, 0x11b: 0x3270, 0x11c: 0x2f8c, 0x11d: 0x3298, - 0x11e: 0x2f96, 0x11f: 0x32a2, 0x120: 0x2f9b, 0x121: 0x32a7, 0x122: 0x2fa5, 0x123: 0x32b1, - 0x124: 0x2faa, 0x125: 0x32b6, 0x128: 0x2fdc, 0x129: 0x32ed, - 0x12a: 0x2fe1, 0x12b: 0x32f2, 0x12c: 0x2fe6, 0x12d: 0x32f7, 0x12e: 0x3009, 0x12f: 0x3315, - 0x130: 0x2feb, 0x132: 0x1a8a, 0x133: 0x1b17, 0x134: 0x3013, 0x135: 0x331f, - 0x136: 0x3027, 0x137: 0x3338, 0x139: 0x3031, 0x13a: 0x3342, 0x13b: 0x303b, - 0x13c: 0x334c, 0x13d: 0x3036, 0x13e: 0x3347, 0x13f: 0x1cdc, - // Block 0x5, offset 0x140 - 0x140: 0x1d64, 0x143: 0x305e, 0x144: 0x336f, 0x145: 0x3077, - 0x146: 0x3388, 0x147: 0x306d, 0x148: 0x337e, 0x149: 0x1d8c, - 0x14c: 0x4804, 0x14d: 0x4895, 0x14e: 0x3090, 0x14f: 0x33a1, 0x150: 0x309a, 0x151: 0x33ab, - 0x154: 0x30b8, 0x155: 0x33c9, 0x156: 0x30d1, 0x157: 0x33e2, - 0x158: 0x30c2, 0x159: 0x33d3, 0x15a: 0x4827, 0x15b: 0x48b8, 0x15c: 0x30db, 0x15d: 0x33ec, - 0x15e: 0x30ea, 0x15f: 0x33fb, 0x160: 0x482c, 0x161: 0x48bd, 0x162: 0x3103, 0x163: 0x3419, - 0x164: 0x30f4, 0x165: 0x340a, 0x168: 0x4836, 0x169: 0x48c7, - 0x16a: 0x483b, 0x16b: 0x48cc, 0x16c: 0x3121, 0x16d: 0x3437, 0x16e: 0x312b, 0x16f: 0x3441, - 0x170: 0x3130, 0x171: 0x3446, 0x172: 0x314e, 0x173: 0x3464, 0x174: 0x3171, 0x175: 0x3487, - 0x176: 0x3199, 0x177: 0x34b4, 0x178: 0x31ad, 0x179: 0x31bc, 0x17a: 0x34dc, 0x17b: 0x31c6, - 0x17c: 0x34e6, 0x17d: 0x31cb, 0x17e: 0x34eb, 0x17f: 0x00a7, - // Block 0x6, offset 0x180 - 0x184: 0x2dd5, 0x185: 0x2ddb, - 0x186: 0x2de1, 0x187: 0x1a9f, 0x188: 0x1aa2, 0x189: 0x1b38, 0x18a: 0x1ab7, 0x18b: 0x1aba, - 0x18c: 0x1b6e, 0x18d: 0x2ee7, 0x18e: 0x31f3, 0x18f: 0x2ff5, 0x190: 0x3301, 0x191: 0x309f, - 0x192: 0x33b0, 0x193: 0x3135, 0x194: 0x344b, 0x195: 0x392e, 0x196: 0x3abd, 0x197: 0x3927, - 0x198: 0x3ab6, 0x199: 0x3935, 0x19a: 0x3ac4, 0x19b: 0x3920, 0x19c: 0x3aaf, - 0x19e: 0x380f, 0x19f: 0x399e, 0x1a0: 0x3808, 0x1a1: 0x3997, 0x1a2: 0x3512, 0x1a3: 0x3524, - 0x1a6: 0x2fa0, 0x1a7: 0x32ac, 0x1a8: 0x301d, 0x1a9: 0x332e, - 0x1aa: 0x481d, 0x1ab: 0x48ae, 0x1ac: 0x38ef, 0x1ad: 0x3a7e, 0x1ae: 0x3536, 0x1af: 0x353c, - 0x1b0: 0x3324, 0x1b1: 0x1a6f, 0x1b2: 0x1a72, 0x1b3: 0x1aff, 0x1b4: 0x2f87, 0x1b5: 0x3293, - 0x1b8: 0x3059, 0x1b9: 0x336a, 0x1ba: 0x3816, 0x1bb: 0x39a5, - 0x1bc: 0x350c, 0x1bd: 0x351e, 0x1be: 0x3518, 0x1bf: 0x352a, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x2eec, 0x1c1: 0x31f8, 0x1c2: 0x2ef1, 0x1c3: 0x31fd, 0x1c4: 0x2f69, 0x1c5: 0x3275, - 0x1c6: 0x2f6e, 0x1c7: 0x327a, 0x1c8: 0x2ffa, 0x1c9: 0x3306, 0x1ca: 0x2fff, 0x1cb: 0x330b, - 0x1cc: 0x30a4, 0x1cd: 0x33b5, 0x1ce: 0x30a9, 0x1cf: 0x33ba, 0x1d0: 0x30c7, 0x1d1: 0x33d8, - 0x1d2: 0x30cc, 0x1d3: 0x33dd, 0x1d4: 0x313a, 0x1d5: 0x3450, 0x1d6: 0x313f, 0x1d7: 0x3455, - 0x1d8: 0x30e5, 0x1d9: 0x33f6, 0x1da: 0x30fe, 0x1db: 0x3414, - 0x1de: 0x2fb9, 0x1df: 0x32c5, - 0x1e6: 0x47c3, 0x1e7: 0x4854, 0x1e8: 0x47eb, 0x1e9: 0x487c, - 0x1ea: 0x38be, 0x1eb: 0x3a4d, 0x1ec: 0x389b, 0x1ed: 0x3a2a, 0x1ee: 0x4809, 0x1ef: 0x489a, - 0x1f0: 0x38b7, 0x1f1: 0x3a46, 0x1f2: 0x31a3, 0x1f3: 0x34be, - // Block 0x8, offset 0x200 - 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, - 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, - 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, - 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, - 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, - 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, - 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, - 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, - 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, - 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, - 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, - // Block 0x9, offset 0x240 - 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, - 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, - 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, - 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, - 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, - 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, - 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, - 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, - 0x274: 0x01ee, - 0x27a: 0x435e, - 0x27e: 0x0037, - // Block 0xa, offset 0x280 - 0x284: 0x4313, 0x285: 0x4534, - 0x286: 0x3548, 0x287: 0x00ce, 0x288: 0x3566, 0x289: 0x3572, 0x28a: 0x3584, - 0x28c: 0x35a2, 0x28e: 0x35b4, 0x28f: 0x35d2, 0x290: 0x3d67, 0x291: 0xa000, - 0x295: 0xa000, 0x297: 0xa000, - 0x299: 0xa000, - 0x29f: 0xa000, 0x2a1: 0xa000, - 0x2a5: 0xa000, 0x2a9: 0xa000, - 0x2aa: 0x3596, 0x2ab: 0x35c6, 0x2ac: 0x492f, 0x2ad: 0x35f6, 0x2ae: 0x4959, 0x2af: 0x3608, - 0x2b0: 0x3dcf, 0x2b1: 0xa000, 0x2b5: 0xa000, - 0x2b7: 0xa000, 0x2b9: 0xa000, - 0x2bf: 0xa000, - // Block 0xb, offset 0x2c0 - 0x2c1: 0xa000, 0x2c5: 0xa000, - 0x2c9: 0xa000, 0x2ca: 0x4971, 0x2cb: 0x498f, - 0x2cc: 0x3626, 0x2cd: 0x363e, 0x2ce: 0x49a7, 0x2d0: 0x0242, 0x2d1: 0x0254, - 0x2d2: 0x0230, 0x2d3: 0x43c5, 0x2d4: 0x43cb, 0x2d5: 0x027e, 0x2d6: 0x026c, - 0x2f0: 0x025a, 0x2f1: 0x026f, 0x2f2: 0x0272, 0x2f4: 0x020c, 0x2f5: 0x024b, - 0x2f9: 0x022a, - // Block 0xc, offset 0x300 - 0x300: 0x3680, 0x301: 0x368c, 0x303: 0x367a, - 0x306: 0xa000, 0x307: 0x3668, - 0x30c: 0x36bc, 0x30d: 0x36a4, 0x30e: 0x36ce, 0x310: 0xa000, - 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000, - 0x318: 0xa000, 0x319: 0x36b0, 0x31a: 0xa000, - 0x31e: 0xa000, 0x323: 0xa000, - 0x327: 0xa000, - 0x32b: 0xa000, 0x32d: 0xa000, - 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000, - 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x3734, 0x33a: 0xa000, - 0x33e: 0xa000, - // Block 0xd, offset 0x340 - 0x341: 0x3692, 0x342: 0x3716, - 0x350: 0x366e, 0x351: 0x36f2, - 0x352: 0x3674, 0x353: 0x36f8, 0x356: 0x3686, 0x357: 0x370a, - 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x3788, 0x35b: 0x378e, 0x35c: 0x3698, 0x35d: 0x371c, - 0x35e: 0x369e, 0x35f: 0x3722, 0x362: 0x36aa, 0x363: 0x372e, - 0x364: 0x36b6, 0x365: 0x373a, 0x366: 0x36c2, 0x367: 0x3746, 0x368: 0xa000, 0x369: 0xa000, - 0x36a: 0x3794, 0x36b: 0x379a, 0x36c: 0x36ec, 0x36d: 0x3770, 0x36e: 0x36c8, 0x36f: 0x374c, - 0x370: 0x36d4, 0x371: 0x3758, 0x372: 0x36da, 0x373: 0x375e, 0x374: 0x36e0, 0x375: 0x3764, - 0x378: 0x36e6, 0x379: 0x376a, - // Block 0xe, offset 0x380 - 0x387: 0x1e91, - 0x391: 0x812e, - 0x392: 0x8133, 0x393: 0x8133, 0x394: 0x8133, 0x395: 0x8133, 0x396: 0x812e, 0x397: 0x8133, - 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x812f, 0x39b: 0x812e, 0x39c: 0x8133, 0x39d: 0x8133, - 0x39e: 0x8133, 0x39f: 0x8133, 0x3a0: 0x8133, 0x3a1: 0x8133, 0x3a2: 0x812e, 0x3a3: 0x812e, - 0x3a4: 0x812e, 0x3a5: 0x812e, 0x3a6: 0x812e, 0x3a7: 0x812e, 0x3a8: 0x8133, 0x3a9: 0x8133, - 0x3aa: 0x812e, 0x3ab: 0x8133, 0x3ac: 0x8133, 0x3ad: 0x812f, 0x3ae: 0x8132, 0x3af: 0x8133, - 0x3b0: 0x8106, 0x3b1: 0x8107, 0x3b2: 0x8108, 0x3b3: 0x8109, 0x3b4: 0x810a, 0x3b5: 0x810b, - 0x3b6: 0x810c, 0x3b7: 0x810d, 0x3b8: 0x810e, 0x3b9: 0x810f, 0x3ba: 0x810f, 0x3bb: 0x8110, - 0x3bc: 0x8111, 0x3bd: 0x8112, 0x3bf: 0x8113, - // Block 0xf, offset 0x3c0 - 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8117, - 0x3cc: 0x8118, 0x3cd: 0x8119, 0x3ce: 0x811a, 0x3cf: 0x811b, 0x3d0: 0x811c, 0x3d1: 0x811d, - 0x3d2: 0x811e, 0x3d3: 0x9933, 0x3d4: 0x9933, 0x3d5: 0x992e, 0x3d6: 0x812e, 0x3d7: 0x8133, - 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x812e, 0x3dd: 0x8133, - 0x3de: 0x8133, 0x3df: 0x812e, - 0x3f0: 0x811f, 0x3f5: 0x1eb4, - 0x3f6: 0x2143, 0x3f7: 0x217f, 0x3f8: 0x217a, - // Block 0x10, offset 0x400 - 0x40a: 0x8133, 0x40b: 0x8133, - 0x40c: 0x8133, 0x40d: 0x8133, 0x40e: 0x8133, 0x40f: 0x812e, 0x410: 0x812e, 0x411: 0x812e, - 0x412: 0x812e, 0x413: 0x812e, 0x414: 0x8133, 0x415: 0x8133, 0x416: 0x8133, 0x417: 0x8133, - 0x418: 0x8133, 0x419: 0x8133, 0x41a: 0x8133, 0x41b: 0x8133, 0x41c: 0x8133, 0x41d: 0x8133, - 0x41e: 0x8133, 0x41f: 0x8133, 0x420: 0x8133, 0x421: 0x8133, 0x423: 0x812e, - 0x424: 0x8133, 0x425: 0x8133, 0x426: 0x812e, 0x427: 0x8133, 0x428: 0x8133, 0x429: 0x812e, - 0x42a: 0x8133, 0x42b: 0x8133, 0x42c: 0x8133, 0x42d: 0x812e, 0x42e: 0x812e, 0x42f: 0x812e, - 0x430: 0x8117, 0x431: 0x8118, 0x432: 0x8119, 0x433: 0x8133, 0x434: 0x8133, 0x435: 0x8133, - 0x436: 0x812e, 0x437: 0x8133, 0x438: 0x8133, 0x439: 0x812e, 0x43a: 0x812e, 0x43b: 0x8133, - 0x43c: 0x8133, 0x43d: 0x8133, 0x43e: 0x8133, 0x43f: 0x8133, - // Block 0x11, offset 0x440 - 0x445: 0xa000, - 0x446: 0x3ee7, 0x447: 0xa000, 0x448: 0x3eef, 0x449: 0xa000, 0x44a: 0x3ef7, 0x44b: 0xa000, - 0x44c: 0x3eff, 0x44d: 0xa000, 0x44e: 0x3f07, 0x451: 0xa000, - 0x452: 0x3f0f, - 0x474: 0x8103, 0x475: 0x9900, - 0x47a: 0xa000, 0x47b: 0x3f17, - 0x47c: 0xa000, 0x47d: 0x3f1f, 0x47e: 0xa000, 0x47f: 0xa000, - // Block 0x12, offset 0x480 - 0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x0104, 0x485: 0x0107, - 0x486: 0x0506, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x011f, 0x48b: 0x0122, - 0x48c: 0x0125, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e6, - 0x492: 0x009f, 0x493: 0x0110, 0x494: 0x050a, 0x495: 0x050e, 0x496: 0x00a1, 0x497: 0x00a9, - 0x498: 0x00ab, 0x499: 0x0516, 0x49a: 0x015b, 0x49b: 0x00ad, 0x49c: 0x051a, 0x49d: 0x0242, - 0x49e: 0x0245, 0x49f: 0x0248, 0x4a0: 0x027e, 0x4a1: 0x0281, 0x4a2: 0x0093, 0x4a3: 0x00a5, - 0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x0242, 0x4a7: 0x0245, 0x4a8: 0x026f, 0x4a9: 0x027e, - 0x4aa: 0x0281, - 0x4b8: 0x02b4, - // Block 0x13, offset 0x4c0 - 0x4db: 0x010a, 0x4dc: 0x0087, 0x4dd: 0x0113, - 0x4de: 0x00d7, 0x4df: 0x0125, 0x4e0: 0x008d, 0x4e1: 0x012b, 0x4e2: 0x0131, 0x4e3: 0x013d, - 0x4e4: 0x0146, 0x4e5: 0x0149, 0x4e6: 0x014c, 0x4e7: 0x051e, 0x4e8: 0x01c7, 0x4e9: 0x0155, - 0x4ea: 0x0522, 0x4eb: 0x01ca, 0x4ec: 0x0161, 0x4ed: 0x015e, 0x4ee: 0x0164, 0x4ef: 0x0167, - 0x4f0: 0x016a, 0x4f1: 0x016d, 0x4f2: 0x0176, 0x4f3: 0x018e, 0x4f4: 0x0191, 0x4f5: 0x00f2, - 0x4f6: 0x019a, 0x4f7: 0x019d, 0x4f8: 0x0512, 0x4f9: 0x01a0, 0x4fa: 0x01a3, 0x4fb: 0x00b5, - 0x4fc: 0x01af, 0x4fd: 0x01b2, 0x4fe: 0x01b5, 0x4ff: 0x0254, - // Block 0x14, offset 0x500 - 0x500: 0x8133, 0x501: 0x8133, 0x502: 0x812e, 0x503: 0x8133, 0x504: 0x8133, 0x505: 0x8133, - 0x506: 0x8133, 0x507: 0x8133, 0x508: 0x8133, 0x509: 0x8133, 0x50a: 0x812e, 0x50b: 0x8133, - 0x50c: 0x8133, 0x50d: 0x8136, 0x50e: 0x812b, 0x50f: 0x812e, 0x510: 0x812a, 0x511: 0x8133, - 0x512: 0x8133, 0x513: 0x8133, 0x514: 0x8133, 0x515: 0x8133, 0x516: 0x8133, 0x517: 0x8133, - 0x518: 0x8133, 0x519: 0x8133, 0x51a: 0x8133, 0x51b: 0x8133, 0x51c: 0x8133, 0x51d: 0x8133, - 0x51e: 0x8133, 0x51f: 0x8133, 0x520: 0x8133, 0x521: 0x8133, 0x522: 0x8133, 0x523: 0x8133, - 0x524: 0x8133, 0x525: 0x8133, 0x526: 0x8133, 0x527: 0x8133, 0x528: 0x8133, 0x529: 0x8133, - 0x52a: 0x8133, 0x52b: 0x8133, 0x52c: 0x8133, 0x52d: 0x8133, 0x52e: 0x8133, 0x52f: 0x8133, - 0x530: 0x8133, 0x531: 0x8133, 0x532: 0x8133, 0x533: 0x8133, 0x534: 0x8133, 0x535: 0x8133, - 0x536: 0x8134, 0x537: 0x8132, 0x538: 0x8132, 0x539: 0x812e, 0x53a: 0x812d, 0x53b: 0x8133, - 0x53c: 0x8135, 0x53d: 0x812e, 0x53e: 0x8133, 0x53f: 0x812e, - // Block 0x15, offset 0x540 - 0x540: 0x2ef6, 0x541: 0x3202, 0x542: 0x2f00, 0x543: 0x320c, 0x544: 0x2f05, 0x545: 0x3211, - 0x546: 0x2f0a, 0x547: 0x3216, 0x548: 0x382b, 0x549: 0x39ba, 0x54a: 0x2f23, 0x54b: 0x322f, - 0x54c: 0x2f2d, 0x54d: 0x3239, 0x54e: 0x2f3c, 0x54f: 0x3248, 0x550: 0x2f32, 0x551: 0x323e, - 0x552: 0x2f37, 0x553: 0x3243, 0x554: 0x384e, 0x555: 0x39dd, 0x556: 0x3855, 0x557: 0x39e4, - 0x558: 0x2f78, 0x559: 0x3284, 0x55a: 0x2f7d, 0x55b: 0x3289, 0x55c: 0x3863, 0x55d: 0x39f2, - 0x55e: 0x2f82, 0x55f: 0x328e, 0x560: 0x2f91, 0x561: 0x329d, 0x562: 0x2faf, 0x563: 0x32bb, - 0x564: 0x2fbe, 0x565: 0x32ca, 0x566: 0x2fb4, 0x567: 0x32c0, 0x568: 0x2fc3, 0x569: 0x32cf, - 0x56a: 0x2fc8, 0x56b: 0x32d4, 0x56c: 0x300e, 0x56d: 0x331a, 0x56e: 0x386a, 0x56f: 0x39f9, - 0x570: 0x3018, 0x571: 0x3329, 0x572: 0x3022, 0x573: 0x3333, 0x574: 0x302c, 0x575: 0x333d, - 0x576: 0x47f5, 0x577: 0x4886, 0x578: 0x3871, 0x579: 0x3a00, 0x57a: 0x3045, 0x57b: 0x3356, - 0x57c: 0x3040, 0x57d: 0x3351, 0x57e: 0x304a, 0x57f: 0x335b, - // Block 0x16, offset 0x580 - 0x580: 0x304f, 0x581: 0x3360, 0x582: 0x3054, 0x583: 0x3365, 0x584: 0x3068, 0x585: 0x3379, - 0x586: 0x3072, 0x587: 0x3383, 0x588: 0x3081, 0x589: 0x3392, 0x58a: 0x307c, 0x58b: 0x338d, - 0x58c: 0x3894, 0x58d: 0x3a23, 0x58e: 0x38a2, 0x58f: 0x3a31, 0x590: 0x38a9, 0x591: 0x3a38, - 0x592: 0x38b0, 0x593: 0x3a3f, 0x594: 0x30ae, 0x595: 0x33bf, 0x596: 0x30b3, 0x597: 0x33c4, - 0x598: 0x30bd, 0x599: 0x33ce, 0x59a: 0x4822, 0x59b: 0x48b3, 0x59c: 0x38f6, 0x59d: 0x3a85, - 0x59e: 0x30d6, 0x59f: 0x33e7, 0x5a0: 0x30e0, 0x5a1: 0x33f1, 0x5a2: 0x4831, 0x5a3: 0x48c2, - 0x5a4: 0x38fd, 0x5a5: 0x3a8c, 0x5a6: 0x3904, 0x5a7: 0x3a93, 0x5a8: 0x390b, 0x5a9: 0x3a9a, - 0x5aa: 0x30ef, 0x5ab: 0x3400, 0x5ac: 0x30f9, 0x5ad: 0x340f, 0x5ae: 0x310d, 0x5af: 0x3423, - 0x5b0: 0x3108, 0x5b1: 0x341e, 0x5b2: 0x3149, 0x5b3: 0x345f, 0x5b4: 0x3158, 0x5b5: 0x346e, - 0x5b6: 0x3153, 0x5b7: 0x3469, 0x5b8: 0x3912, 0x5b9: 0x3aa1, 0x5ba: 0x3919, 0x5bb: 0x3aa8, - 0x5bc: 0x315d, 0x5bd: 0x3473, 0x5be: 0x3162, 0x5bf: 0x3478, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x3167, 0x5c1: 0x347d, 0x5c2: 0x316c, 0x5c3: 0x3482, 0x5c4: 0x317b, 0x5c5: 0x3491, - 0x5c6: 0x3176, 0x5c7: 0x348c, 0x5c8: 0x3180, 0x5c9: 0x349b, 0x5ca: 0x3185, 0x5cb: 0x34a0, - 0x5cc: 0x318a, 0x5cd: 0x34a5, 0x5ce: 0x31a8, 0x5cf: 0x34c3, 0x5d0: 0x31c1, 0x5d1: 0x34e1, - 0x5d2: 0x31d0, 0x5d3: 0x34f0, 0x5d4: 0x31d5, 0x5d5: 0x34f5, 0x5d6: 0x32d9, 0x5d7: 0x3405, - 0x5d8: 0x3496, 0x5d9: 0x34d2, 0x5da: 0x1d10, 0x5db: 0x4390, - 0x5e0: 0x47d2, 0x5e1: 0x4863, 0x5e2: 0x2ee2, 0x5e3: 0x31ee, - 0x5e4: 0x37d7, 0x5e5: 0x3966, 0x5e6: 0x37d0, 0x5e7: 0x395f, 0x5e8: 0x37e5, 0x5e9: 0x3974, - 0x5ea: 0x37de, 0x5eb: 0x396d, 0x5ec: 0x381d, 0x5ed: 0x39ac, 0x5ee: 0x37f3, 0x5ef: 0x3982, - 0x5f0: 0x37ec, 0x5f1: 0x397b, 0x5f2: 0x3801, 0x5f3: 0x3990, 0x5f4: 0x37fa, 0x5f5: 0x3989, - 0x5f6: 0x3824, 0x5f7: 0x39b3, 0x5f8: 0x47e6, 0x5f9: 0x4877, 0x5fa: 0x2f5f, 0x5fb: 0x326b, - 0x5fc: 0x2f4b, 0x5fd: 0x3257, 0x5fe: 0x3839, 0x5ff: 0x39c8, - // Block 0x18, offset 0x600 - 0x600: 0x3832, 0x601: 0x39c1, 0x602: 0x3847, 0x603: 0x39d6, 0x604: 0x3840, 0x605: 0x39cf, - 0x606: 0x385c, 0x607: 0x39eb, 0x608: 0x2ff0, 0x609: 0x32fc, 0x60a: 0x3004, 0x60b: 0x3310, - 0x60c: 0x4818, 0x60d: 0x48a9, 0x60e: 0x3095, 0x60f: 0x33a6, 0x610: 0x387f, 0x611: 0x3a0e, - 0x612: 0x3878, 0x613: 0x3a07, 0x614: 0x388d, 0x615: 0x3a1c, 0x616: 0x3886, 0x617: 0x3a15, - 0x618: 0x38e8, 0x619: 0x3a77, 0x61a: 0x38cc, 0x61b: 0x3a5b, 0x61c: 0x38c5, 0x61d: 0x3a54, - 0x61e: 0x38da, 0x61f: 0x3a69, 0x620: 0x38d3, 0x621: 0x3a62, 0x622: 0x38e1, 0x623: 0x3a70, - 0x624: 0x3144, 0x625: 0x345a, 0x626: 0x3126, 0x627: 0x343c, 0x628: 0x3943, 0x629: 0x3ad2, - 0x62a: 0x393c, 0x62b: 0x3acb, 0x62c: 0x3951, 0x62d: 0x3ae0, 0x62e: 0x394a, 0x62f: 0x3ad9, - 0x630: 0x3958, 0x631: 0x3ae7, 0x632: 0x318f, 0x633: 0x34aa, 0x634: 0x31b7, 0x635: 0x34d7, - 0x636: 0x31b2, 0x637: 0x34cd, 0x638: 0x319e, 0x639: 0x34b9, - // Block 0x19, offset 0x640 - 0x640: 0x4935, 0x641: 0x493b, 0x642: 0x4a4f, 0x643: 0x4a67, 0x644: 0x4a57, 0x645: 0x4a6f, - 0x646: 0x4a5f, 0x647: 0x4a77, 0x648: 0x48db, 0x649: 0x48e1, 0x64a: 0x49bf, 0x64b: 0x49d7, - 0x64c: 0x49c7, 0x64d: 0x49df, 0x64e: 0x49cf, 0x64f: 0x49e7, 0x650: 0x4947, 0x651: 0x494d, - 0x652: 0x3d17, 0x653: 0x3d27, 0x654: 0x3d1f, 0x655: 0x3d2f, - 0x658: 0x48e7, 0x659: 0x48ed, 0x65a: 0x3c47, 0x65b: 0x3c57, 0x65c: 0x3c4f, 0x65d: 0x3c5f, - 0x660: 0x495f, 0x661: 0x4965, 0x662: 0x4a7f, 0x663: 0x4a97, - 0x664: 0x4a87, 0x665: 0x4a9f, 0x666: 0x4a8f, 0x667: 0x4aa7, 0x668: 0x48f3, 0x669: 0x48f9, - 0x66a: 0x49ef, 0x66b: 0x4a07, 0x66c: 0x49f7, 0x66d: 0x4a0f, 0x66e: 0x49ff, 0x66f: 0x4a17, - 0x670: 0x4977, 0x671: 0x497d, 0x672: 0x3d77, 0x673: 0x3d8f, 0x674: 0x3d7f, 0x675: 0x3d97, - 0x676: 0x3d87, 0x677: 0x3d9f, 0x678: 0x48ff, 0x679: 0x4905, 0x67a: 0x3c77, 0x67b: 0x3c8f, - 0x67c: 0x3c7f, 0x67d: 0x3c97, 0x67e: 0x3c87, 0x67f: 0x3c9f, - // Block 0x1a, offset 0x680 - 0x680: 0x4983, 0x681: 0x4989, 0x682: 0x3da7, 0x683: 0x3db7, 0x684: 0x3daf, 0x685: 0x3dbf, - 0x688: 0x490b, 0x689: 0x4911, 0x68a: 0x3ca7, 0x68b: 0x3cb7, - 0x68c: 0x3caf, 0x68d: 0x3cbf, 0x690: 0x4995, 0x691: 0x499b, - 0x692: 0x3ddf, 0x693: 0x3df7, 0x694: 0x3de7, 0x695: 0x3dff, 0x696: 0x3def, 0x697: 0x3e07, - 0x699: 0x4917, 0x69b: 0x3cc7, 0x69d: 0x3ccf, - 0x69f: 0x3cd7, 0x6a0: 0x49ad, 0x6a1: 0x49b3, 0x6a2: 0x4aaf, 0x6a3: 0x4ac7, - 0x6a4: 0x4ab7, 0x6a5: 0x4acf, 0x6a6: 0x4abf, 0x6a7: 0x4ad7, 0x6a8: 0x491d, 0x6a9: 0x4923, - 0x6aa: 0x4a1f, 0x6ab: 0x4a37, 0x6ac: 0x4a27, 0x6ad: 0x4a3f, 0x6ae: 0x4a2f, 0x6af: 0x4a47, - 0x6b0: 0x4929, 0x6b1: 0x43d7, 0x6b2: 0x35f0, 0x6b3: 0x43dd, 0x6b4: 0x4953, 0x6b5: 0x43e3, - 0x6b6: 0x3602, 0x6b7: 0x43e9, 0x6b8: 0x3620, 0x6b9: 0x43ef, 0x6ba: 0x3638, 0x6bb: 0x43f5, - 0x6bc: 0x49a1, 0x6bd: 0x43fb, - // Block 0x1b, offset 0x6c0 - 0x6c0: 0x3cff, 0x6c1: 0x3d07, 0x6c2: 0x41c3, 0x6c3: 0x41e1, 0x6c4: 0x41cd, 0x6c5: 0x41eb, - 0x6c6: 0x41d7, 0x6c7: 0x41f5, 0x6c8: 0x3c37, 0x6c9: 0x3c3f, 0x6ca: 0x410f, 0x6cb: 0x412d, - 0x6cc: 0x4119, 0x6cd: 0x4137, 0x6ce: 0x4123, 0x6cf: 0x4141, 0x6d0: 0x3d47, 0x6d1: 0x3d4f, - 0x6d2: 0x41ff, 0x6d3: 0x421d, 0x6d4: 0x4209, 0x6d5: 0x4227, 0x6d6: 0x4213, 0x6d7: 0x4231, - 0x6d8: 0x3c67, 0x6d9: 0x3c6f, 0x6da: 0x414b, 0x6db: 0x4169, 0x6dc: 0x4155, 0x6dd: 0x4173, - 0x6de: 0x415f, 0x6df: 0x417d, 0x6e0: 0x3e1f, 0x6e1: 0x3e27, 0x6e2: 0x423b, 0x6e3: 0x4259, - 0x6e4: 0x4245, 0x6e5: 0x4263, 0x6e6: 0x424f, 0x6e7: 0x426d, 0x6e8: 0x3cdf, 0x6e9: 0x3ce7, - 0x6ea: 0x4187, 0x6eb: 0x41a5, 0x6ec: 0x4191, 0x6ed: 0x41af, 0x6ee: 0x419b, 0x6ef: 0x41b9, - 0x6f0: 0x35e4, 0x6f1: 0x35de, 0x6f2: 0x3cef, 0x6f3: 0x35ea, 0x6f4: 0x3cf7, - 0x6f6: 0x4941, 0x6f7: 0x3d0f, 0x6f8: 0x3554, 0x6f9: 0x354e, 0x6fa: 0x3542, 0x6fb: 0x43a7, - 0x6fc: 0x355a, 0x6fd: 0x4340, 0x6fe: 0x0257, 0x6ff: 0x4340, - // Block 0x1c, offset 0x700 - 0x700: 0x4359, 0x701: 0x453b, 0x702: 0x3d37, 0x703: 0x35fc, 0x704: 0x3d3f, - 0x706: 0x496b, 0x707: 0x3d57, 0x708: 0x3560, 0x709: 0x43ad, 0x70a: 0x356c, 0x70b: 0x43b3, - 0x70c: 0x3578, 0x70d: 0x4542, 0x70e: 0x4549, 0x70f: 0x4550, 0x710: 0x3614, 0x711: 0x360e, - 0x712: 0x3d5f, 0x713: 0x459d, 0x716: 0x361a, 0x717: 0x3d6f, - 0x718: 0x3590, 0x719: 0x358a, 0x71a: 0x357e, 0x71b: 0x43b9, 0x71d: 0x4557, - 0x71e: 0x455e, 0x71f: 0x4565, 0x720: 0x364a, 0x721: 0x3644, 0x722: 0x3dc7, 0x723: 0x45a5, - 0x724: 0x362c, 0x725: 0x3632, 0x726: 0x3650, 0x727: 0x3dd7, 0x728: 0x35c0, 0x729: 0x35ba, - 0x72a: 0x35ae, 0x72b: 0x43c5, 0x72c: 0x35a8, 0x72d: 0x452d, 0x72e: 0x4534, 0x72f: 0x0081, - 0x732: 0x3e0f, 0x733: 0x3656, 0x734: 0x3e17, - 0x736: 0x49b9, 0x737: 0x3e2f, 0x738: 0x359c, 0x739: 0x43bf, 0x73a: 0x35cc, 0x73b: 0x43d1, - 0x73c: 0x35d8, 0x73d: 0x4313, 0x73e: 0x4345, - // Block 0x1d, offset 0x740 - 0x740: 0x1d08, 0x741: 0x1d0c, 0x742: 0x0047, 0x743: 0x1d84, 0x745: 0x1d18, - 0x746: 0x1d1c, 0x747: 0x00ef, 0x749: 0x1d88, 0x74a: 0x008f, 0x74b: 0x0051, - 0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00e0, 0x750: 0x0053, 0x751: 0x0053, - 0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x1abd, - 0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065, - 0x760: 0x1acf, 0x761: 0x1cf8, 0x762: 0x1ad8, - 0x764: 0x0075, 0x766: 0x023c, 0x768: 0x0075, - 0x76a: 0x0057, 0x76b: 0x438b, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b, - 0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0308, - 0x776: 0x030b, 0x777: 0x030e, 0x778: 0x0311, 0x779: 0x0093, 0x77b: 0x1cc8, - 0x77c: 0x026c, 0x77d: 0x0245, 0x77e: 0x01fd, 0x77f: 0x0224, - // Block 0x1e, offset 0x780 - 0x780: 0x055a, 0x785: 0x0049, - 0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095, - 0x790: 0x235e, 0x791: 0x236a, - 0x792: 0x241e, 0x793: 0x2346, 0x794: 0x23ca, 0x795: 0x2352, 0x796: 0x23d0, 0x797: 0x23e8, - 0x798: 0x23f4, 0x799: 0x2358, 0x79a: 0x23fa, 0x79b: 0x2364, 0x79c: 0x23ee, 0x79d: 0x2400, - 0x79e: 0x2406, 0x79f: 0x1dec, 0x7a0: 0x0053, 0x7a1: 0x1a87, 0x7a2: 0x1cd4, 0x7a3: 0x1a90, - 0x7a4: 0x006d, 0x7a5: 0x1adb, 0x7a6: 0x1d00, 0x7a7: 0x1e78, 0x7a8: 0x1a93, 0x7a9: 0x0071, - 0x7aa: 0x1ae7, 0x7ab: 0x1d04, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b, - 0x7b0: 0x0093, 0x7b1: 0x1b14, 0x7b2: 0x1d48, 0x7b3: 0x1b1d, 0x7b4: 0x00ad, 0x7b5: 0x1b92, - 0x7b6: 0x1d7c, 0x7b7: 0x1e8c, 0x7b8: 0x1b20, 0x7b9: 0x00b1, 0x7ba: 0x1b95, 0x7bb: 0x1d80, - 0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b, - // Block 0x1f, offset 0x7c0 - 0x7c1: 0x3b65, 0x7c3: 0xa000, 0x7c4: 0x3b6c, 0x7c5: 0xa000, - 0x7c7: 0x3b73, 0x7c8: 0xa000, 0x7c9: 0x3b7a, - 0x7cd: 0xa000, - 0x7e0: 0x2ec4, 0x7e1: 0xa000, 0x7e2: 0x3b88, - 0x7e4: 0xa000, 0x7e5: 0xa000, - 0x7ed: 0x3b81, 0x7ee: 0x2ebf, 0x7ef: 0x2ec9, - 0x7f0: 0x3b8f, 0x7f1: 0x3b96, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3b9d, 0x7f5: 0x3ba4, - 0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3bab, 0x7f9: 0x3bb2, 0x7fa: 0xa000, 0x7fb: 0xa000, - 0x7fc: 0xa000, 0x7fd: 0xa000, - // Block 0x20, offset 0x800 - 0x800: 0x3bb9, 0x801: 0x3bc0, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3bd5, 0x805: 0x3bdc, - 0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3be3, 0x809: 0x3bea, - 0x811: 0xa000, - 0x812: 0xa000, - 0x822: 0xa000, - 0x828: 0xa000, 0x829: 0xa000, - 0x82b: 0xa000, 0x82c: 0x3bff, 0x82d: 0x3c06, 0x82e: 0x3c0d, 0x82f: 0x3c14, - 0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000, - // Block 0x21, offset 0x840 - 0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029, - 0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x19af, - 0x86a: 0x19b2, 0x86b: 0x19b5, 0x86c: 0x19b8, 0x86d: 0x19bb, 0x86e: 0x19be, 0x86f: 0x19c1, - 0x870: 0x19c4, 0x871: 0x19c7, 0x872: 0x19ca, 0x873: 0x19d3, 0x874: 0x1b98, 0x875: 0x1b9c, - 0x876: 0x1ba0, 0x877: 0x1ba4, 0x878: 0x1ba8, 0x879: 0x1bac, 0x87a: 0x1bb0, 0x87b: 0x1bb4, - 0x87c: 0x1bb8, 0x87d: 0x1db0, 0x87e: 0x1db5, 0x87f: 0x1dba, - // Block 0x22, offset 0x880 - 0x880: 0x1dbf, 0x881: 0x1dc4, 0x882: 0x1dc9, 0x883: 0x1dce, 0x884: 0x1dd3, 0x885: 0x1dd8, - 0x886: 0x1ddd, 0x887: 0x1de2, 0x888: 0x19ac, 0x889: 0x19d0, 0x88a: 0x19f4, 0x88b: 0x1a18, - 0x88c: 0x1a3c, 0x88d: 0x1a45, 0x88e: 0x1a4b, 0x88f: 0x1a51, 0x890: 0x1a57, 0x891: 0x1c90, - 0x892: 0x1c94, 0x893: 0x1c98, 0x894: 0x1c9c, 0x895: 0x1ca0, 0x896: 0x1ca4, 0x897: 0x1ca8, - 0x898: 0x1cac, 0x899: 0x1cb0, 0x89a: 0x1cb4, 0x89b: 0x1cb8, 0x89c: 0x1c24, 0x89d: 0x1c28, - 0x89e: 0x1c2c, 0x89f: 0x1c30, 0x8a0: 0x1c34, 0x8a1: 0x1c38, 0x8a2: 0x1c3c, 0x8a3: 0x1c40, - 0x8a4: 0x1c44, 0x8a5: 0x1c48, 0x8a6: 0x1c4c, 0x8a7: 0x1c50, 0x8a8: 0x1c54, 0x8a9: 0x1c58, - 0x8aa: 0x1c5c, 0x8ab: 0x1c60, 0x8ac: 0x1c64, 0x8ad: 0x1c68, 0x8ae: 0x1c6c, 0x8af: 0x1c70, - 0x8b0: 0x1c74, 0x8b1: 0x1c78, 0x8b2: 0x1c7c, 0x8b3: 0x1c80, 0x8b4: 0x1c84, 0x8b5: 0x1c88, - 0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d, - 0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055, - // Block 0x23, offset 0x8c0 - 0x8c0: 0x07ba, 0x8c1: 0x07de, 0x8c2: 0x07ea, 0x8c3: 0x07fa, 0x8c4: 0x0802, 0x8c5: 0x080e, - 0x8c6: 0x0816, 0x8c7: 0x081e, 0x8c8: 0x082a, 0x8c9: 0x087e, 0x8ca: 0x0896, 0x8cb: 0x08a6, - 0x8cc: 0x08b6, 0x8cd: 0x08c6, 0x8ce: 0x08d6, 0x8cf: 0x08f6, 0x8d0: 0x08fa, 0x8d1: 0x08fe, - 0x8d2: 0x0932, 0x8d3: 0x095a, 0x8d4: 0x096a, 0x8d5: 0x0972, 0x8d6: 0x0976, 0x8d7: 0x0982, - 0x8d8: 0x099e, 0x8d9: 0x09a2, 0x8da: 0x09ba, 0x8db: 0x09be, 0x8dc: 0x09c6, 0x8dd: 0x09d6, - 0x8de: 0x0a72, 0x8df: 0x0a86, 0x8e0: 0x0ac6, 0x8e1: 0x0ada, 0x8e2: 0x0ae2, 0x8e3: 0x0ae6, - 0x8e4: 0x0af6, 0x8e5: 0x0b12, 0x8e6: 0x0b3e, 0x8e7: 0x0b4a, 0x8e8: 0x0b6a, 0x8e9: 0x0b76, - 0x8ea: 0x0b7a, 0x8eb: 0x0b7e, 0x8ec: 0x0b96, 0x8ed: 0x0b9a, 0x8ee: 0x0bc6, 0x8ef: 0x0bd2, - 0x8f0: 0x0bda, 0x8f1: 0x0be2, 0x8f2: 0x0bf2, 0x8f3: 0x0bfa, 0x8f4: 0x0c02, 0x8f5: 0x0c2e, - 0x8f6: 0x0c32, 0x8f7: 0x0c3a, 0x8f8: 0x0c3e, 0x8f9: 0x0c46, 0x8fa: 0x0c4e, 0x8fb: 0x0c5e, - 0x8fc: 0x0c7a, 0x8fd: 0x0cf2, 0x8fe: 0x0d06, 0x8ff: 0x0d0a, - // Block 0x24, offset 0x900 - 0x900: 0x0d8a, 0x901: 0x0d8e, 0x902: 0x0da2, 0x903: 0x0da6, 0x904: 0x0dae, 0x905: 0x0db6, - 0x906: 0x0dbe, 0x907: 0x0dca, 0x908: 0x0df2, 0x909: 0x0e02, 0x90a: 0x0e16, 0x90b: 0x0e86, - 0x90c: 0x0e92, 0x90d: 0x0ea2, 0x90e: 0x0eae, 0x90f: 0x0eba, 0x910: 0x0ec2, 0x911: 0x0ec6, - 0x912: 0x0eca, 0x913: 0x0ece, 0x914: 0x0ed2, 0x915: 0x0f8a, 0x916: 0x0fd2, 0x917: 0x0fde, - 0x918: 0x0fe2, 0x919: 0x0fe6, 0x91a: 0x0fea, 0x91b: 0x0ff2, 0x91c: 0x0ff6, 0x91d: 0x100a, - 0x91e: 0x1026, 0x91f: 0x102e, 0x920: 0x106e, 0x921: 0x1072, 0x922: 0x107a, 0x923: 0x107e, - 0x924: 0x1086, 0x925: 0x108a, 0x926: 0x10ae, 0x927: 0x10b2, 0x928: 0x10ce, 0x929: 0x10d2, - 0x92a: 0x10d6, 0x92b: 0x10da, 0x92c: 0x10ee, 0x92d: 0x1112, 0x92e: 0x1116, 0x92f: 0x111a, - 0x930: 0x113e, 0x931: 0x117e, 0x932: 0x1182, 0x933: 0x11a2, 0x934: 0x11b2, 0x935: 0x11ba, - 0x936: 0x11da, 0x937: 0x11fe, 0x938: 0x1242, 0x939: 0x124a, 0x93a: 0x125e, 0x93b: 0x126a, - 0x93c: 0x1272, 0x93d: 0x127a, 0x93e: 0x127e, 0x93f: 0x1282, - // Block 0x25, offset 0x940 - 0x940: 0x129a, 0x941: 0x129e, 0x942: 0x12ba, 0x943: 0x12c2, 0x944: 0x12ca, 0x945: 0x12ce, - 0x946: 0x12da, 0x947: 0x12e2, 0x948: 0x12e6, 0x949: 0x12ea, 0x94a: 0x12f2, 0x94b: 0x12f6, - 0x94c: 0x1396, 0x94d: 0x13aa, 0x94e: 0x13de, 0x94f: 0x13e2, 0x950: 0x13ea, 0x951: 0x1416, - 0x952: 0x141e, 0x953: 0x1426, 0x954: 0x142e, 0x955: 0x146a, 0x956: 0x146e, 0x957: 0x1476, - 0x958: 0x147a, 0x959: 0x147e, 0x95a: 0x14aa, 0x95b: 0x14ae, 0x95c: 0x14b6, 0x95d: 0x14ca, - 0x95e: 0x14ce, 0x95f: 0x14ea, 0x960: 0x14f2, 0x961: 0x14f6, 0x962: 0x151a, 0x963: 0x153a, - 0x964: 0x154e, 0x965: 0x1552, 0x966: 0x155a, 0x967: 0x1586, 0x968: 0x158a, 0x969: 0x159a, - 0x96a: 0x15be, 0x96b: 0x15ca, 0x96c: 0x15da, 0x96d: 0x15f2, 0x96e: 0x15fa, 0x96f: 0x15fe, - 0x970: 0x1602, 0x971: 0x1606, 0x972: 0x1612, 0x973: 0x1616, 0x974: 0x161e, 0x975: 0x163a, - 0x976: 0x163e, 0x977: 0x1642, 0x978: 0x165a, 0x979: 0x165e, 0x97a: 0x1666, 0x97b: 0x167a, - 0x97c: 0x167e, 0x97d: 0x1682, 0x97e: 0x168a, 0x97f: 0x168e, - // Block 0x26, offset 0x980 - 0x986: 0xa000, 0x98b: 0xa000, - 0x98c: 0x3f47, 0x98d: 0xa000, 0x98e: 0x3f4f, 0x98f: 0xa000, 0x990: 0x3f57, 0x991: 0xa000, - 0x992: 0x3f5f, 0x993: 0xa000, 0x994: 0x3f67, 0x995: 0xa000, 0x996: 0x3f6f, 0x997: 0xa000, - 0x998: 0x3f77, 0x999: 0xa000, 0x99a: 0x3f7f, 0x99b: 0xa000, 0x99c: 0x3f87, 0x99d: 0xa000, - 0x99e: 0x3f8f, 0x99f: 0xa000, 0x9a0: 0x3f97, 0x9a1: 0xa000, 0x9a2: 0x3f9f, - 0x9a4: 0xa000, 0x9a5: 0x3fa7, 0x9a6: 0xa000, 0x9a7: 0x3faf, 0x9a8: 0xa000, 0x9a9: 0x3fb7, - 0x9af: 0xa000, - 0x9b0: 0x3fbf, 0x9b1: 0x3fc7, 0x9b2: 0xa000, 0x9b3: 0x3fcf, 0x9b4: 0x3fd7, 0x9b5: 0xa000, - 0x9b6: 0x3fdf, 0x9b7: 0x3fe7, 0x9b8: 0xa000, 0x9b9: 0x3fef, 0x9ba: 0x3ff7, 0x9bb: 0xa000, - 0x9bc: 0x3fff, 0x9bd: 0x4007, - // Block 0x27, offset 0x9c0 - 0x9d4: 0x3f3f, - 0x9d9: 0x9904, 0x9da: 0x9904, 0x9db: 0x4395, 0x9dc: 0x439b, 0x9dd: 0xa000, - 0x9de: 0x400f, 0x9df: 0x27e4, - 0x9e6: 0xa000, - 0x9eb: 0xa000, 0x9ec: 0x401f, 0x9ed: 0xa000, 0x9ee: 0x4027, 0x9ef: 0xa000, - 0x9f0: 0x402f, 0x9f1: 0xa000, 0x9f2: 0x4037, 0x9f3: 0xa000, 0x9f4: 0x403f, 0x9f5: 0xa000, - 0x9f6: 0x4047, 0x9f7: 0xa000, 0x9f8: 0x404f, 0x9f9: 0xa000, 0x9fa: 0x4057, 0x9fb: 0xa000, - 0x9fc: 0x405f, 0x9fd: 0xa000, 0x9fe: 0x4067, 0x9ff: 0xa000, - // Block 0x28, offset 0xa00 - 0xa00: 0x406f, 0xa01: 0xa000, 0xa02: 0x4077, 0xa04: 0xa000, 0xa05: 0x407f, - 0xa06: 0xa000, 0xa07: 0x4087, 0xa08: 0xa000, 0xa09: 0x408f, - 0xa0f: 0xa000, 0xa10: 0x4097, 0xa11: 0x409f, - 0xa12: 0xa000, 0xa13: 0x40a7, 0xa14: 0x40af, 0xa15: 0xa000, 0xa16: 0x40b7, 0xa17: 0x40bf, - 0xa18: 0xa000, 0xa19: 0x40c7, 0xa1a: 0x40cf, 0xa1b: 0xa000, 0xa1c: 0x40d7, 0xa1d: 0x40df, - 0xa2f: 0xa000, - 0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x4017, - 0xa37: 0x40e7, 0xa38: 0x40ef, 0xa39: 0x40f7, 0xa3a: 0x40ff, - 0xa3d: 0xa000, 0xa3e: 0x4107, 0xa3f: 0x27f9, - // Block 0x29, offset 0xa40 - 0xa40: 0x045a, 0xa41: 0x041e, 0xa42: 0x0422, 0xa43: 0x0426, 0xa44: 0x046e, 0xa45: 0x042a, - 0xa46: 0x042e, 0xa47: 0x0432, 0xa48: 0x0436, 0xa49: 0x043a, 0xa4a: 0x043e, 0xa4b: 0x0442, - 0xa4c: 0x0446, 0xa4d: 0x044a, 0xa4e: 0x044e, 0xa4f: 0x4afe, 0xa50: 0x4b04, 0xa51: 0x4b0a, - 0xa52: 0x4b10, 0xa53: 0x4b16, 0xa54: 0x4b1c, 0xa55: 0x4b22, 0xa56: 0x4b28, 0xa57: 0x4b2e, - 0xa58: 0x4b34, 0xa59: 0x4b3a, 0xa5a: 0x4b40, 0xa5b: 0x4b46, 0xa5c: 0x4b4c, 0xa5d: 0x4b52, - 0xa5e: 0x4b58, 0xa5f: 0x4b5e, 0xa60: 0x4b64, 0xa61: 0x4b6a, 0xa62: 0x4b70, 0xa63: 0x4b76, - 0xa64: 0x04b6, 0xa65: 0x0452, 0xa66: 0x0456, 0xa67: 0x04da, 0xa68: 0x04de, 0xa69: 0x04e2, - 0xa6a: 0x04e6, 0xa6b: 0x04ea, 0xa6c: 0x04ee, 0xa6d: 0x04f2, 0xa6e: 0x045e, 0xa6f: 0x04f6, - 0xa70: 0x04fa, 0xa71: 0x0462, 0xa72: 0x0466, 0xa73: 0x046a, 0xa74: 0x0472, 0xa75: 0x0476, - 0xa76: 0x047a, 0xa77: 0x047e, 0xa78: 0x0482, 0xa79: 0x0486, 0xa7a: 0x048a, 0xa7b: 0x048e, - 0xa7c: 0x0492, 0xa7d: 0x0496, 0xa7e: 0x049a, 0xa7f: 0x049e, - // Block 0x2a, offset 0xa80 - 0xa80: 0x04a2, 0xa81: 0x04a6, 0xa82: 0x04fe, 0xa83: 0x0502, 0xa84: 0x04aa, 0xa85: 0x04ae, - 0xa86: 0x04b2, 0xa87: 0x04ba, 0xa88: 0x04be, 0xa89: 0x04c2, 0xa8a: 0x04c6, 0xa8b: 0x04ca, - 0xa8c: 0x04ce, 0xa8d: 0x04d2, 0xa8e: 0x04d6, - 0xa92: 0x07ba, 0xa93: 0x0816, 0xa94: 0x07c6, 0xa95: 0x0a76, 0xa96: 0x07ca, 0xa97: 0x07e2, - 0xa98: 0x07ce, 0xa99: 0x108e, 0xa9a: 0x0802, 0xa9b: 0x07d6, 0xa9c: 0x07be, 0xa9d: 0x0afa, - 0xa9e: 0x0a8a, 0xa9f: 0x082a, - // Block 0x2b, offset 0xac0 - 0xac0: 0x2184, 0xac1: 0x218a, 0xac2: 0x2190, 0xac3: 0x2196, 0xac4: 0x219c, 0xac5: 0x21a2, - 0xac6: 0x21a8, 0xac7: 0x21ae, 0xac8: 0x21b4, 0xac9: 0x21ba, 0xaca: 0x21c0, 0xacb: 0x21c6, - 0xacc: 0x21cc, 0xacd: 0x21d2, 0xace: 0x285d, 0xacf: 0x2866, 0xad0: 0x286f, 0xad1: 0x2878, - 0xad2: 0x2881, 0xad3: 0x288a, 0xad4: 0x2893, 0xad5: 0x289c, 0xad6: 0x28a5, 0xad7: 0x28b7, - 0xad8: 0x28c0, 0xad9: 0x28c9, 0xada: 0x28d2, 0xadb: 0x28db, 0xadc: 0x28ae, 0xadd: 0x2ce3, - 0xade: 0x2c24, 0xae0: 0x21d8, 0xae1: 0x21f0, 0xae2: 0x21e4, 0xae3: 0x2238, - 0xae4: 0x21f6, 0xae5: 0x2214, 0xae6: 0x21de, 0xae7: 0x220e, 0xae8: 0x21ea, 0xae9: 0x2220, - 0xaea: 0x2250, 0xaeb: 0x226e, 0xaec: 0x2268, 0xaed: 0x225c, 0xaee: 0x22aa, 0xaef: 0x223e, - 0xaf0: 0x224a, 0xaf1: 0x2262, 0xaf2: 0x2256, 0xaf3: 0x2280, 0xaf4: 0x222c, 0xaf5: 0x2274, - 0xaf6: 0x229e, 0xaf7: 0x2286, 0xaf8: 0x221a, 0xaf9: 0x21fc, 0xafa: 0x2232, 0xafb: 0x2244, - 0xafc: 0x227a, 0xafd: 0x2202, 0xafe: 0x22a4, 0xaff: 0x2226, - // Block 0x2c, offset 0xb00 - 0xb00: 0x228c, 0xb01: 0x2208, 0xb02: 0x2292, 0xb03: 0x2298, 0xb04: 0x0a2a, 0xb05: 0x0bfe, - 0xb06: 0x0da2, 0xb07: 0x11c2, - 0xb10: 0x1cf4, 0xb11: 0x19d6, - 0xb12: 0x19d9, 0xb13: 0x19dc, 0xb14: 0x19df, 0xb15: 0x19e2, 0xb16: 0x19e5, 0xb17: 0x19e8, - 0xb18: 0x19eb, 0xb19: 0x19ee, 0xb1a: 0x19f7, 0xb1b: 0x19fa, 0xb1c: 0x19fd, 0xb1d: 0x1a00, - 0xb1e: 0x1a03, 0xb1f: 0x1a06, 0xb20: 0x0406, 0xb21: 0x040e, 0xb22: 0x0412, 0xb23: 0x041a, - 0xb24: 0x041e, 0xb25: 0x0422, 0xb26: 0x042a, 0xb27: 0x0432, 0xb28: 0x0436, 0xb29: 0x043e, - 0xb2a: 0x0442, 0xb2b: 0x0446, 0xb2c: 0x044a, 0xb2d: 0x044e, 0xb2e: 0x467d, 0xb2f: 0x4685, - 0xb30: 0x468d, 0xb31: 0x4695, 0xb32: 0x469d, 0xb33: 0x46a5, 0xb34: 0x46ad, 0xb35: 0x46b5, - 0xb36: 0x46c5, 0xb37: 0x46cd, 0xb38: 0x46d5, 0xb39: 0x46dd, 0xb3a: 0x46e5, 0xb3b: 0x46ed, - 0xb3c: 0x2e42, 0xb3d: 0x2e0a, 0xb3e: 0x46bd, - // Block 0x2d, offset 0xb40 - 0xb40: 0x07ba, 0xb41: 0x0816, 0xb42: 0x07c6, 0xb43: 0x0a76, 0xb44: 0x081a, 0xb45: 0x08aa, - 0xb46: 0x07c2, 0xb47: 0x08a6, 0xb48: 0x0806, 0xb49: 0x0982, 0xb4a: 0x0e02, 0xb4b: 0x0f8a, - 0xb4c: 0x0ed2, 0xb4d: 0x0e16, 0xb4e: 0x155a, 0xb4f: 0x0a86, 0xb50: 0x0dca, 0xb51: 0x0e46, - 0xb52: 0x0e06, 0xb53: 0x1146, 0xb54: 0x09f6, 0xb55: 0x0ffe, 0xb56: 0x1482, 0xb57: 0x115a, - 0xb58: 0x093e, 0xb59: 0x118a, 0xb5a: 0x1096, 0xb5b: 0x0b12, 0xb5c: 0x150a, 0xb5d: 0x087a, - 0xb5e: 0x09a6, 0xb5f: 0x0ef2, 0xb60: 0x1622, 0xb61: 0x083e, 0xb62: 0x08ce, 0xb63: 0x0e96, - 0xb64: 0x07ca, 0xb65: 0x07e2, 0xb66: 0x07ce, 0xb67: 0x0bd6, 0xb68: 0x09ea, 0xb69: 0x097a, - 0xb6a: 0x0b52, 0xb6b: 0x0b46, 0xb6c: 0x10e6, 0xb6d: 0x083a, 0xb6e: 0x1496, 0xb6f: 0x0996, - 0xb70: 0x0aee, 0xb71: 0x1a09, 0xb72: 0x1a0c, 0xb73: 0x1a0f, 0xb74: 0x1a12, 0xb75: 0x1a1b, - 0xb76: 0x1a1e, 0xb77: 0x1a21, 0xb78: 0x1a24, 0xb79: 0x1a27, 0xb7a: 0x1a2a, 0xb7b: 0x1a2d, - 0xb7c: 0x1a30, 0xb7d: 0x1a33, 0xb7e: 0x1a36, 0xb7f: 0x1a3f, - // Block 0x2e, offset 0xb80 - 0xb80: 0x1df6, 0xb81: 0x1e05, 0xb82: 0x1e14, 0xb83: 0x1e23, 0xb84: 0x1e32, 0xb85: 0x1e41, - 0xb86: 0x1e50, 0xb87: 0x1e5f, 0xb88: 0x1e6e, 0xb89: 0x22bc, 0xb8a: 0x22ce, 0xb8b: 0x22e0, - 0xb8c: 0x1a81, 0xb8d: 0x1d34, 0xb8e: 0x1b02, 0xb8f: 0x1cd8, 0xb90: 0x05c6, 0xb91: 0x05ce, - 0xb92: 0x05d6, 0xb93: 0x05de, 0xb94: 0x05e6, 0xb95: 0x05ea, 0xb96: 0x05ee, 0xb97: 0x05f2, - 0xb98: 0x05f6, 0xb99: 0x05fa, 0xb9a: 0x05fe, 0xb9b: 0x0602, 0xb9c: 0x0606, 0xb9d: 0x060a, - 0xb9e: 0x060e, 0xb9f: 0x0612, 0xba0: 0x0616, 0xba1: 0x061e, 0xba2: 0x0622, 0xba3: 0x0626, - 0xba4: 0x062a, 0xba5: 0x062e, 0xba6: 0x0632, 0xba7: 0x0636, 0xba8: 0x063a, 0xba9: 0x063e, - 0xbaa: 0x0642, 0xbab: 0x0646, 0xbac: 0x064a, 0xbad: 0x064e, 0xbae: 0x0652, 0xbaf: 0x0656, - 0xbb0: 0x065a, 0xbb1: 0x065e, 0xbb2: 0x0662, 0xbb3: 0x066a, 0xbb4: 0x0672, 0xbb5: 0x067a, - 0xbb6: 0x067e, 0xbb7: 0x0682, 0xbb8: 0x0686, 0xbb9: 0x068a, 0xbba: 0x068e, 0xbbb: 0x0692, - 0xbbc: 0x0696, 0xbbd: 0x069a, 0xbbe: 0x069e, 0xbbf: 0x282a, - // Block 0x2f, offset 0xbc0 - 0xbc0: 0x2c43, 0xbc1: 0x2adf, 0xbc2: 0x2c53, 0xbc3: 0x29b7, 0xbc4: 0x2e53, 0xbc5: 0x29c1, - 0xbc6: 0x29cb, 0xbc7: 0x2e97, 0xbc8: 0x2aec, 0xbc9: 0x29d5, 0xbca: 0x29df, 0xbcb: 0x29e9, - 0xbcc: 0x2b13, 0xbcd: 0x2b20, 0xbce: 0x2af9, 0xbcf: 0x2b06, 0xbd0: 0x2e18, 0xbd1: 0x2b2d, - 0xbd2: 0x2b3a, 0xbd3: 0x2cf5, 0xbd4: 0x27eb, 0xbd5: 0x2d08, 0xbd6: 0x2d1b, 0xbd7: 0x2c63, - 0xbd8: 0x2b47, 0xbd9: 0x2d2e, 0xbda: 0x2d41, 0xbdb: 0x2b54, 0xbdc: 0x29f3, 0xbdd: 0x29fd, - 0xbde: 0x2e26, 0xbdf: 0x2b61, 0xbe0: 0x2c73, 0xbe1: 0x2e64, 0xbe2: 0x2a07, 0xbe3: 0x2a11, - 0xbe4: 0x2b6e, 0xbe5: 0x2a1b, 0xbe6: 0x2a25, 0xbe7: 0x2800, 0xbe8: 0x2807, 0xbe9: 0x2a2f, - 0xbea: 0x2a39, 0xbeb: 0x2d54, 0xbec: 0x2b7b, 0xbed: 0x2c83, 0xbee: 0x2d67, 0xbef: 0x2b88, - 0xbf0: 0x2a4d, 0xbf1: 0x2a43, 0xbf2: 0x2eab, 0xbf3: 0x2b95, 0xbf4: 0x2d7a, 0xbf5: 0x2a57, - 0xbf6: 0x2c93, 0xbf7: 0x2a61, 0xbf8: 0x2baf, 0xbf9: 0x2a6b, 0xbfa: 0x2bbc, 0xbfb: 0x2e75, - 0xbfc: 0x2ba2, 0xbfd: 0x2ca3, 0xbfe: 0x2bc9, 0xbff: 0x280e, - // Block 0x30, offset 0xc00 - 0xc00: 0x2e86, 0xc01: 0x2a75, 0xc02: 0x2a7f, 0xc03: 0x2bd6, 0xc04: 0x2a89, 0xc05: 0x2a93, - 0xc06: 0x2a9d, 0xc07: 0x2cb3, 0xc08: 0x2be3, 0xc09: 0x2815, 0xc0a: 0x2d8d, 0xc0b: 0x2dff, - 0xc0c: 0x2cc3, 0xc0d: 0x2bf0, 0xc0e: 0x2e34, 0xc0f: 0x2aa7, 0xc10: 0x2ab1, 0xc11: 0x2bfd, - 0xc12: 0x281c, 0xc13: 0x2c0a, 0xc14: 0x2cd3, 0xc15: 0x2823, 0xc16: 0x2da0, 0xc17: 0x2abb, - 0xc18: 0x1de7, 0xc19: 0x1dfb, 0xc1a: 0x1e0a, 0xc1b: 0x1e19, 0xc1c: 0x1e28, 0xc1d: 0x1e37, - 0xc1e: 0x1e46, 0xc1f: 0x1e55, 0xc20: 0x1e64, 0xc21: 0x1e73, 0xc22: 0x22c2, 0xc23: 0x22d4, - 0xc24: 0x22e6, 0xc25: 0x22f2, 0xc26: 0x22fe, 0xc27: 0x230a, 0xc28: 0x2316, 0xc29: 0x2322, - 0xc2a: 0x232e, 0xc2b: 0x233a, 0xc2c: 0x2376, 0xc2d: 0x2382, 0xc2e: 0x238e, 0xc2f: 0x239a, - 0xc30: 0x23a6, 0xc31: 0x1d44, 0xc32: 0x1af6, 0xc33: 0x1a63, 0xc34: 0x1d14, 0xc35: 0x1b77, - 0xc36: 0x1b86, 0xc37: 0x1afc, 0xc38: 0x1d2c, 0xc39: 0x1d30, 0xc3a: 0x1a8d, 0xc3b: 0x2838, - 0xc3c: 0x2846, 0xc3d: 0x2831, 0xc3e: 0x283f, 0xc3f: 0x2c17, - // Block 0x31, offset 0xc40 - 0xc40: 0x1b7a, 0xc41: 0x1b62, 0xc42: 0x1d90, 0xc43: 0x1b4a, 0xc44: 0x1b23, 0xc45: 0x1a96, - 0xc46: 0x1aa5, 0xc47: 0x1a75, 0xc48: 0x1d20, 0xc49: 0x1e82, 0xc4a: 0x1b7d, 0xc4b: 0x1b65, - 0xc4c: 0x1d94, 0xc4d: 0x1da0, 0xc4e: 0x1b56, 0xc4f: 0x1b2c, 0xc50: 0x1a84, 0xc51: 0x1d4c, - 0xc52: 0x1ce0, 0xc53: 0x1ccc, 0xc54: 0x1cfc, 0xc55: 0x1da4, 0xc56: 0x1b59, 0xc57: 0x1af9, - 0xc58: 0x1b2f, 0xc59: 0x1b0e, 0xc5a: 0x1b71, 0xc5b: 0x1da8, 0xc5c: 0x1b5c, 0xc5d: 0x1af0, - 0xc5e: 0x1b32, 0xc5f: 0x1d6c, 0xc60: 0x1d24, 0xc61: 0x1b44, 0xc62: 0x1d54, 0xc63: 0x1d70, - 0xc64: 0x1d28, 0xc65: 0x1b47, 0xc66: 0x1d58, 0xc67: 0x2418, 0xc68: 0x242c, 0xc69: 0x1ac6, - 0xc6a: 0x1d50, 0xc6b: 0x1ce4, 0xc6c: 0x1cd0, 0xc6d: 0x1d78, 0xc6e: 0x284d, 0xc6f: 0x28e4, - 0xc70: 0x1b89, 0xc71: 0x1b74, 0xc72: 0x1dac, 0xc73: 0x1b5f, 0xc74: 0x1b80, 0xc75: 0x1b68, - 0xc76: 0x1d98, 0xc77: 0x1b4d, 0xc78: 0x1b26, 0xc79: 0x1ab1, 0xc7a: 0x1b83, 0xc7b: 0x1b6b, - 0xc7c: 0x1d9c, 0xc7d: 0x1b50, 0xc7e: 0x1b29, 0xc7f: 0x1ab4, - // Block 0x32, offset 0xc80 - 0xc80: 0x1d5c, 0xc81: 0x1ce8, 0xc82: 0x1e7d, 0xc83: 0x1a66, 0xc84: 0x1aea, 0xc85: 0x1aed, - 0xc86: 0x2425, 0xc87: 0x1cc4, 0xc88: 0x1af3, 0xc89: 0x1a78, 0xc8a: 0x1b11, 0xc8b: 0x1a7b, - 0xc8c: 0x1b1a, 0xc8d: 0x1a99, 0xc8e: 0x1a9c, 0xc8f: 0x1b35, 0xc90: 0x1b3b, 0xc91: 0x1b3e, - 0xc92: 0x1d60, 0xc93: 0x1b41, 0xc94: 0x1b53, 0xc95: 0x1d68, 0xc96: 0x1d74, 0xc97: 0x1ac0, - 0xc98: 0x1e87, 0xc99: 0x1cec, 0xc9a: 0x1ac3, 0xc9b: 0x1b8c, 0xc9c: 0x1ad5, 0xc9d: 0x1ae4, - 0xc9e: 0x2412, 0xc9f: 0x240c, 0xca0: 0x1df1, 0xca1: 0x1e00, 0xca2: 0x1e0f, 0xca3: 0x1e1e, - 0xca4: 0x1e2d, 0xca5: 0x1e3c, 0xca6: 0x1e4b, 0xca7: 0x1e5a, 0xca8: 0x1e69, 0xca9: 0x22b6, - 0xcaa: 0x22c8, 0xcab: 0x22da, 0xcac: 0x22ec, 0xcad: 0x22f8, 0xcae: 0x2304, 0xcaf: 0x2310, - 0xcb0: 0x231c, 0xcb1: 0x2328, 0xcb2: 0x2334, 0xcb3: 0x2370, 0xcb4: 0x237c, 0xcb5: 0x2388, - 0xcb6: 0x2394, 0xcb7: 0x23a0, 0xcb8: 0x23ac, 0xcb9: 0x23b2, 0xcba: 0x23b8, 0xcbb: 0x23be, - 0xcbc: 0x23c4, 0xcbd: 0x23d6, 0xcbe: 0x23dc, 0xcbf: 0x1d40, - // Block 0x33, offset 0xcc0 - 0xcc0: 0x1472, 0xcc1: 0x0df6, 0xcc2: 0x14ce, 0xcc3: 0x149a, 0xcc4: 0x0f52, 0xcc5: 0x07e6, - 0xcc6: 0x09da, 0xcc7: 0x1726, 0xcc8: 0x1726, 0xcc9: 0x0b06, 0xcca: 0x155a, 0xccb: 0x0a3e, - 0xccc: 0x0b02, 0xccd: 0x0cea, 0xcce: 0x10ca, 0xccf: 0x125a, 0xcd0: 0x1392, 0xcd1: 0x13ce, - 0xcd2: 0x1402, 0xcd3: 0x1516, 0xcd4: 0x0e6e, 0xcd5: 0x0efa, 0xcd6: 0x0fa6, 0xcd7: 0x103e, - 0xcd8: 0x135a, 0xcd9: 0x1542, 0xcda: 0x166e, 0xcdb: 0x080a, 0xcdc: 0x09ae, 0xcdd: 0x0e82, - 0xcde: 0x0fca, 0xcdf: 0x138e, 0xce0: 0x16be, 0xce1: 0x0bae, 0xce2: 0x0f72, 0xce3: 0x137e, - 0xce4: 0x1412, 0xce5: 0x0d1e, 0xce6: 0x12b6, 0xce7: 0x13da, 0xce8: 0x0c1a, 0xce9: 0x0e0a, - 0xcea: 0x0f12, 0xceb: 0x1016, 0xcec: 0x1522, 0xced: 0x084a, 0xcee: 0x08e2, 0xcef: 0x094e, - 0xcf0: 0x0d86, 0xcf1: 0x0e7a, 0xcf2: 0x0fc6, 0xcf3: 0x10ea, 0xcf4: 0x1272, 0xcf5: 0x1386, - 0xcf6: 0x139e, 0xcf7: 0x14c2, 0xcf8: 0x15ea, 0xcf9: 0x169e, 0xcfa: 0x16ba, 0xcfb: 0x1126, - 0xcfc: 0x1166, 0xcfd: 0x121e, 0xcfe: 0x133e, 0xcff: 0x1576, - // Block 0x34, offset 0xd00 - 0xd00: 0x16c6, 0xd01: 0x1446, 0xd02: 0x0ac2, 0xd03: 0x0c36, 0xd04: 0x11d6, 0xd05: 0x1296, - 0xd06: 0x0ffa, 0xd07: 0x112e, 0xd08: 0x1492, 0xd09: 0x15e2, 0xd0a: 0x0abe, 0xd0b: 0x0b8a, - 0xd0c: 0x0e72, 0xd0d: 0x0f26, 0xd0e: 0x0f5a, 0xd0f: 0x120e, 0xd10: 0x1236, 0xd11: 0x15a2, - 0xd12: 0x094a, 0xd13: 0x12a2, 0xd14: 0x08ee, 0xd15: 0x08ea, 0xd16: 0x1192, 0xd17: 0x1222, - 0xd18: 0x1356, 0xd19: 0x15aa, 0xd1a: 0x1462, 0xd1b: 0x0d22, 0xd1c: 0x0e6e, 0xd1d: 0x1452, - 0xd1e: 0x07f2, 0xd1f: 0x0b5e, 0xd20: 0x0c8e, 0xd21: 0x102a, 0xd22: 0x10aa, 0xd23: 0x096e, - 0xd24: 0x1136, 0xd25: 0x085a, 0xd26: 0x0c72, 0xd27: 0x07d2, 0xd28: 0x0ee6, 0xd29: 0x0d9e, - 0xd2a: 0x120a, 0xd2b: 0x09c2, 0xd2c: 0x0aae, 0xd2d: 0x10f6, 0xd2e: 0x135e, 0xd2f: 0x1436, - 0xd30: 0x0eb2, 0xd31: 0x14f2, 0xd32: 0x0ede, 0xd33: 0x0d32, 0xd34: 0x1316, 0xd35: 0x0d52, - 0xd36: 0x10a6, 0xd37: 0x0826, 0xd38: 0x08a2, 0xd39: 0x08e6, 0xd3a: 0x0e4e, 0xd3b: 0x11f6, - 0xd3c: 0x12ee, 0xd3d: 0x1442, 0xd3e: 0x1556, 0xd3f: 0x0956, - // Block 0x35, offset 0xd40 - 0xd40: 0x0a0a, 0xd41: 0x0b12, 0xd42: 0x0c2a, 0xd43: 0x0dba, 0xd44: 0x0f76, 0xd45: 0x113a, - 0xd46: 0x1592, 0xd47: 0x1676, 0xd48: 0x16ca, 0xd49: 0x16e2, 0xd4a: 0x0932, 0xd4b: 0x0dee, - 0xd4c: 0x0e9e, 0xd4d: 0x14e6, 0xd4e: 0x0bf6, 0xd4f: 0x0cd2, 0xd50: 0x0cee, 0xd51: 0x0d7e, - 0xd52: 0x0f66, 0xd53: 0x0fb2, 0xd54: 0x1062, 0xd55: 0x1186, 0xd56: 0x122a, 0xd57: 0x128e, - 0xd58: 0x14d6, 0xd59: 0x1366, 0xd5a: 0x14fe, 0xd5b: 0x157a, 0xd5c: 0x090a, 0xd5d: 0x0936, - 0xd5e: 0x0a1e, 0xd5f: 0x0fa2, 0xd60: 0x13ee, 0xd61: 0x1436, 0xd62: 0x0c16, 0xd63: 0x0c86, - 0xd64: 0x0d4a, 0xd65: 0x0eaa, 0xd66: 0x11d2, 0xd67: 0x101e, 0xd68: 0x0836, 0xd69: 0x0a7a, - 0xd6a: 0x0b5e, 0xd6b: 0x0bc2, 0xd6c: 0x0c92, 0xd6d: 0x103a, 0xd6e: 0x1056, 0xd6f: 0x1266, - 0xd70: 0x1286, 0xd71: 0x155e, 0xd72: 0x15de, 0xd73: 0x15ee, 0xd74: 0x162a, 0xd75: 0x084e, - 0xd76: 0x117a, 0xd77: 0x154a, 0xd78: 0x15c6, 0xd79: 0x0caa, 0xd7a: 0x0812, 0xd7b: 0x0872, - 0xd7c: 0x0b62, 0xd7d: 0x0b82, 0xd7e: 0x0daa, 0xd7f: 0x0e6e, - // Block 0x36, offset 0xd80 - 0xd80: 0x0fbe, 0xd81: 0x10c6, 0xd82: 0x1372, 0xd83: 0x1512, 0xd84: 0x171e, 0xd85: 0x0dde, - 0xd86: 0x159e, 0xd87: 0x092e, 0xd88: 0x0e2a, 0xd89: 0x0e36, 0xd8a: 0x0f0a, 0xd8b: 0x0f42, - 0xd8c: 0x1046, 0xd8d: 0x10a2, 0xd8e: 0x1122, 0xd8f: 0x1206, 0xd90: 0x1636, 0xd91: 0x08aa, - 0xd92: 0x0cfe, 0xd93: 0x15ae, 0xd94: 0x0862, 0xd95: 0x0ba6, 0xd96: 0x0f2a, 0xd97: 0x14da, - 0xd98: 0x0c62, 0xd99: 0x0cb2, 0xd9a: 0x0e3e, 0xd9b: 0x102a, 0xd9c: 0x15b6, 0xd9d: 0x0912, - 0xd9e: 0x09fa, 0xd9f: 0x0b92, 0xda0: 0x0dce, 0xda1: 0x0e1a, 0xda2: 0x0e5a, 0xda3: 0x0eee, - 0xda4: 0x1042, 0xda5: 0x10b6, 0xda6: 0x1252, 0xda7: 0x13f2, 0xda8: 0x13fe, 0xda9: 0x1552, - 0xdaa: 0x15d2, 0xdab: 0x097e, 0xdac: 0x0f46, 0xdad: 0x09fe, 0xdae: 0x0fc2, 0xdaf: 0x1066, - 0xdb0: 0x1382, 0xdb1: 0x15ba, 0xdb2: 0x16a6, 0xdb3: 0x16ce, 0xdb4: 0x0e32, 0xdb5: 0x0f22, - 0xdb6: 0x12be, 0xdb7: 0x11b2, 0xdb8: 0x11be, 0xdb9: 0x11e2, 0xdba: 0x1012, 0xdbb: 0x0f9a, - 0xdbc: 0x145e, 0xdbd: 0x082e, 0xdbe: 0x1326, 0xdbf: 0x0916, - // Block 0x37, offset 0xdc0 - 0xdc0: 0x0906, 0xdc1: 0x0c06, 0xdc2: 0x0d26, 0xdc3: 0x11ee, 0xdc4: 0x0b4e, 0xdc5: 0x0efe, - 0xdc6: 0x0dea, 0xdc7: 0x14e2, 0xdc8: 0x13e2, 0xdc9: 0x15a6, 0xdca: 0x141e, 0xdcb: 0x0c22, - 0xdcc: 0x0882, 0xdcd: 0x0a56, 0xdd0: 0x0aaa, - 0xdd2: 0x0dda, 0xdd5: 0x08f2, 0xdd6: 0x101a, 0xdd7: 0x10de, - 0xdd8: 0x1142, 0xdd9: 0x115e, 0xdda: 0x1162, 0xddb: 0x1176, 0xddc: 0x15f6, 0xddd: 0x11e6, - 0xdde: 0x126a, 0xde0: 0x138a, 0xde2: 0x144e, - 0xde5: 0x1502, 0xde6: 0x152e, - 0xdea: 0x164a, 0xdeb: 0x164e, 0xdec: 0x1652, 0xded: 0x16b6, 0xdee: 0x1526, 0xdef: 0x15c2, - 0xdf0: 0x0852, 0xdf1: 0x0876, 0xdf2: 0x088a, 0xdf3: 0x0946, 0xdf4: 0x0952, 0xdf5: 0x0992, - 0xdf6: 0x0a46, 0xdf7: 0x0a62, 0xdf8: 0x0a6a, 0xdf9: 0x0aa6, 0xdfa: 0x0ab2, 0xdfb: 0x0b8e, - 0xdfc: 0x0b96, 0xdfd: 0x0c9e, 0xdfe: 0x0cc6, 0xdff: 0x0cce, - // Block 0x38, offset 0xe00 - 0xe00: 0x0ce6, 0xe01: 0x0d92, 0xe02: 0x0dc2, 0xe03: 0x0de2, 0xe04: 0x0e52, 0xe05: 0x0f16, - 0xe06: 0x0f32, 0xe07: 0x0f62, 0xe08: 0x0fb6, 0xe09: 0x0fd6, 0xe0a: 0x104a, 0xe0b: 0x112a, - 0xe0c: 0x1146, 0xe0d: 0x114e, 0xe0e: 0x114a, 0xe0f: 0x1152, 0xe10: 0x1156, 0xe11: 0x115a, - 0xe12: 0x116e, 0xe13: 0x1172, 0xe14: 0x1196, 0xe15: 0x11aa, 0xe16: 0x11c6, 0xe17: 0x122a, - 0xe18: 0x1232, 0xe19: 0x123a, 0xe1a: 0x124e, 0xe1b: 0x1276, 0xe1c: 0x12c6, 0xe1d: 0x12fa, - 0xe1e: 0x12fa, 0xe1f: 0x1362, 0xe20: 0x140a, 0xe21: 0x1422, 0xe22: 0x1456, 0xe23: 0x145a, - 0xe24: 0x149e, 0xe25: 0x14a2, 0xe26: 0x14fa, 0xe27: 0x1502, 0xe28: 0x15d6, 0xe29: 0x161a, - 0xe2a: 0x1632, 0xe2b: 0x0c96, 0xe2c: 0x184b, 0xe2d: 0x12de, - 0xe30: 0x07da, 0xe31: 0x08de, 0xe32: 0x089e, 0xe33: 0x0846, 0xe34: 0x0886, 0xe35: 0x08b2, - 0xe36: 0x0942, 0xe37: 0x095e, 0xe38: 0x0a46, 0xe39: 0x0a32, 0xe3a: 0x0a42, 0xe3b: 0x0a5e, - 0xe3c: 0x0aaa, 0xe3d: 0x0aba, 0xe3e: 0x0afe, 0xe3f: 0x0b0a, - // Block 0x39, offset 0xe40 - 0xe40: 0x0b26, 0xe41: 0x0b36, 0xe42: 0x0c1e, 0xe43: 0x0c26, 0xe44: 0x0c56, 0xe45: 0x0c76, - 0xe46: 0x0ca6, 0xe47: 0x0cbe, 0xe48: 0x0cae, 0xe49: 0x0cce, 0xe4a: 0x0cc2, 0xe4b: 0x0ce6, - 0xe4c: 0x0d02, 0xe4d: 0x0d5a, 0xe4e: 0x0d66, 0xe4f: 0x0d6e, 0xe50: 0x0d96, 0xe51: 0x0dda, - 0xe52: 0x0e0a, 0xe53: 0x0e0e, 0xe54: 0x0e22, 0xe55: 0x0ea2, 0xe56: 0x0eb2, 0xe57: 0x0f0a, - 0xe58: 0x0f56, 0xe59: 0x0f4e, 0xe5a: 0x0f62, 0xe5b: 0x0f7e, 0xe5c: 0x0fb6, 0xe5d: 0x110e, - 0xe5e: 0x0fda, 0xe5f: 0x100e, 0xe60: 0x101a, 0xe61: 0x105a, 0xe62: 0x1076, 0xe63: 0x109a, - 0xe64: 0x10be, 0xe65: 0x10c2, 0xe66: 0x10de, 0xe67: 0x10e2, 0xe68: 0x10f2, 0xe69: 0x1106, - 0xe6a: 0x1102, 0xe6b: 0x1132, 0xe6c: 0x11ae, 0xe6d: 0x11c6, 0xe6e: 0x11de, 0xe6f: 0x1216, - 0xe70: 0x122a, 0xe71: 0x1246, 0xe72: 0x1276, 0xe73: 0x132a, 0xe74: 0x1352, 0xe75: 0x13c6, - 0xe76: 0x140e, 0xe77: 0x141a, 0xe78: 0x1422, 0xe79: 0x143a, 0xe7a: 0x144e, 0xe7b: 0x143e, - 0xe7c: 0x1456, 0xe7d: 0x1452, 0xe7e: 0x144a, 0xe7f: 0x145a, - // Block 0x3a, offset 0xe80 - 0xe80: 0x1466, 0xe81: 0x14a2, 0xe82: 0x14de, 0xe83: 0x150e, 0xe84: 0x1546, 0xe85: 0x1566, - 0xe86: 0x15b2, 0xe87: 0x15d6, 0xe88: 0x15f6, 0xe89: 0x160a, 0xe8a: 0x161a, 0xe8b: 0x1626, - 0xe8c: 0x1632, 0xe8d: 0x1686, 0xe8e: 0x1726, 0xe8f: 0x17e2, 0xe90: 0x17dd, 0xe91: 0x180f, - 0xe92: 0x0702, 0xe93: 0x072a, 0xe94: 0x072e, 0xe95: 0x1891, 0xe96: 0x18be, 0xe97: 0x1936, - 0xe98: 0x1712, 0xe99: 0x1722, - // Block 0x3b, offset 0xec0 - 0xec0: 0x1b05, 0xec1: 0x1b08, 0xec2: 0x1b0b, 0xec3: 0x1d38, 0xec4: 0x1d3c, 0xec5: 0x1b8f, - 0xec6: 0x1b8f, - 0xed3: 0x1ea5, 0xed4: 0x1e96, 0xed5: 0x1e9b, 0xed6: 0x1eaa, 0xed7: 0x1ea0, - 0xedd: 0x4449, - 0xede: 0x8116, 0xedf: 0x44bb, 0xee0: 0x0320, 0xee1: 0x0308, 0xee2: 0x0311, 0xee3: 0x0314, - 0xee4: 0x0317, 0xee5: 0x031a, 0xee6: 0x031d, 0xee7: 0x0323, 0xee8: 0x0326, 0xee9: 0x0017, - 0xeea: 0x44a9, 0xeeb: 0x44af, 0xeec: 0x45ad, 0xeed: 0x45b5, 0xeee: 0x4401, 0xeef: 0x4407, - 0xef0: 0x440d, 0xef1: 0x4413, 0xef2: 0x441f, 0xef3: 0x4425, 0xef4: 0x442b, 0xef5: 0x4437, - 0xef6: 0x443d, 0xef8: 0x4443, 0xef9: 0x444f, 0xefa: 0x4455, 0xefb: 0x445b, - 0xefc: 0x4467, 0xefe: 0x446d, - // Block 0x3c, offset 0xf00 - 0xf00: 0x4473, 0xf01: 0x4479, 0xf03: 0x447f, 0xf04: 0x4485, - 0xf06: 0x4491, 0xf07: 0x4497, 0xf08: 0x449d, 0xf09: 0x44a3, 0xf0a: 0x44b5, 0xf0b: 0x4431, - 0xf0c: 0x4419, 0xf0d: 0x4461, 0xf0e: 0x448b, 0xf0f: 0x1eaf, 0xf10: 0x038c, 0xf11: 0x038c, - 0xf12: 0x0395, 0xf13: 0x0395, 0xf14: 0x0395, 0xf15: 0x0395, 0xf16: 0x0398, 0xf17: 0x0398, - 0xf18: 0x0398, 0xf19: 0x0398, 0xf1a: 0x039e, 0xf1b: 0x039e, 0xf1c: 0x039e, 0xf1d: 0x039e, - 0xf1e: 0x0392, 0xf1f: 0x0392, 0xf20: 0x0392, 0xf21: 0x0392, 0xf22: 0x039b, 0xf23: 0x039b, - 0xf24: 0x039b, 0xf25: 0x039b, 0xf26: 0x038f, 0xf27: 0x038f, 0xf28: 0x038f, 0xf29: 0x038f, - 0xf2a: 0x03c2, 0xf2b: 0x03c2, 0xf2c: 0x03c2, 0xf2d: 0x03c2, 0xf2e: 0x03c5, 0xf2f: 0x03c5, - 0xf30: 0x03c5, 0xf31: 0x03c5, 0xf32: 0x03a4, 0xf33: 0x03a4, 0xf34: 0x03a4, 0xf35: 0x03a4, - 0xf36: 0x03a1, 0xf37: 0x03a1, 0xf38: 0x03a1, 0xf39: 0x03a1, 0xf3a: 0x03a7, 0xf3b: 0x03a7, - 0xf3c: 0x03a7, 0xf3d: 0x03a7, 0xf3e: 0x03aa, 0xf3f: 0x03aa, - // Block 0x3d, offset 0xf40 - 0xf40: 0x03aa, 0xf41: 0x03aa, 0xf42: 0x03b3, 0xf43: 0x03b3, 0xf44: 0x03b0, 0xf45: 0x03b0, - 0xf46: 0x03b6, 0xf47: 0x03b6, 0xf48: 0x03ad, 0xf49: 0x03ad, 0xf4a: 0x03bc, 0xf4b: 0x03bc, - 0xf4c: 0x03b9, 0xf4d: 0x03b9, 0xf4e: 0x03c8, 0xf4f: 0x03c8, 0xf50: 0x03c8, 0xf51: 0x03c8, - 0xf52: 0x03ce, 0xf53: 0x03ce, 0xf54: 0x03ce, 0xf55: 0x03ce, 0xf56: 0x03d4, 0xf57: 0x03d4, - 0xf58: 0x03d4, 0xf59: 0x03d4, 0xf5a: 0x03d1, 0xf5b: 0x03d1, 0xf5c: 0x03d1, 0xf5d: 0x03d1, - 0xf5e: 0x03d7, 0xf5f: 0x03d7, 0xf60: 0x03da, 0xf61: 0x03da, 0xf62: 0x03da, 0xf63: 0x03da, - 0xf64: 0x4527, 0xf65: 0x4527, 0xf66: 0x03e0, 0xf67: 0x03e0, 0xf68: 0x03e0, 0xf69: 0x03e0, - 0xf6a: 0x03dd, 0xf6b: 0x03dd, 0xf6c: 0x03dd, 0xf6d: 0x03dd, 0xf6e: 0x03fb, 0xf6f: 0x03fb, - 0xf70: 0x4521, 0xf71: 0x4521, - // Block 0x3e, offset 0xf80 - 0xf93: 0x03cb, 0xf94: 0x03cb, 0xf95: 0x03cb, 0xf96: 0x03cb, 0xf97: 0x03e9, - 0xf98: 0x03e9, 0xf99: 0x03e6, 0xf9a: 0x03e6, 0xf9b: 0x03ec, 0xf9c: 0x03ec, 0xf9d: 0x217f, - 0xf9e: 0x03f2, 0xf9f: 0x03f2, 0xfa0: 0x03e3, 0xfa1: 0x03e3, 0xfa2: 0x03ef, 0xfa3: 0x03ef, - 0xfa4: 0x03f8, 0xfa5: 0x03f8, 0xfa6: 0x03f8, 0xfa7: 0x03f8, 0xfa8: 0x0380, 0xfa9: 0x0380, - 0xfaa: 0x26da, 0xfab: 0x26da, 0xfac: 0x274a, 0xfad: 0x274a, 0xfae: 0x2719, 0xfaf: 0x2719, - 0xfb0: 0x2735, 0xfb1: 0x2735, 0xfb2: 0x272e, 0xfb3: 0x272e, 0xfb4: 0x273c, 0xfb5: 0x273c, - 0xfb6: 0x2743, 0xfb7: 0x2743, 0xfb8: 0x2743, 0xfb9: 0x2720, 0xfba: 0x2720, 0xfbb: 0x2720, - 0xfbc: 0x03f5, 0xfbd: 0x03f5, 0xfbe: 0x03f5, 0xfbf: 0x03f5, - // Block 0x3f, offset 0xfc0 - 0xfc0: 0x26e1, 0xfc1: 0x26e8, 0xfc2: 0x2704, 0xfc3: 0x2720, 0xfc4: 0x2727, 0xfc5: 0x1eb9, - 0xfc6: 0x1ebe, 0xfc7: 0x1ec3, 0xfc8: 0x1ed2, 0xfc9: 0x1ee1, 0xfca: 0x1ee6, 0xfcb: 0x1eeb, - 0xfcc: 0x1ef0, 0xfcd: 0x1ef5, 0xfce: 0x1f04, 0xfcf: 0x1f13, 0xfd0: 0x1f18, 0xfd1: 0x1f1d, - 0xfd2: 0x1f2c, 0xfd3: 0x1f3b, 0xfd4: 0x1f40, 0xfd5: 0x1f45, 0xfd6: 0x1f4a, 0xfd7: 0x1f59, - 0xfd8: 0x1f5e, 0xfd9: 0x1f6d, 0xfda: 0x1f72, 0xfdb: 0x1f77, 0xfdc: 0x1f86, 0xfdd: 0x1f8b, - 0xfde: 0x1f90, 0xfdf: 0x1f9a, 0xfe0: 0x1fd6, 0xfe1: 0x1fe5, 0xfe2: 0x1ff4, 0xfe3: 0x1ff9, - 0xfe4: 0x1ffe, 0xfe5: 0x2008, 0xfe6: 0x2017, 0xfe7: 0x201c, 0xfe8: 0x202b, 0xfe9: 0x2030, - 0xfea: 0x2035, 0xfeb: 0x2044, 0xfec: 0x2049, 0xfed: 0x2058, 0xfee: 0x205d, 0xfef: 0x2062, - 0xff0: 0x2067, 0xff1: 0x206c, 0xff2: 0x2071, 0xff3: 0x2076, 0xff4: 0x207b, 0xff5: 0x2080, - 0xff6: 0x2085, 0xff7: 0x208a, 0xff8: 0x208f, 0xff9: 0x2094, 0xffa: 0x2099, 0xffb: 0x209e, - 0xffc: 0x20a3, 0xffd: 0x20a8, 0xffe: 0x20ad, 0xfff: 0x20b7, - // Block 0x40, offset 0x1000 - 0x1000: 0x20bc, 0x1001: 0x20c1, 0x1002: 0x20c6, 0x1003: 0x20d0, 0x1004: 0x20d5, 0x1005: 0x20df, - 0x1006: 0x20e4, 0x1007: 0x20e9, 0x1008: 0x20ee, 0x1009: 0x20f3, 0x100a: 0x20f8, 0x100b: 0x20fd, - 0x100c: 0x2102, 0x100d: 0x2107, 0x100e: 0x2116, 0x100f: 0x2125, 0x1010: 0x212a, 0x1011: 0x212f, - 0x1012: 0x2134, 0x1013: 0x2139, 0x1014: 0x213e, 0x1015: 0x2148, 0x1016: 0x214d, 0x1017: 0x2152, - 0x1018: 0x2161, 0x1019: 0x2170, 0x101a: 0x2175, 0x101b: 0x44d9, 0x101c: 0x44df, 0x101d: 0x4515, - 0x101e: 0x456c, 0x101f: 0x4573, 0x1020: 0x457a, 0x1021: 0x4581, 0x1022: 0x4588, 0x1023: 0x458f, - 0x1024: 0x26f6, 0x1025: 0x26fd, 0x1026: 0x2704, 0x1027: 0x270b, 0x1028: 0x2720, 0x1029: 0x2727, - 0x102a: 0x1ec8, 0x102b: 0x1ecd, 0x102c: 0x1ed2, 0x102d: 0x1ed7, 0x102e: 0x1ee1, 0x102f: 0x1ee6, - 0x1030: 0x1efa, 0x1031: 0x1eff, 0x1032: 0x1f04, 0x1033: 0x1f09, 0x1034: 0x1f13, 0x1035: 0x1f18, - 0x1036: 0x1f22, 0x1037: 0x1f27, 0x1038: 0x1f2c, 0x1039: 0x1f31, 0x103a: 0x1f3b, 0x103b: 0x1f40, - 0x103c: 0x206c, 0x103d: 0x2071, 0x103e: 0x2080, 0x103f: 0x2085, - // Block 0x41, offset 0x1040 - 0x1040: 0x208a, 0x1041: 0x209e, 0x1042: 0x20a3, 0x1043: 0x20a8, 0x1044: 0x20ad, 0x1045: 0x20c6, - 0x1046: 0x20d0, 0x1047: 0x20d5, 0x1048: 0x20da, 0x1049: 0x20ee, 0x104a: 0x210c, 0x104b: 0x2111, - 0x104c: 0x2116, 0x104d: 0x211b, 0x104e: 0x2125, 0x104f: 0x212a, 0x1050: 0x4515, 0x1051: 0x2157, - 0x1052: 0x215c, 0x1053: 0x2161, 0x1054: 0x2166, 0x1055: 0x2170, 0x1056: 0x2175, 0x1057: 0x26e1, - 0x1058: 0x26e8, 0x1059: 0x26ef, 0x105a: 0x2704, 0x105b: 0x2712, 0x105c: 0x1eb9, 0x105d: 0x1ebe, - 0x105e: 0x1ec3, 0x105f: 0x1ed2, 0x1060: 0x1edc, 0x1061: 0x1eeb, 0x1062: 0x1ef0, 0x1063: 0x1ef5, - 0x1064: 0x1f04, 0x1065: 0x1f0e, 0x1066: 0x1f2c, 0x1067: 0x1f45, 0x1068: 0x1f4a, 0x1069: 0x1f59, - 0x106a: 0x1f5e, 0x106b: 0x1f6d, 0x106c: 0x1f77, 0x106d: 0x1f86, 0x106e: 0x1f8b, 0x106f: 0x1f90, - 0x1070: 0x1f9a, 0x1071: 0x1fd6, 0x1072: 0x1fdb, 0x1073: 0x1fe5, 0x1074: 0x1ff4, 0x1075: 0x1ff9, - 0x1076: 0x1ffe, 0x1077: 0x2008, 0x1078: 0x2017, 0x1079: 0x202b, 0x107a: 0x2030, 0x107b: 0x2035, - 0x107c: 0x2044, 0x107d: 0x2049, 0x107e: 0x2058, 0x107f: 0x205d, - // Block 0x42, offset 0x1080 - 0x1080: 0x2062, 0x1081: 0x2067, 0x1082: 0x2076, 0x1083: 0x207b, 0x1084: 0x208f, 0x1085: 0x2094, - 0x1086: 0x2099, 0x1087: 0x209e, 0x1088: 0x20a3, 0x1089: 0x20b7, 0x108a: 0x20bc, 0x108b: 0x20c1, - 0x108c: 0x20c6, 0x108d: 0x20cb, 0x108e: 0x20df, 0x108f: 0x20e4, 0x1090: 0x20e9, 0x1091: 0x20ee, - 0x1092: 0x20fd, 0x1093: 0x2102, 0x1094: 0x2107, 0x1095: 0x2116, 0x1096: 0x2120, 0x1097: 0x212f, - 0x1098: 0x2134, 0x1099: 0x4509, 0x109a: 0x2148, 0x109b: 0x214d, 0x109c: 0x2152, 0x109d: 0x2161, - 0x109e: 0x216b, 0x109f: 0x2704, 0x10a0: 0x2712, 0x10a1: 0x1ed2, 0x10a2: 0x1edc, 0x10a3: 0x1f04, - 0x10a4: 0x1f0e, 0x10a5: 0x1f2c, 0x10a6: 0x1f36, 0x10a7: 0x1f9a, 0x10a8: 0x1f9f, 0x10a9: 0x1fc2, - 0x10aa: 0x1fc7, 0x10ab: 0x209e, 0x10ac: 0x20a3, 0x10ad: 0x20c6, 0x10ae: 0x2116, 0x10af: 0x2120, - 0x10b0: 0x2161, 0x10b1: 0x216b, 0x10b2: 0x45bd, 0x10b3: 0x45c5, 0x10b4: 0x45cd, 0x10b5: 0x2021, - 0x10b6: 0x2026, 0x10b7: 0x203a, 0x10b8: 0x203f, 0x10b9: 0x204e, 0x10ba: 0x2053, 0x10bb: 0x1fa4, - 0x10bc: 0x1fa9, 0x10bd: 0x1fcc, 0x10be: 0x1fd1, 0x10bf: 0x1f63, - // Block 0x43, offset 0x10c0 - 0x10c0: 0x1f68, 0x10c1: 0x1f4f, 0x10c2: 0x1f54, 0x10c3: 0x1f7c, 0x10c4: 0x1f81, 0x10c5: 0x1fea, - 0x10c6: 0x1fef, 0x10c7: 0x200d, 0x10c8: 0x2012, 0x10c9: 0x1fae, 0x10ca: 0x1fb3, 0x10cb: 0x1fb8, - 0x10cc: 0x1fc2, 0x10cd: 0x1fbd, 0x10ce: 0x1f95, 0x10cf: 0x1fe0, 0x10d0: 0x2003, 0x10d1: 0x2021, - 0x10d2: 0x2026, 0x10d3: 0x203a, 0x10d4: 0x203f, 0x10d5: 0x204e, 0x10d6: 0x2053, 0x10d7: 0x1fa4, - 0x10d8: 0x1fa9, 0x10d9: 0x1fcc, 0x10da: 0x1fd1, 0x10db: 0x1f63, 0x10dc: 0x1f68, 0x10dd: 0x1f4f, - 0x10de: 0x1f54, 0x10df: 0x1f7c, 0x10e0: 0x1f81, 0x10e1: 0x1fea, 0x10e2: 0x1fef, 0x10e3: 0x200d, - 0x10e4: 0x2012, 0x10e5: 0x1fae, 0x10e6: 0x1fb3, 0x10e7: 0x1fb8, 0x10e8: 0x1fc2, 0x10e9: 0x1fbd, - 0x10ea: 0x1f95, 0x10eb: 0x1fe0, 0x10ec: 0x2003, 0x10ed: 0x1fae, 0x10ee: 0x1fb3, 0x10ef: 0x1fb8, - 0x10f0: 0x1fc2, 0x10f1: 0x1f9f, 0x10f2: 0x1fc7, 0x10f3: 0x201c, 0x10f4: 0x1f86, 0x10f5: 0x1f8b, - 0x10f6: 0x1f90, 0x10f7: 0x1fae, 0x10f8: 0x1fb3, 0x10f9: 0x1fb8, 0x10fa: 0x201c, 0x10fb: 0x202b, - 0x10fc: 0x44c1, 0x10fd: 0x44c1, - // Block 0x44, offset 0x1100 - 0x1110: 0x2441, 0x1111: 0x2456, - 0x1112: 0x2456, 0x1113: 0x245d, 0x1114: 0x2464, 0x1115: 0x2479, 0x1116: 0x2480, 0x1117: 0x2487, - 0x1118: 0x24aa, 0x1119: 0x24aa, 0x111a: 0x24cd, 0x111b: 0x24c6, 0x111c: 0x24e2, 0x111d: 0x24d4, - 0x111e: 0x24db, 0x111f: 0x24fe, 0x1120: 0x24fe, 0x1121: 0x24f7, 0x1122: 0x2505, 0x1123: 0x2505, - 0x1124: 0x252f, 0x1125: 0x252f, 0x1126: 0x254b, 0x1127: 0x2513, 0x1128: 0x2513, 0x1129: 0x250c, - 0x112a: 0x2521, 0x112b: 0x2521, 0x112c: 0x2528, 0x112d: 0x2528, 0x112e: 0x2552, 0x112f: 0x2560, - 0x1130: 0x2560, 0x1131: 0x2567, 0x1132: 0x2567, 0x1133: 0x256e, 0x1134: 0x2575, 0x1135: 0x257c, - 0x1136: 0x2583, 0x1137: 0x2583, 0x1138: 0x258a, 0x1139: 0x2598, 0x113a: 0x25a6, 0x113b: 0x259f, - 0x113c: 0x25ad, 0x113d: 0x25ad, 0x113e: 0x25c2, 0x113f: 0x25c9, - // Block 0x45, offset 0x1140 - 0x1140: 0x25fa, 0x1141: 0x2608, 0x1142: 0x2601, 0x1143: 0x25e5, 0x1144: 0x25e5, 0x1145: 0x260f, - 0x1146: 0x260f, 0x1147: 0x2616, 0x1148: 0x2616, 0x1149: 0x2640, 0x114a: 0x2647, 0x114b: 0x264e, - 0x114c: 0x2624, 0x114d: 0x2632, 0x114e: 0x2655, 0x114f: 0x265c, - 0x1152: 0x262b, 0x1153: 0x26b0, 0x1154: 0x26b7, 0x1155: 0x268d, 0x1156: 0x2694, 0x1157: 0x2678, - 0x1158: 0x2678, 0x1159: 0x267f, 0x115a: 0x26a9, 0x115b: 0x26a2, 0x115c: 0x26cc, 0x115d: 0x26cc, - 0x115e: 0x243a, 0x115f: 0x244f, 0x1160: 0x2448, 0x1161: 0x2472, 0x1162: 0x246b, 0x1163: 0x2495, - 0x1164: 0x248e, 0x1165: 0x24b8, 0x1166: 0x249c, 0x1167: 0x24b1, 0x1168: 0x24e9, 0x1169: 0x2536, - 0x116a: 0x251a, 0x116b: 0x2559, 0x116c: 0x25f3, 0x116d: 0x261d, 0x116e: 0x26c5, 0x116f: 0x26be, - 0x1170: 0x26d3, 0x1171: 0x266a, 0x1172: 0x25d0, 0x1173: 0x269b, 0x1174: 0x25c2, 0x1175: 0x25fa, - 0x1176: 0x2591, 0x1177: 0x25de, 0x1178: 0x2671, 0x1179: 0x2663, 0x117a: 0x25ec, 0x117b: 0x25d7, - 0x117c: 0x25ec, 0x117d: 0x2671, 0x117e: 0x24a3, 0x117f: 0x24bf, - // Block 0x46, offset 0x1180 - 0x1180: 0x2639, 0x1181: 0x25b4, 0x1182: 0x2433, 0x1183: 0x25d7, 0x1184: 0x257c, 0x1185: 0x254b, - 0x1186: 0x24f0, 0x1187: 0x2686, - 0x11b0: 0x2544, 0x11b1: 0x25bb, 0x11b2: 0x28f6, 0x11b3: 0x28ed, 0x11b4: 0x2923, 0x11b5: 0x2911, - 0x11b6: 0x28ff, 0x11b7: 0x291a, 0x11b8: 0x292c, 0x11b9: 0x253d, 0x11ba: 0x2db3, 0x11bb: 0x2c33, - 0x11bc: 0x2908, - // Block 0x47, offset 0x11c0 - 0x11d0: 0x0019, 0x11d1: 0x057e, - 0x11d2: 0x0582, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x05ba, - 0x11d8: 0x05be, 0x11d9: 0x1c8c, - 0x11e0: 0x8133, 0x11e1: 0x8133, 0x11e2: 0x8133, 0x11e3: 0x8133, - 0x11e4: 0x8133, 0x11e5: 0x8133, 0x11e6: 0x8133, 0x11e7: 0x812e, 0x11e8: 0x812e, 0x11e9: 0x812e, - 0x11ea: 0x812e, 0x11eb: 0x812e, 0x11ec: 0x812e, 0x11ed: 0x812e, 0x11ee: 0x8133, 0x11ef: 0x8133, - 0x11f0: 0x19a0, 0x11f1: 0x053a, 0x11f2: 0x0536, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011, - 0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x05b2, 0x11fa: 0x05b6, 0x11fb: 0x05a6, - 0x11fc: 0x05aa, 0x11fd: 0x058e, 0x11fe: 0x0592, 0x11ff: 0x0586, - // Block 0x48, offset 0x1200 - 0x1200: 0x058a, 0x1201: 0x0596, 0x1202: 0x059a, 0x1203: 0x059e, 0x1204: 0x05a2, - 0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x4322, 0x120a: 0x4322, 0x120b: 0x4322, - 0x120c: 0x4322, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x057e, - 0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003, - 0x1218: 0x053a, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x05b2, - 0x121e: 0x05b6, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b, - 0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009, - 0x122a: 0x000b, 0x122b: 0x0041, - 0x1230: 0x4363, 0x1231: 0x44e5, 0x1232: 0x4368, 0x1234: 0x436d, - 0x1236: 0x4372, 0x1237: 0x44eb, 0x1238: 0x4377, 0x1239: 0x44f1, 0x123a: 0x437c, 0x123b: 0x44f7, - 0x123c: 0x4381, 0x123d: 0x44fd, 0x123e: 0x4386, 0x123f: 0x4503, - // Block 0x49, offset 0x1240 - 0x1240: 0x0329, 0x1241: 0x44c7, 0x1242: 0x44c7, 0x1243: 0x44cd, 0x1244: 0x44cd, 0x1245: 0x450f, - 0x1246: 0x450f, 0x1247: 0x44d3, 0x1248: 0x44d3, 0x1249: 0x451b, 0x124a: 0x451b, 0x124b: 0x451b, - 0x124c: 0x451b, 0x124d: 0x032c, 0x124e: 0x032c, 0x124f: 0x032f, 0x1250: 0x032f, 0x1251: 0x032f, - 0x1252: 0x032f, 0x1253: 0x0332, 0x1254: 0x0332, 0x1255: 0x0335, 0x1256: 0x0335, 0x1257: 0x0335, - 0x1258: 0x0335, 0x1259: 0x0338, 0x125a: 0x0338, 0x125b: 0x0338, 0x125c: 0x0338, 0x125d: 0x033b, - 0x125e: 0x033b, 0x125f: 0x033b, 0x1260: 0x033b, 0x1261: 0x033e, 0x1262: 0x033e, 0x1263: 0x033e, - 0x1264: 0x033e, 0x1265: 0x0341, 0x1266: 0x0341, 0x1267: 0x0341, 0x1268: 0x0341, 0x1269: 0x0344, - 0x126a: 0x0344, 0x126b: 0x0347, 0x126c: 0x0347, 0x126d: 0x034a, 0x126e: 0x034a, 0x126f: 0x034d, - 0x1270: 0x034d, 0x1271: 0x0350, 0x1272: 0x0350, 0x1273: 0x0350, 0x1274: 0x0350, 0x1275: 0x0353, - 0x1276: 0x0353, 0x1277: 0x0353, 0x1278: 0x0353, 0x1279: 0x0356, 0x127a: 0x0356, 0x127b: 0x0356, - 0x127c: 0x0356, 0x127d: 0x0359, 0x127e: 0x0359, 0x127f: 0x0359, - // Block 0x4a, offset 0x1280 - 0x1280: 0x0359, 0x1281: 0x035c, 0x1282: 0x035c, 0x1283: 0x035c, 0x1284: 0x035c, 0x1285: 0x035f, - 0x1286: 0x035f, 0x1287: 0x035f, 0x1288: 0x035f, 0x1289: 0x0362, 0x128a: 0x0362, 0x128b: 0x0362, - 0x128c: 0x0362, 0x128d: 0x0365, 0x128e: 0x0365, 0x128f: 0x0365, 0x1290: 0x0365, 0x1291: 0x0368, - 0x1292: 0x0368, 0x1293: 0x0368, 0x1294: 0x0368, 0x1295: 0x036b, 0x1296: 0x036b, 0x1297: 0x036b, - 0x1298: 0x036b, 0x1299: 0x036e, 0x129a: 0x036e, 0x129b: 0x036e, 0x129c: 0x036e, 0x129d: 0x0371, - 0x129e: 0x0371, 0x129f: 0x0371, 0x12a0: 0x0371, 0x12a1: 0x0374, 0x12a2: 0x0374, 0x12a3: 0x0374, - 0x12a4: 0x0374, 0x12a5: 0x0377, 0x12a6: 0x0377, 0x12a7: 0x0377, 0x12a8: 0x0377, 0x12a9: 0x037a, - 0x12aa: 0x037a, 0x12ab: 0x037a, 0x12ac: 0x037a, 0x12ad: 0x037d, 0x12ae: 0x037d, 0x12af: 0x0380, - 0x12b0: 0x0380, 0x12b1: 0x0383, 0x12b2: 0x0383, 0x12b3: 0x0383, 0x12b4: 0x0383, 0x12b5: 0x2de7, - 0x12b6: 0x2de7, 0x12b7: 0x2def, 0x12b8: 0x2def, 0x12b9: 0x2df7, 0x12ba: 0x2df7, 0x12bb: 0x20b2, - 0x12bc: 0x20b2, - // Block 0x4b, offset 0x12c0 - 0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b, - 0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097, - 0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3, - 0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af, - 0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb, - 0x12de: 0x00bd, 0x12df: 0x056e, 0x12e0: 0x0572, 0x12e1: 0x0582, 0x12e2: 0x0596, 0x12e3: 0x059a, - 0x12e4: 0x057e, 0x12e5: 0x06a6, 0x12e6: 0x069e, 0x12e7: 0x05c2, 0x12e8: 0x05ca, 0x12e9: 0x05d2, - 0x12ea: 0x05da, 0x12eb: 0x05e2, 0x12ec: 0x0666, 0x12ed: 0x066e, 0x12ee: 0x0676, 0x12ef: 0x061a, - 0x12f0: 0x06aa, 0x12f1: 0x05c6, 0x12f2: 0x05ce, 0x12f3: 0x05d6, 0x12f4: 0x05de, 0x12f5: 0x05e6, - 0x12f6: 0x05ea, 0x12f7: 0x05ee, 0x12f8: 0x05f2, 0x12f9: 0x05f6, 0x12fa: 0x05fa, 0x12fb: 0x05fe, - 0x12fc: 0x0602, 0x12fd: 0x0606, 0x12fe: 0x060a, 0x12ff: 0x060e, - // Block 0x4c, offset 0x1300 - 0x1300: 0x0612, 0x1301: 0x0616, 0x1302: 0x061e, 0x1303: 0x0622, 0x1304: 0x0626, 0x1305: 0x062a, - 0x1306: 0x062e, 0x1307: 0x0632, 0x1308: 0x0636, 0x1309: 0x063a, 0x130a: 0x063e, 0x130b: 0x0642, - 0x130c: 0x0646, 0x130d: 0x064a, 0x130e: 0x064e, 0x130f: 0x0652, 0x1310: 0x0656, 0x1311: 0x065a, - 0x1312: 0x065e, 0x1313: 0x0662, 0x1314: 0x066a, 0x1315: 0x0672, 0x1316: 0x067a, 0x1317: 0x067e, - 0x1318: 0x0682, 0x1319: 0x0686, 0x131a: 0x068a, 0x131b: 0x068e, 0x131c: 0x0692, 0x131d: 0x06a2, - 0x131e: 0x4bb9, 0x131f: 0x4bbf, 0x1320: 0x04b6, 0x1321: 0x0406, 0x1322: 0x040a, 0x1323: 0x4b7c, - 0x1324: 0x040e, 0x1325: 0x4b82, 0x1326: 0x4b88, 0x1327: 0x0412, 0x1328: 0x0416, 0x1329: 0x041a, - 0x132a: 0x4b8e, 0x132b: 0x4b94, 0x132c: 0x4b9a, 0x132d: 0x4ba0, 0x132e: 0x4ba6, 0x132f: 0x4bac, - 0x1330: 0x045a, 0x1331: 0x041e, 0x1332: 0x0422, 0x1333: 0x0426, 0x1334: 0x046e, 0x1335: 0x042a, - 0x1336: 0x042e, 0x1337: 0x0432, 0x1338: 0x0436, 0x1339: 0x043a, 0x133a: 0x043e, 0x133b: 0x0442, - 0x133c: 0x0446, 0x133d: 0x044a, 0x133e: 0x044e, - // Block 0x4d, offset 0x1340 - 0x1342: 0x4afe, 0x1343: 0x4b04, 0x1344: 0x4b0a, 0x1345: 0x4b10, - 0x1346: 0x4b16, 0x1347: 0x4b1c, 0x134a: 0x4b22, 0x134b: 0x4b28, - 0x134c: 0x4b2e, 0x134d: 0x4b34, 0x134e: 0x4b3a, 0x134f: 0x4b40, - 0x1352: 0x4b46, 0x1353: 0x4b4c, 0x1354: 0x4b52, 0x1355: 0x4b58, 0x1356: 0x4b5e, 0x1357: 0x4b64, - 0x135a: 0x4b6a, 0x135b: 0x4b70, 0x135c: 0x4b76, - 0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x431d, - 0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x053e, 0x1368: 0x0562, 0x1369: 0x0542, - 0x136a: 0x0546, 0x136b: 0x054a, 0x136c: 0x054e, 0x136d: 0x0566, 0x136e: 0x056a, - // Block 0x4e, offset 0x1380 - 0x1381: 0x01f1, 0x1382: 0x01f4, 0x1383: 0x00d4, 0x1384: 0x01be, 0x1385: 0x010d, - 0x1387: 0x01d3, 0x1388: 0x174e, 0x1389: 0x01d9, 0x138a: 0x01d6, 0x138b: 0x0116, - 0x138c: 0x0119, 0x138d: 0x0526, 0x138e: 0x011c, 0x138f: 0x0128, 0x1390: 0x01e5, 0x1391: 0x013a, - 0x1392: 0x0134, 0x1393: 0x012e, 0x1394: 0x01c1, 0x1395: 0x00e0, 0x1396: 0x01c4, 0x1397: 0x0143, - 0x1398: 0x0194, 0x1399: 0x01e8, 0x139a: 0x01eb, 0x139b: 0x0152, 0x139c: 0x1756, 0x139d: 0x1742, - 0x139e: 0x0158, 0x139f: 0x175b, 0x13a0: 0x01a9, 0x13a1: 0x1760, 0x13a2: 0x00da, 0x13a3: 0x0170, - 0x13a4: 0x0173, 0x13a5: 0x00a3, 0x13a6: 0x017c, 0x13a7: 0x1765, 0x13a8: 0x0182, 0x13a9: 0x0185, - 0x13aa: 0x0188, 0x13ab: 0x01e2, 0x13ac: 0x01dc, 0x13ad: 0x1752, 0x13ae: 0x01df, 0x13af: 0x0197, - 0x13b0: 0x0576, 0x13b2: 0x01ac, 0x13b3: 0x01cd, 0x13b4: 0x01d0, 0x13b5: 0x01bb, - 0x13b6: 0x00f5, 0x13b7: 0x00f8, 0x13b8: 0x00fb, 0x13b9: 0x176a, 0x13ba: 0x176f, - // Block 0x4f, offset 0x13c0 - 0x13c0: 0x0063, 0x13c1: 0x0065, 0x13c2: 0x0067, 0x13c3: 0x0069, 0x13c4: 0x006b, 0x13c5: 0x006d, - 0x13c6: 0x006f, 0x13c7: 0x0071, 0x13c8: 0x0073, 0x13c9: 0x0075, 0x13ca: 0x0083, 0x13cb: 0x0085, - 0x13cc: 0x0087, 0x13cd: 0x0089, 0x13ce: 0x008b, 0x13cf: 0x008d, 0x13d0: 0x008f, 0x13d1: 0x0091, - 0x13d2: 0x0093, 0x13d3: 0x0095, 0x13d4: 0x0097, 0x13d5: 0x0099, 0x13d6: 0x009b, 0x13d7: 0x009d, - 0x13d8: 0x009f, 0x13d9: 0x00a1, 0x13da: 0x00a3, 0x13db: 0x00a5, 0x13dc: 0x00a7, 0x13dd: 0x00a9, - 0x13de: 0x00ab, 0x13df: 0x00ad, 0x13e0: 0x00af, 0x13e1: 0x00b1, 0x13e2: 0x00b3, 0x13e3: 0x00b5, - 0x13e4: 0x00e3, 0x13e5: 0x0101, 0x13e8: 0x01f7, 0x13e9: 0x01fa, - 0x13ea: 0x01fd, 0x13eb: 0x0200, 0x13ec: 0x0203, 0x13ed: 0x0206, 0x13ee: 0x0209, 0x13ef: 0x020c, - 0x13f0: 0x020f, 0x13f1: 0x0212, 0x13f2: 0x0215, 0x13f3: 0x0218, 0x13f4: 0x021b, 0x13f5: 0x021e, - 0x13f6: 0x0221, 0x13f7: 0x0224, 0x13f8: 0x0227, 0x13f9: 0x020c, 0x13fa: 0x022a, 0x13fb: 0x022d, - 0x13fc: 0x0230, 0x13fd: 0x0233, 0x13fe: 0x0236, 0x13ff: 0x0239, - // Block 0x50, offset 0x1400 - 0x1400: 0x0281, 0x1401: 0x0284, 0x1402: 0x0287, 0x1403: 0x0552, 0x1404: 0x024b, 0x1405: 0x0254, - 0x1406: 0x025a, 0x1407: 0x027e, 0x1408: 0x026f, 0x1409: 0x026c, 0x140a: 0x028a, 0x140b: 0x028d, - 0x140e: 0x0021, 0x140f: 0x0023, 0x1410: 0x0025, 0x1411: 0x0027, - 0x1412: 0x0029, 0x1413: 0x002b, 0x1414: 0x002d, 0x1415: 0x002f, 0x1416: 0x0031, 0x1417: 0x0033, - 0x1418: 0x0021, 0x1419: 0x0023, 0x141a: 0x0025, 0x141b: 0x0027, 0x141c: 0x0029, 0x141d: 0x002b, - 0x141e: 0x002d, 0x141f: 0x002f, 0x1420: 0x0031, 0x1421: 0x0033, 0x1422: 0x0021, 0x1423: 0x0023, - 0x1424: 0x0025, 0x1425: 0x0027, 0x1426: 0x0029, 0x1427: 0x002b, 0x1428: 0x002d, 0x1429: 0x002f, - 0x142a: 0x0031, 0x142b: 0x0033, 0x142c: 0x0021, 0x142d: 0x0023, 0x142e: 0x0025, 0x142f: 0x0027, - 0x1430: 0x0029, 0x1431: 0x002b, 0x1432: 0x002d, 0x1433: 0x002f, 0x1434: 0x0031, 0x1435: 0x0033, - 0x1436: 0x0021, 0x1437: 0x0023, 0x1438: 0x0025, 0x1439: 0x0027, 0x143a: 0x0029, 0x143b: 0x002b, - 0x143c: 0x002d, 0x143d: 0x002f, 0x143e: 0x0031, 0x143f: 0x0033, - // Block 0x51, offset 0x1440 - 0x1440: 0x8133, 0x1441: 0x8133, 0x1442: 0x8133, 0x1443: 0x8133, 0x1444: 0x8133, 0x1445: 0x8133, - 0x1446: 0x8133, 0x1448: 0x8133, 0x1449: 0x8133, 0x144a: 0x8133, 0x144b: 0x8133, - 0x144c: 0x8133, 0x144d: 0x8133, 0x144e: 0x8133, 0x144f: 0x8133, 0x1450: 0x8133, 0x1451: 0x8133, - 0x1452: 0x8133, 0x1453: 0x8133, 0x1454: 0x8133, 0x1455: 0x8133, 0x1456: 0x8133, 0x1457: 0x8133, - 0x1458: 0x8133, 0x145b: 0x8133, 0x145c: 0x8133, 0x145d: 0x8133, - 0x145e: 0x8133, 0x145f: 0x8133, 0x1460: 0x8133, 0x1461: 0x8133, 0x1463: 0x8133, - 0x1464: 0x8133, 0x1466: 0x8133, 0x1467: 0x8133, 0x1468: 0x8133, 0x1469: 0x8133, - 0x146a: 0x8133, - 0x1470: 0x0290, 0x1471: 0x0293, 0x1472: 0x0296, 0x1473: 0x0299, 0x1474: 0x029c, 0x1475: 0x029f, - 0x1476: 0x02a2, 0x1477: 0x02a5, 0x1478: 0x02a8, 0x1479: 0x02ab, 0x147a: 0x02ae, 0x147b: 0x02b1, - 0x147c: 0x02b7, 0x147d: 0x02ba, 0x147e: 0x02bd, 0x147f: 0x02c0, - // Block 0x52, offset 0x1480 - 0x1480: 0x02c3, 0x1481: 0x02c6, 0x1482: 0x02c9, 0x1483: 0x02cc, 0x1484: 0x02cf, 0x1485: 0x02d2, - 0x1486: 0x02d5, 0x1487: 0x02db, 0x1488: 0x02e1, 0x1489: 0x02e4, 0x148a: 0x1736, 0x148b: 0x0302, - 0x148c: 0x02ea, 0x148d: 0x02ed, 0x148e: 0x0305, 0x148f: 0x02f9, 0x1490: 0x02ff, 0x1491: 0x0290, - 0x1492: 0x0293, 0x1493: 0x0296, 0x1494: 0x0299, 0x1495: 0x029c, 0x1496: 0x029f, 0x1497: 0x02a2, - 0x1498: 0x02a5, 0x1499: 0x02a8, 0x149a: 0x02ab, 0x149b: 0x02ae, 0x149c: 0x02b7, 0x149d: 0x02ba, - 0x149e: 0x02c0, 0x149f: 0x02c6, 0x14a0: 0x02c9, 0x14a1: 0x02cc, 0x14a2: 0x02cf, 0x14a3: 0x02d2, - 0x14a4: 0x02d5, 0x14a5: 0x02d8, 0x14a6: 0x02db, 0x14a7: 0x02f3, 0x14a8: 0x02ea, 0x14a9: 0x02e7, - 0x14aa: 0x02f0, 0x14ab: 0x02f6, 0x14ac: 0x1732, 0x14ad: 0x02fc, - // Block 0x53, offset 0x14c0 - 0x14c0: 0x032c, 0x14c1: 0x032f, 0x14c2: 0x033b, 0x14c3: 0x0344, 0x14c5: 0x037d, - 0x14c6: 0x034d, 0x14c7: 0x033e, 0x14c8: 0x035c, 0x14c9: 0x0383, 0x14ca: 0x036e, 0x14cb: 0x0371, - 0x14cc: 0x0374, 0x14cd: 0x0377, 0x14ce: 0x0350, 0x14cf: 0x0362, 0x14d0: 0x0368, 0x14d1: 0x0356, - 0x14d2: 0x036b, 0x14d3: 0x034a, 0x14d4: 0x0353, 0x14d5: 0x0335, 0x14d6: 0x0338, 0x14d7: 0x0341, - 0x14d8: 0x0347, 0x14d9: 0x0359, 0x14da: 0x035f, 0x14db: 0x0365, 0x14dc: 0x0386, 0x14dd: 0x03d7, - 0x14de: 0x03bf, 0x14df: 0x0389, 0x14e1: 0x032f, 0x14e2: 0x033b, - 0x14e4: 0x037a, 0x14e7: 0x033e, 0x14e9: 0x0383, - 0x14ea: 0x036e, 0x14eb: 0x0371, 0x14ec: 0x0374, 0x14ed: 0x0377, 0x14ee: 0x0350, 0x14ef: 0x0362, - 0x14f0: 0x0368, 0x14f1: 0x0356, 0x14f2: 0x036b, 0x14f4: 0x0353, 0x14f5: 0x0335, - 0x14f6: 0x0338, 0x14f7: 0x0341, 0x14f9: 0x0359, 0x14fb: 0x0365, - // Block 0x54, offset 0x1500 - 0x1502: 0x033b, - 0x1507: 0x033e, 0x1509: 0x0383, 0x150b: 0x0371, - 0x150d: 0x0377, 0x150e: 0x0350, 0x150f: 0x0362, 0x1511: 0x0356, - 0x1512: 0x036b, 0x1514: 0x0353, 0x1517: 0x0341, - 0x1519: 0x0359, 0x151b: 0x0365, 0x151d: 0x03d7, - 0x151f: 0x0389, 0x1521: 0x032f, 0x1522: 0x033b, - 0x1524: 0x037a, 0x1527: 0x033e, 0x1528: 0x035c, 0x1529: 0x0383, - 0x152a: 0x036e, 0x152c: 0x0374, 0x152d: 0x0377, 0x152e: 0x0350, 0x152f: 0x0362, - 0x1530: 0x0368, 0x1531: 0x0356, 0x1532: 0x036b, 0x1534: 0x0353, 0x1535: 0x0335, - 0x1536: 0x0338, 0x1537: 0x0341, 0x1539: 0x0359, 0x153a: 0x035f, 0x153b: 0x0365, - 0x153c: 0x0386, 0x153e: 0x03bf, - // Block 0x55, offset 0x1540 - 0x1540: 0x032c, 0x1541: 0x032f, 0x1542: 0x033b, 0x1543: 0x0344, 0x1544: 0x037a, 0x1545: 0x037d, - 0x1546: 0x034d, 0x1547: 0x033e, 0x1548: 0x035c, 0x1549: 0x0383, 0x154b: 0x0371, - 0x154c: 0x0374, 0x154d: 0x0377, 0x154e: 0x0350, 0x154f: 0x0362, 0x1550: 0x0368, 0x1551: 0x0356, - 0x1552: 0x036b, 0x1553: 0x034a, 0x1554: 0x0353, 0x1555: 0x0335, 0x1556: 0x0338, 0x1557: 0x0341, - 0x1558: 0x0347, 0x1559: 0x0359, 0x155a: 0x035f, 0x155b: 0x0365, - 0x1561: 0x032f, 0x1562: 0x033b, 0x1563: 0x0344, - 0x1565: 0x037d, 0x1566: 0x034d, 0x1567: 0x033e, 0x1568: 0x035c, 0x1569: 0x0383, - 0x156b: 0x0371, 0x156c: 0x0374, 0x156d: 0x0377, 0x156e: 0x0350, 0x156f: 0x0362, - 0x1570: 0x0368, 0x1571: 0x0356, 0x1572: 0x036b, 0x1573: 0x034a, 0x1574: 0x0353, 0x1575: 0x0335, - 0x1576: 0x0338, 0x1577: 0x0341, 0x1578: 0x0347, 0x1579: 0x0359, 0x157a: 0x035f, 0x157b: 0x0365, - // Block 0x56, offset 0x1580 - 0x1580: 0x19a6, 0x1581: 0x19a3, 0x1582: 0x19a9, 0x1583: 0x19cd, 0x1584: 0x19f1, 0x1585: 0x1a15, - 0x1586: 0x1a39, 0x1587: 0x1a42, 0x1588: 0x1a48, 0x1589: 0x1a4e, 0x158a: 0x1a54, - 0x1590: 0x1bbc, 0x1591: 0x1bc0, - 0x1592: 0x1bc4, 0x1593: 0x1bc8, 0x1594: 0x1bcc, 0x1595: 0x1bd0, 0x1596: 0x1bd4, 0x1597: 0x1bd8, - 0x1598: 0x1bdc, 0x1599: 0x1be0, 0x159a: 0x1be4, 0x159b: 0x1be8, 0x159c: 0x1bec, 0x159d: 0x1bf0, - 0x159e: 0x1bf4, 0x159f: 0x1bf8, 0x15a0: 0x1bfc, 0x15a1: 0x1c00, 0x15a2: 0x1c04, 0x15a3: 0x1c08, - 0x15a4: 0x1c0c, 0x15a5: 0x1c10, 0x15a6: 0x1c14, 0x15a7: 0x1c18, 0x15a8: 0x1c1c, 0x15a9: 0x1c20, - 0x15aa: 0x2855, 0x15ab: 0x0047, 0x15ac: 0x0065, 0x15ad: 0x1a69, 0x15ae: 0x1ae1, - 0x15b0: 0x0043, 0x15b1: 0x0045, 0x15b2: 0x0047, 0x15b3: 0x0049, 0x15b4: 0x004b, 0x15b5: 0x004d, - 0x15b6: 0x004f, 0x15b7: 0x0051, 0x15b8: 0x0053, 0x15b9: 0x0055, 0x15ba: 0x0057, 0x15bb: 0x0059, - 0x15bc: 0x005b, 0x15bd: 0x005d, 0x15be: 0x005f, 0x15bf: 0x0061, - // Block 0x57, offset 0x15c0 - 0x15c0: 0x27dd, 0x15c1: 0x27f2, 0x15c2: 0x05fe, - 0x15d0: 0x0d0a, 0x15d1: 0x0b42, - 0x15d2: 0x09ce, 0x15d3: 0x46f5, 0x15d4: 0x0816, 0x15d5: 0x0aea, 0x15d6: 0x142a, 0x15d7: 0x0afa, - 0x15d8: 0x0822, 0x15d9: 0x0dd2, 0x15da: 0x0faa, 0x15db: 0x0daa, 0x15dc: 0x0922, 0x15dd: 0x0c66, - 0x15de: 0x08ba, 0x15df: 0x0db2, 0x15e0: 0x090e, 0x15e1: 0x1212, 0x15e2: 0x107e, 0x15e3: 0x1486, - 0x15e4: 0x0ace, 0x15e5: 0x0a06, 0x15e6: 0x0f5e, 0x15e7: 0x0d16, 0x15e8: 0x0d42, 0x15e9: 0x07ba, - 0x15ea: 0x07c6, 0x15eb: 0x1506, 0x15ec: 0x0bd6, 0x15ed: 0x07e2, 0x15ee: 0x09ea, 0x15ef: 0x0d36, - 0x15f0: 0x14ae, 0x15f1: 0x0d0e, 0x15f2: 0x116a, 0x15f3: 0x11a6, 0x15f4: 0x09f2, 0x15f5: 0x0f3e, - 0x15f6: 0x0e06, 0x15f7: 0x0e02, 0x15f8: 0x1092, 0x15f9: 0x0926, 0x15fa: 0x0a52, 0x15fb: 0x153e, - // Block 0x58, offset 0x1600 - 0x1600: 0x07f6, 0x1601: 0x07ee, 0x1602: 0x07fe, 0x1603: 0x1774, 0x1604: 0x0842, 0x1605: 0x0852, - 0x1606: 0x0856, 0x1607: 0x085e, 0x1608: 0x0866, 0x1609: 0x086a, 0x160a: 0x0876, 0x160b: 0x086e, - 0x160c: 0x06ae, 0x160d: 0x1788, 0x160e: 0x088a, 0x160f: 0x088e, 0x1610: 0x0892, 0x1611: 0x08ae, - 0x1612: 0x1779, 0x1613: 0x06b2, 0x1614: 0x089a, 0x1615: 0x08ba, 0x1616: 0x1783, 0x1617: 0x08ca, - 0x1618: 0x08d2, 0x1619: 0x0832, 0x161a: 0x08da, 0x161b: 0x08de, 0x161c: 0x195e, 0x161d: 0x08fa, - 0x161e: 0x0902, 0x161f: 0x06ba, 0x1620: 0x091a, 0x1621: 0x091e, 0x1622: 0x0926, 0x1623: 0x092a, - 0x1624: 0x06be, 0x1625: 0x0942, 0x1626: 0x0946, 0x1627: 0x0952, 0x1628: 0x095e, 0x1629: 0x0962, - 0x162a: 0x0966, 0x162b: 0x096e, 0x162c: 0x098e, 0x162d: 0x0992, 0x162e: 0x099a, 0x162f: 0x09aa, - 0x1630: 0x09b2, 0x1631: 0x09b6, 0x1632: 0x09b6, 0x1633: 0x09b6, 0x1634: 0x1797, 0x1635: 0x0f8e, - 0x1636: 0x09ca, 0x1637: 0x09d2, 0x1638: 0x179c, 0x1639: 0x09de, 0x163a: 0x09e6, 0x163b: 0x09ee, - 0x163c: 0x0a16, 0x163d: 0x0a02, 0x163e: 0x0a0e, 0x163f: 0x0a12, - // Block 0x59, offset 0x1640 - 0x1640: 0x0a1a, 0x1641: 0x0a22, 0x1642: 0x0a26, 0x1643: 0x0a2e, 0x1644: 0x0a36, 0x1645: 0x0a3a, - 0x1646: 0x0a3a, 0x1647: 0x0a42, 0x1648: 0x0a4a, 0x1649: 0x0a4e, 0x164a: 0x0a5a, 0x164b: 0x0a7e, - 0x164c: 0x0a62, 0x164d: 0x0a82, 0x164e: 0x0a66, 0x164f: 0x0a6e, 0x1650: 0x0906, 0x1651: 0x0aca, - 0x1652: 0x0a92, 0x1653: 0x0a96, 0x1654: 0x0a9a, 0x1655: 0x0a8e, 0x1656: 0x0aa2, 0x1657: 0x0a9e, - 0x1658: 0x0ab6, 0x1659: 0x17a1, 0x165a: 0x0ad2, 0x165b: 0x0ad6, 0x165c: 0x0ade, 0x165d: 0x0aea, - 0x165e: 0x0af2, 0x165f: 0x0b0e, 0x1660: 0x17a6, 0x1661: 0x17ab, 0x1662: 0x0b1a, 0x1663: 0x0b1e, - 0x1664: 0x0b22, 0x1665: 0x0b16, 0x1666: 0x0b2a, 0x1667: 0x06c2, 0x1668: 0x06c6, 0x1669: 0x0b32, - 0x166a: 0x0b3a, 0x166b: 0x0b3a, 0x166c: 0x17b0, 0x166d: 0x0b56, 0x166e: 0x0b5a, 0x166f: 0x0b5e, - 0x1670: 0x0b66, 0x1671: 0x17b5, 0x1672: 0x0b6e, 0x1673: 0x0b72, 0x1674: 0x0c4a, 0x1675: 0x0b7a, - 0x1676: 0x06ca, 0x1677: 0x0b86, 0x1678: 0x0b96, 0x1679: 0x0ba2, 0x167a: 0x0b9e, 0x167b: 0x17bf, - 0x167c: 0x0baa, 0x167d: 0x17c4, 0x167e: 0x0bb6, 0x167f: 0x0bb2, - // Block 0x5a, offset 0x1680 - 0x1680: 0x0bba, 0x1681: 0x0bca, 0x1682: 0x0bce, 0x1683: 0x06ce, 0x1684: 0x0bde, 0x1685: 0x0be6, - 0x1686: 0x0bea, 0x1687: 0x0bee, 0x1688: 0x06d2, 0x1689: 0x17c9, 0x168a: 0x06d6, 0x168b: 0x0c0a, - 0x168c: 0x0c0e, 0x168d: 0x0c12, 0x168e: 0x0c1a, 0x168f: 0x1990, 0x1690: 0x0c32, 0x1691: 0x17d3, - 0x1692: 0x17d3, 0x1693: 0x12d2, 0x1694: 0x0c42, 0x1695: 0x0c42, 0x1696: 0x06da, 0x1697: 0x17f6, - 0x1698: 0x18c8, 0x1699: 0x0c52, 0x169a: 0x0c5a, 0x169b: 0x06de, 0x169c: 0x0c6e, 0x169d: 0x0c7e, - 0x169e: 0x0c82, 0x169f: 0x0c8a, 0x16a0: 0x0c9a, 0x16a1: 0x06e6, 0x16a2: 0x06e2, 0x16a3: 0x0c9e, - 0x16a4: 0x17d8, 0x16a5: 0x0ca2, 0x16a6: 0x0cb6, 0x16a7: 0x0cba, 0x16a8: 0x0cbe, 0x16a9: 0x0cba, - 0x16aa: 0x0cca, 0x16ab: 0x0cce, 0x16ac: 0x0cde, 0x16ad: 0x0cd6, 0x16ae: 0x0cda, 0x16af: 0x0ce2, - 0x16b0: 0x0ce6, 0x16b1: 0x0cea, 0x16b2: 0x0cf6, 0x16b3: 0x0cfa, 0x16b4: 0x0d12, 0x16b5: 0x0d1a, - 0x16b6: 0x0d2a, 0x16b7: 0x0d3e, 0x16b8: 0x17e7, 0x16b9: 0x0d3a, 0x16ba: 0x0d2e, 0x16bb: 0x0d46, - 0x16bc: 0x0d4e, 0x16bd: 0x0d62, 0x16be: 0x17ec, 0x16bf: 0x0d6a, - // Block 0x5b, offset 0x16c0 - 0x16c0: 0x0d5e, 0x16c1: 0x0d56, 0x16c2: 0x06ea, 0x16c3: 0x0d72, 0x16c4: 0x0d7a, 0x16c5: 0x0d82, - 0x16c6: 0x0d76, 0x16c7: 0x06ee, 0x16c8: 0x0d92, 0x16c9: 0x0d9a, 0x16ca: 0x17f1, 0x16cb: 0x0dc6, - 0x16cc: 0x0dfa, 0x16cd: 0x0dd6, 0x16ce: 0x06fa, 0x16cf: 0x0de2, 0x16d0: 0x06f6, 0x16d1: 0x06f2, - 0x16d2: 0x08be, 0x16d3: 0x08c2, 0x16d4: 0x0dfe, 0x16d5: 0x0de6, 0x16d6: 0x12a6, 0x16d7: 0x075e, - 0x16d8: 0x0e0a, 0x16d9: 0x0e0e, 0x16da: 0x0e12, 0x16db: 0x0e26, 0x16dc: 0x0e1e, 0x16dd: 0x180a, - 0x16de: 0x06fe, 0x16df: 0x0e3a, 0x16e0: 0x0e2e, 0x16e1: 0x0e4a, 0x16e2: 0x0e52, 0x16e3: 0x1814, - 0x16e4: 0x0e56, 0x16e5: 0x0e42, 0x16e6: 0x0e5e, 0x16e7: 0x0702, 0x16e8: 0x0e62, 0x16e9: 0x0e66, - 0x16ea: 0x0e6a, 0x16eb: 0x0e76, 0x16ec: 0x1819, 0x16ed: 0x0e7e, 0x16ee: 0x0706, 0x16ef: 0x0e8a, - 0x16f0: 0x181e, 0x16f1: 0x0e8e, 0x16f2: 0x070a, 0x16f3: 0x0e9a, 0x16f4: 0x0ea6, 0x16f5: 0x0eb2, - 0x16f6: 0x0eb6, 0x16f7: 0x1823, 0x16f8: 0x17ba, 0x16f9: 0x1828, 0x16fa: 0x0ed6, 0x16fb: 0x182d, - 0x16fc: 0x0ee2, 0x16fd: 0x0eea, 0x16fe: 0x0eda, 0x16ff: 0x0ef6, - // Block 0x5c, offset 0x1700 - 0x1700: 0x0f06, 0x1701: 0x0f16, 0x1702: 0x0f0a, 0x1703: 0x0f0e, 0x1704: 0x0f1a, 0x1705: 0x0f1e, - 0x1706: 0x1832, 0x1707: 0x0f02, 0x1708: 0x0f36, 0x1709: 0x0f3a, 0x170a: 0x070e, 0x170b: 0x0f4e, - 0x170c: 0x0f4a, 0x170d: 0x1837, 0x170e: 0x0f2e, 0x170f: 0x0f6a, 0x1710: 0x183c, 0x1711: 0x1841, - 0x1712: 0x0f6e, 0x1713: 0x0f82, 0x1714: 0x0f7e, 0x1715: 0x0f7a, 0x1716: 0x0712, 0x1717: 0x0f86, - 0x1718: 0x0f96, 0x1719: 0x0f92, 0x171a: 0x0f9e, 0x171b: 0x177e, 0x171c: 0x0fae, 0x171d: 0x1846, - 0x171e: 0x0fba, 0x171f: 0x1850, 0x1720: 0x0fce, 0x1721: 0x0fda, 0x1722: 0x0fee, 0x1723: 0x1855, - 0x1724: 0x1002, 0x1725: 0x1006, 0x1726: 0x185a, 0x1727: 0x185f, 0x1728: 0x1022, 0x1729: 0x1032, - 0x172a: 0x0716, 0x172b: 0x1036, 0x172c: 0x071a, 0x172d: 0x071a, 0x172e: 0x104e, 0x172f: 0x1052, - 0x1730: 0x105a, 0x1731: 0x105e, 0x1732: 0x106a, 0x1733: 0x071e, 0x1734: 0x1082, 0x1735: 0x1864, - 0x1736: 0x109e, 0x1737: 0x1869, 0x1738: 0x10aa, 0x1739: 0x17ce, 0x173a: 0x10ba, 0x173b: 0x186e, - 0x173c: 0x1873, 0x173d: 0x1878, 0x173e: 0x0722, 0x173f: 0x0726, - // Block 0x5d, offset 0x1740 - 0x1740: 0x10f2, 0x1741: 0x1882, 0x1742: 0x187d, 0x1743: 0x1887, 0x1744: 0x188c, 0x1745: 0x10fa, - 0x1746: 0x10fe, 0x1747: 0x10fe, 0x1748: 0x1106, 0x1749: 0x072e, 0x174a: 0x110a, 0x174b: 0x0732, - 0x174c: 0x0736, 0x174d: 0x1896, 0x174e: 0x111e, 0x174f: 0x1126, 0x1750: 0x1132, 0x1751: 0x073a, - 0x1752: 0x189b, 0x1753: 0x1156, 0x1754: 0x18a0, 0x1755: 0x18a5, 0x1756: 0x1176, 0x1757: 0x118e, - 0x1758: 0x073e, 0x1759: 0x1196, 0x175a: 0x119a, 0x175b: 0x119e, 0x175c: 0x18aa, 0x175d: 0x18af, - 0x175e: 0x18af, 0x175f: 0x11b6, 0x1760: 0x0742, 0x1761: 0x18b4, 0x1762: 0x11ca, 0x1763: 0x11ce, - 0x1764: 0x0746, 0x1765: 0x18b9, 0x1766: 0x11ea, 0x1767: 0x074a, 0x1768: 0x11fa, 0x1769: 0x11f2, - 0x176a: 0x1202, 0x176b: 0x18c3, 0x176c: 0x121a, 0x176d: 0x074e, 0x176e: 0x1226, 0x176f: 0x122e, - 0x1770: 0x123e, 0x1771: 0x0752, 0x1772: 0x18cd, 0x1773: 0x18d2, 0x1774: 0x0756, 0x1775: 0x18d7, - 0x1776: 0x1256, 0x1777: 0x18dc, 0x1778: 0x1262, 0x1779: 0x126e, 0x177a: 0x1276, 0x177b: 0x18e1, - 0x177c: 0x18e6, 0x177d: 0x128a, 0x177e: 0x18eb, 0x177f: 0x1292, - // Block 0x5e, offset 0x1780 - 0x1780: 0x17fb, 0x1781: 0x075a, 0x1782: 0x12aa, 0x1783: 0x12ae, 0x1784: 0x0762, 0x1785: 0x12b2, - 0x1786: 0x0b2e, 0x1787: 0x18f0, 0x1788: 0x18f5, 0x1789: 0x1800, 0x178a: 0x1805, 0x178b: 0x12d2, - 0x178c: 0x12d6, 0x178d: 0x14ee, 0x178e: 0x0766, 0x178f: 0x1302, 0x1790: 0x12fe, 0x1791: 0x1306, - 0x1792: 0x093a, 0x1793: 0x130a, 0x1794: 0x130e, 0x1795: 0x1312, 0x1796: 0x131a, 0x1797: 0x18fa, - 0x1798: 0x1316, 0x1799: 0x131e, 0x179a: 0x1332, 0x179b: 0x1336, 0x179c: 0x1322, 0x179d: 0x133a, - 0x179e: 0x134e, 0x179f: 0x1362, 0x17a0: 0x132e, 0x17a1: 0x1342, 0x17a2: 0x1346, 0x17a3: 0x134a, - 0x17a4: 0x18ff, 0x17a5: 0x1909, 0x17a6: 0x1904, 0x17a7: 0x076a, 0x17a8: 0x136a, 0x17a9: 0x136e, - 0x17aa: 0x1376, 0x17ab: 0x191d, 0x17ac: 0x137a, 0x17ad: 0x190e, 0x17ae: 0x076e, 0x17af: 0x0772, - 0x17b0: 0x1913, 0x17b1: 0x1918, 0x17b2: 0x0776, 0x17b3: 0x139a, 0x17b4: 0x139e, 0x17b5: 0x13a2, - 0x17b6: 0x13a6, 0x17b7: 0x13b2, 0x17b8: 0x13ae, 0x17b9: 0x13ba, 0x17ba: 0x13b6, 0x17bb: 0x13c6, - 0x17bc: 0x13be, 0x17bd: 0x13c2, 0x17be: 0x13ca, 0x17bf: 0x077a, - // Block 0x5f, offset 0x17c0 - 0x17c0: 0x13d2, 0x17c1: 0x13d6, 0x17c2: 0x077e, 0x17c3: 0x13e6, 0x17c4: 0x13ea, 0x17c5: 0x1922, - 0x17c6: 0x13f6, 0x17c7: 0x13fa, 0x17c8: 0x0782, 0x17c9: 0x1406, 0x17ca: 0x06b6, 0x17cb: 0x1927, - 0x17cc: 0x192c, 0x17cd: 0x0786, 0x17ce: 0x078a, 0x17cf: 0x1432, 0x17d0: 0x144a, 0x17d1: 0x1466, - 0x17d2: 0x1476, 0x17d3: 0x1931, 0x17d4: 0x148a, 0x17d5: 0x148e, 0x17d6: 0x14a6, 0x17d7: 0x14b2, - 0x17d8: 0x193b, 0x17d9: 0x178d, 0x17da: 0x14be, 0x17db: 0x14ba, 0x17dc: 0x14c6, 0x17dd: 0x1792, - 0x17de: 0x14d2, 0x17df: 0x14de, 0x17e0: 0x1940, 0x17e1: 0x1945, 0x17e2: 0x151e, 0x17e3: 0x152a, - 0x17e4: 0x1532, 0x17e5: 0x194a, 0x17e6: 0x1536, 0x17e7: 0x1562, 0x17e8: 0x156e, 0x17e9: 0x1572, - 0x17ea: 0x156a, 0x17eb: 0x157e, 0x17ec: 0x1582, 0x17ed: 0x194f, 0x17ee: 0x158e, 0x17ef: 0x078e, - 0x17f0: 0x1596, 0x17f1: 0x1954, 0x17f2: 0x0792, 0x17f3: 0x15ce, 0x17f4: 0x0bbe, 0x17f5: 0x15e6, - 0x17f6: 0x1959, 0x17f7: 0x1963, 0x17f8: 0x0796, 0x17f9: 0x079a, 0x17fa: 0x160e, 0x17fb: 0x1968, - 0x17fc: 0x079e, 0x17fd: 0x196d, 0x17fe: 0x1626, 0x17ff: 0x1626, - // Block 0x60, offset 0x1800 - 0x1800: 0x162e, 0x1801: 0x1972, 0x1802: 0x1646, 0x1803: 0x07a2, 0x1804: 0x1656, 0x1805: 0x1662, - 0x1806: 0x166a, 0x1807: 0x1672, 0x1808: 0x07a6, 0x1809: 0x1977, 0x180a: 0x1686, 0x180b: 0x16a2, - 0x180c: 0x16ae, 0x180d: 0x07aa, 0x180e: 0x07ae, 0x180f: 0x16b2, 0x1810: 0x197c, 0x1811: 0x07b2, - 0x1812: 0x1981, 0x1813: 0x1986, 0x1814: 0x198b, 0x1815: 0x16d6, 0x1816: 0x07b6, 0x1817: 0x16ea, - 0x1818: 0x16f2, 0x1819: 0x16f6, 0x181a: 0x16fe, 0x181b: 0x1706, 0x181c: 0x170e, 0x181d: 0x1995, -} - -// nfkcIndex: 22 blocks, 1408 entries, 2816 bytes -// Block 0 is the zero block. -var nfkcIndex = [1408]uint16{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x5f, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x60, 0xc7: 0x04, - 0xc8: 0x05, 0xca: 0x61, 0xcb: 0x62, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09, - 0xd0: 0x0a, 0xd1: 0x63, 0xd2: 0x64, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x65, - 0xd8: 0x66, 0xd9: 0x0d, 0xdb: 0x67, 0xdc: 0x68, 0xdd: 0x69, 0xdf: 0x6a, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, - 0xf0: 0x13, - // Block 0x4, offset 0x100 - 0x120: 0x6b, 0x121: 0x6c, 0x122: 0x6d, 0x123: 0x0e, 0x124: 0x6e, 0x125: 0x6f, 0x126: 0x70, 0x127: 0x71, - 0x128: 0x72, 0x129: 0x73, 0x12a: 0x74, 0x12b: 0x75, 0x12c: 0x70, 0x12d: 0x76, 0x12e: 0x77, 0x12f: 0x78, - 0x130: 0x74, 0x131: 0x79, 0x132: 0x7a, 0x133: 0x7b, 0x134: 0x7c, 0x135: 0x7d, 0x137: 0x7e, - 0x138: 0x7f, 0x139: 0x80, 0x13a: 0x81, 0x13b: 0x82, 0x13c: 0x83, 0x13d: 0x84, 0x13e: 0x85, 0x13f: 0x86, - // Block 0x5, offset 0x140 - 0x140: 0x87, 0x142: 0x88, 0x143: 0x89, 0x144: 0x8a, 0x145: 0x8b, 0x146: 0x8c, 0x147: 0x8d, - 0x14d: 0x8e, - 0x15c: 0x8f, 0x15f: 0x90, - 0x162: 0x91, 0x164: 0x92, - 0x168: 0x93, 0x169: 0x94, 0x16a: 0x95, 0x16b: 0x96, 0x16c: 0x0f, 0x16d: 0x97, 0x16e: 0x98, 0x16f: 0x99, - 0x170: 0x9a, 0x173: 0x9b, 0x174: 0x9c, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12, - 0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a, - // Block 0x6, offset 0x180 - 0x180: 0x9d, 0x181: 0x9e, 0x182: 0x9f, 0x183: 0xa0, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0xa1, 0x187: 0xa2, - 0x188: 0xa3, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0xa4, 0x18c: 0xa5, - 0x191: 0x1f, 0x192: 0x20, 0x193: 0xa6, - 0x1a8: 0xa7, 0x1a9: 0xa8, 0x1ab: 0xa9, - 0x1b1: 0xaa, 0x1b3: 0xab, 0x1b5: 0xac, 0x1b7: 0xad, - 0x1ba: 0xae, 0x1bb: 0xaf, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xb0, - // Block 0x7, offset 0x1c0 - 0x1c0: 0xb1, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xb2, 0x1c5: 0x27, 0x1c6: 0x28, - 0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30, - // Block 0x8, offset 0x200 - 0x219: 0xb3, 0x21a: 0xb4, 0x21b: 0xb5, 0x21d: 0xb6, 0x21f: 0xb7, - 0x220: 0xb8, 0x223: 0xb9, 0x224: 0xba, 0x225: 0xbb, 0x226: 0xbc, 0x227: 0xbd, - 0x22a: 0xbe, 0x22b: 0xbf, 0x22d: 0xc0, 0x22f: 0xc1, - 0x230: 0xc2, 0x231: 0xc3, 0x232: 0xc4, 0x233: 0xc5, 0x234: 0xc6, 0x235: 0xc7, 0x236: 0xc8, 0x237: 0xc2, - 0x238: 0xc3, 0x239: 0xc4, 0x23a: 0xc5, 0x23b: 0xc6, 0x23c: 0xc7, 0x23d: 0xc8, 0x23e: 0xc2, 0x23f: 0xc3, - // Block 0x9, offset 0x240 - 0x240: 0xc4, 0x241: 0xc5, 0x242: 0xc6, 0x243: 0xc7, 0x244: 0xc8, 0x245: 0xc2, 0x246: 0xc3, 0x247: 0xc4, - 0x248: 0xc5, 0x249: 0xc6, 0x24a: 0xc7, 0x24b: 0xc8, 0x24c: 0xc2, 0x24d: 0xc3, 0x24e: 0xc4, 0x24f: 0xc5, - 0x250: 0xc6, 0x251: 0xc7, 0x252: 0xc8, 0x253: 0xc2, 0x254: 0xc3, 0x255: 0xc4, 0x256: 0xc5, 0x257: 0xc6, - 0x258: 0xc7, 0x259: 0xc8, 0x25a: 0xc2, 0x25b: 0xc3, 0x25c: 0xc4, 0x25d: 0xc5, 0x25e: 0xc6, 0x25f: 0xc7, - 0x260: 0xc8, 0x261: 0xc2, 0x262: 0xc3, 0x263: 0xc4, 0x264: 0xc5, 0x265: 0xc6, 0x266: 0xc7, 0x267: 0xc8, - 0x268: 0xc2, 0x269: 0xc3, 0x26a: 0xc4, 0x26b: 0xc5, 0x26c: 0xc6, 0x26d: 0xc7, 0x26e: 0xc8, 0x26f: 0xc2, - 0x270: 0xc3, 0x271: 0xc4, 0x272: 0xc5, 0x273: 0xc6, 0x274: 0xc7, 0x275: 0xc8, 0x276: 0xc2, 0x277: 0xc3, - 0x278: 0xc4, 0x279: 0xc5, 0x27a: 0xc6, 0x27b: 0xc7, 0x27c: 0xc8, 0x27d: 0xc2, 0x27e: 0xc3, 0x27f: 0xc4, - // Block 0xa, offset 0x280 - 0x280: 0xc5, 0x281: 0xc6, 0x282: 0xc7, 0x283: 0xc8, 0x284: 0xc2, 0x285: 0xc3, 0x286: 0xc4, 0x287: 0xc5, - 0x288: 0xc6, 0x289: 0xc7, 0x28a: 0xc8, 0x28b: 0xc2, 0x28c: 0xc3, 0x28d: 0xc4, 0x28e: 0xc5, 0x28f: 0xc6, - 0x290: 0xc7, 0x291: 0xc8, 0x292: 0xc2, 0x293: 0xc3, 0x294: 0xc4, 0x295: 0xc5, 0x296: 0xc6, 0x297: 0xc7, - 0x298: 0xc8, 0x299: 0xc2, 0x29a: 0xc3, 0x29b: 0xc4, 0x29c: 0xc5, 0x29d: 0xc6, 0x29e: 0xc7, 0x29f: 0xc8, - 0x2a0: 0xc2, 0x2a1: 0xc3, 0x2a2: 0xc4, 0x2a3: 0xc5, 0x2a4: 0xc6, 0x2a5: 0xc7, 0x2a6: 0xc8, 0x2a7: 0xc2, - 0x2a8: 0xc3, 0x2a9: 0xc4, 0x2aa: 0xc5, 0x2ab: 0xc6, 0x2ac: 0xc7, 0x2ad: 0xc8, 0x2ae: 0xc2, 0x2af: 0xc3, - 0x2b0: 0xc4, 0x2b1: 0xc5, 0x2b2: 0xc6, 0x2b3: 0xc7, 0x2b4: 0xc8, 0x2b5: 0xc2, 0x2b6: 0xc3, 0x2b7: 0xc4, - 0x2b8: 0xc5, 0x2b9: 0xc6, 0x2ba: 0xc7, 0x2bb: 0xc8, 0x2bc: 0xc2, 0x2bd: 0xc3, 0x2be: 0xc4, 0x2bf: 0xc5, - // Block 0xb, offset 0x2c0 - 0x2c0: 0xc6, 0x2c1: 0xc7, 0x2c2: 0xc8, 0x2c3: 0xc2, 0x2c4: 0xc3, 0x2c5: 0xc4, 0x2c6: 0xc5, 0x2c7: 0xc6, - 0x2c8: 0xc7, 0x2c9: 0xc8, 0x2ca: 0xc2, 0x2cb: 0xc3, 0x2cc: 0xc4, 0x2cd: 0xc5, 0x2ce: 0xc6, 0x2cf: 0xc7, - 0x2d0: 0xc8, 0x2d1: 0xc2, 0x2d2: 0xc3, 0x2d3: 0xc4, 0x2d4: 0xc5, 0x2d5: 0xc6, 0x2d6: 0xc7, 0x2d7: 0xc8, - 0x2d8: 0xc2, 0x2d9: 0xc3, 0x2da: 0xc4, 0x2db: 0xc5, 0x2dc: 0xc6, 0x2dd: 0xc7, 0x2de: 0xc9, - // Block 0xc, offset 0x300 - 0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34, - 0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c, - 0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44, - 0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xca, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b, - // Block 0xd, offset 0x340 - 0x347: 0xcb, - 0x34b: 0xcc, 0x34d: 0xcd, - 0x35e: 0x4c, - 0x368: 0xce, 0x36b: 0xcf, - 0x374: 0xd0, - 0x37a: 0xd1, 0x37b: 0xd2, 0x37d: 0xd3, 0x37e: 0xd4, - // Block 0xe, offset 0x380 - 0x381: 0xd5, 0x382: 0xd6, 0x384: 0xd7, 0x385: 0xbc, 0x387: 0xd8, - 0x388: 0xd9, 0x38b: 0xda, 0x38c: 0xdb, 0x38d: 0xdc, - 0x391: 0xdd, 0x392: 0xde, 0x393: 0xdf, 0x396: 0xe0, 0x397: 0xe1, - 0x398: 0xe2, 0x39a: 0xe3, 0x39c: 0xe4, - 0x3a0: 0xe5, 0x3a4: 0xe6, 0x3a5: 0xe7, 0x3a7: 0xe8, - 0x3a8: 0xe9, 0x3a9: 0xea, 0x3aa: 0xeb, - 0x3b0: 0xe2, 0x3b5: 0xec, 0x3b6: 0xed, - 0x3bd: 0xee, - // Block 0xf, offset 0x3c0 - 0x3eb: 0xef, 0x3ec: 0xf0, - 0x3ff: 0xf1, - // Block 0x10, offset 0x400 - 0x432: 0xf2, - // Block 0x11, offset 0x440 - 0x445: 0xf3, 0x446: 0xf4, 0x447: 0xf5, - 0x449: 0xf6, - 0x450: 0xf7, 0x451: 0xf8, 0x452: 0xf9, 0x453: 0xfa, 0x454: 0xfb, 0x455: 0xfc, 0x456: 0xfd, 0x457: 0xfe, - 0x458: 0xff, 0x459: 0x100, 0x45a: 0x4d, 0x45b: 0x101, 0x45c: 0x102, 0x45d: 0x103, 0x45e: 0x104, 0x45f: 0x4e, - // Block 0x12, offset 0x480 - 0x480: 0x4f, 0x481: 0x50, 0x482: 0x105, 0x484: 0xf0, - 0x48a: 0x106, 0x48b: 0x107, - 0x493: 0x108, - 0x4a3: 0x109, 0x4a5: 0x10a, - 0x4b8: 0x51, 0x4b9: 0x52, 0x4ba: 0x53, - // Block 0x13, offset 0x4c0 - 0x4c4: 0x54, 0x4c5: 0x10b, 0x4c6: 0x10c, - 0x4c8: 0x55, 0x4c9: 0x10d, - 0x4ef: 0x10e, - // Block 0x14, offset 0x500 - 0x520: 0x56, 0x521: 0x57, 0x522: 0x58, 0x523: 0x59, 0x524: 0x5a, 0x525: 0x5b, 0x526: 0x5c, 0x527: 0x5d, - 0x528: 0x5e, - // Block 0x15, offset 0x540 - 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, - 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, - 0x56f: 0x12, -} - -// nfkcSparseOffset: 176 entries, 352 bytes -var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1c, 0x26, 0x36, 0x38, 0x3d, 0x48, 0x57, 0x64, 0x6c, 0x71, 0x76, 0x78, 0x7c, 0x84, 0x8b, 0x8e, 0x96, 0x9a, 0x9e, 0xa0, 0xa2, 0xab, 0xaf, 0xb6, 0xbb, 0xbe, 0xc8, 0xcb, 0xd2, 0xda, 0xde, 0xe0, 0xe4, 0xe8, 0xee, 0xff, 0x10b, 0x10d, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11d, 0x11f, 0x121, 0x124, 0x127, 0x129, 0x12c, 0x12f, 0x133, 0x139, 0x140, 0x149, 0x14b, 0x14e, 0x150, 0x15b, 0x166, 0x174, 0x182, 0x192, 0x1a0, 0x1a7, 0x1ad, 0x1bc, 0x1c0, 0x1c2, 0x1c6, 0x1c8, 0x1cb, 0x1cd, 0x1d0, 0x1d2, 0x1d5, 0x1d7, 0x1d9, 0x1db, 0x1e7, 0x1f1, 0x1fb, 0x1fe, 0x202, 0x204, 0x206, 0x20b, 0x20e, 0x211, 0x213, 0x215, 0x217, 0x219, 0x21f, 0x222, 0x227, 0x229, 0x230, 0x236, 0x23c, 0x244, 0x24a, 0x250, 0x256, 0x25a, 0x25c, 0x25e, 0x260, 0x262, 0x268, 0x26b, 0x26d, 0x26f, 0x271, 0x277, 0x27b, 0x27f, 0x287, 0x28e, 0x291, 0x294, 0x296, 0x299, 0x2a1, 0x2a5, 0x2ac, 0x2af, 0x2b5, 0x2b7, 0x2b9, 0x2bc, 0x2be, 0x2c1, 0x2c6, 0x2c8, 0x2ca, 0x2cc, 0x2ce, 0x2d0, 0x2d3, 0x2d5, 0x2d7, 0x2d9, 0x2db, 0x2dd, 0x2df, 0x2ec, 0x2f6, 0x2f8, 0x2fa, 0x2fe, 0x303, 0x30f, 0x314, 0x31d, 0x323, 0x328, 0x32c, 0x331, 0x335, 0x345, 0x353, 0x361, 0x36f, 0x371, 0x373, 0x375, 0x379, 0x37b, 0x37e, 0x389, 0x38b, 0x395} - -// nfkcSparseValues: 919 entries, 3676 bytes -var nfkcSparseValues = [919]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0002, lo: 0x0d}, - {value: 0x0001, lo: 0xa0, hi: 0xa0}, - {value: 0x4331, lo: 0xa8, hi: 0xa8}, - {value: 0x0083, lo: 0xaa, hi: 0xaa}, - {value: 0x431d, lo: 0xaf, hi: 0xaf}, - {value: 0x0025, lo: 0xb2, hi: 0xb3}, - {value: 0x4313, lo: 0xb4, hi: 0xb4}, - {value: 0x0260, lo: 0xb5, hi: 0xb5}, - {value: 0x434a, lo: 0xb8, hi: 0xb8}, - {value: 0x0023, lo: 0xb9, hi: 0xb9}, - {value: 0x009f, lo: 0xba, hi: 0xba}, - {value: 0x234c, lo: 0xbc, hi: 0xbc}, - {value: 0x2340, lo: 0xbd, hi: 0xbd}, - {value: 0x23e2, lo: 0xbe, hi: 0xbe}, - // Block 0x1, offset 0xe - {value: 0x0091, lo: 0x03}, - {value: 0x4813, lo: 0xa0, hi: 0xa1}, - {value: 0x4845, lo: 0xaf, hi: 0xb0}, - {value: 0xa000, lo: 0xb7, hi: 0xb7}, - // Block 0x2, offset 0x12 - {value: 0x0004, lo: 0x09}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x0091, lo: 0xb0, hi: 0xb0}, - {value: 0x0140, lo: 0xb1, hi: 0xb1}, - {value: 0x0095, lo: 0xb2, hi: 0xb2}, - {value: 0x00a5, lo: 0xb3, hi: 0xb3}, - {value: 0x0179, lo: 0xb4, hi: 0xb4}, - {value: 0x017f, lo: 0xb5, hi: 0xb5}, - {value: 0x018b, lo: 0xb6, hi: 0xb6}, - {value: 0x00af, lo: 0xb7, hi: 0xb8}, - // Block 0x3, offset 0x1c - {value: 0x000a, lo: 0x09}, - {value: 0x4327, lo: 0x98, hi: 0x98}, - {value: 0x432c, lo: 0x99, hi: 0x9a}, - {value: 0x434f, lo: 0x9b, hi: 0x9b}, - {value: 0x4318, lo: 0x9c, hi: 0x9c}, - {value: 0x433b, lo: 0x9d, hi: 0x9d}, - {value: 0x0137, lo: 0xa0, hi: 0xa0}, - {value: 0x0099, lo: 0xa1, hi: 0xa1}, - {value: 0x00a7, lo: 0xa2, hi: 0xa3}, - {value: 0x01b8, lo: 0xa4, hi: 0xa4}, - // Block 0x4, offset 0x26 - {value: 0x0000, lo: 0x0f}, - {value: 0xa000, lo: 0x83, hi: 0x83}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0xa000, lo: 0x8b, hi: 0x8b}, - {value: 0xa000, lo: 0x8d, hi: 0x8d}, - {value: 0x3704, lo: 0x90, hi: 0x90}, - {value: 0x3710, lo: 0x91, hi: 0x91}, - {value: 0x36fe, lo: 0x93, hi: 0x93}, - {value: 0xa000, lo: 0x96, hi: 0x96}, - {value: 0x3776, lo: 0x97, hi: 0x97}, - {value: 0x3740, lo: 0x9c, hi: 0x9c}, - {value: 0x3728, lo: 0x9d, hi: 0x9d}, - {value: 0x3752, lo: 0x9e, hi: 0x9e}, - {value: 0xa000, lo: 0xb4, hi: 0xb5}, - {value: 0x377c, lo: 0xb6, hi: 0xb6}, - {value: 0x3782, lo: 0xb7, hi: 0xb7}, - // Block 0x5, offset 0x36 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x83, hi: 0x87}, - // Block 0x6, offset 0x38 - {value: 0x0001, lo: 0x04}, - {value: 0x8114, lo: 0x81, hi: 0x82}, - {value: 0x8133, lo: 0x84, hi: 0x84}, - {value: 0x812e, lo: 0x85, hi: 0x85}, - {value: 0x810e, lo: 0x87, hi: 0x87}, - // Block 0x7, offset 0x3d - {value: 0x0000, lo: 0x0a}, - {value: 0x8133, lo: 0x90, hi: 0x97}, - {value: 0x811a, lo: 0x98, hi: 0x98}, - {value: 0x811b, lo: 0x99, hi: 0x99}, - {value: 0x811c, lo: 0x9a, hi: 0x9a}, - {value: 0x37a0, lo: 0xa2, hi: 0xa2}, - {value: 0x37a6, lo: 0xa3, hi: 0xa3}, - {value: 0x37b2, lo: 0xa4, hi: 0xa4}, - {value: 0x37ac, lo: 0xa5, hi: 0xa5}, - {value: 0x37b8, lo: 0xa6, hi: 0xa6}, - {value: 0xa000, lo: 0xa7, hi: 0xa7}, - // Block 0x8, offset 0x48 - {value: 0x0000, lo: 0x0e}, - {value: 0x37ca, lo: 0x80, hi: 0x80}, - {value: 0xa000, lo: 0x81, hi: 0x81}, - {value: 0x37be, lo: 0x82, hi: 0x82}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x37c4, lo: 0x93, hi: 0x93}, - {value: 0xa000, lo: 0x95, hi: 0x95}, - {value: 0x8133, lo: 0x96, hi: 0x9c}, - {value: 0x8133, lo: 0x9f, hi: 0xa2}, - {value: 0x812e, lo: 0xa3, hi: 0xa3}, - {value: 0x8133, lo: 0xa4, hi: 0xa4}, - {value: 0x8133, lo: 0xa7, hi: 0xa8}, - {value: 0x812e, lo: 0xaa, hi: 0xaa}, - {value: 0x8133, lo: 0xab, hi: 0xac}, - {value: 0x812e, lo: 0xad, hi: 0xad}, - // Block 0x9, offset 0x57 - {value: 0x0000, lo: 0x0c}, - {value: 0x8120, lo: 0x91, hi: 0x91}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - {value: 0x812e, lo: 0xb1, hi: 0xb1}, - {value: 0x8133, lo: 0xb2, hi: 0xb3}, - {value: 0x812e, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb5, hi: 0xb6}, - {value: 0x812e, lo: 0xb7, hi: 0xb9}, - {value: 0x8133, lo: 0xba, hi: 0xba}, - {value: 0x812e, lo: 0xbb, hi: 0xbc}, - {value: 0x8133, lo: 0xbd, hi: 0xbd}, - {value: 0x812e, lo: 0xbe, hi: 0xbe}, - {value: 0x8133, lo: 0xbf, hi: 0xbf}, - // Block 0xa, offset 0x64 - {value: 0x0005, lo: 0x07}, - {value: 0x8133, lo: 0x80, hi: 0x80}, - {value: 0x8133, lo: 0x81, hi: 0x81}, - {value: 0x812e, lo: 0x82, hi: 0x83}, - {value: 0x812e, lo: 0x84, hi: 0x85}, - {value: 0x812e, lo: 0x86, hi: 0x87}, - {value: 0x812e, lo: 0x88, hi: 0x89}, - {value: 0x8133, lo: 0x8a, hi: 0x8a}, - // Block 0xb, offset 0x6c - {value: 0x0000, lo: 0x04}, - {value: 0x8133, lo: 0xab, hi: 0xb1}, - {value: 0x812e, lo: 0xb2, hi: 0xb2}, - {value: 0x8133, lo: 0xb3, hi: 0xb3}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - // Block 0xc, offset 0x71 - {value: 0x0000, lo: 0x04}, - {value: 0x8133, lo: 0x96, hi: 0x99}, - {value: 0x8133, lo: 0x9b, hi: 0xa3}, - {value: 0x8133, lo: 0xa5, hi: 0xa7}, - {value: 0x8133, lo: 0xa9, hi: 0xad}, - // Block 0xd, offset 0x76 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x99, hi: 0x9b}, - // Block 0xe, offset 0x78 - {value: 0x0000, lo: 0x03}, - {value: 0x8133, lo: 0x98, hi: 0x98}, - {value: 0x812e, lo: 0x99, hi: 0x9b}, - {value: 0x8133, lo: 0x9c, hi: 0x9f}, - // Block 0xf, offset 0x7c - {value: 0x0000, lo: 0x07}, - {value: 0xa000, lo: 0xa8, hi: 0xa8}, - {value: 0x3e37, lo: 0xa9, hi: 0xa9}, - {value: 0xa000, lo: 0xb0, hi: 0xb0}, - {value: 0x3e3f, lo: 0xb1, hi: 0xb1}, - {value: 0xa000, lo: 0xb3, hi: 0xb3}, - {value: 0x3e47, lo: 0xb4, hi: 0xb4}, - {value: 0x9903, lo: 0xbc, hi: 0xbc}, - // Block 0x10, offset 0x84 - {value: 0x0008, lo: 0x06}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x8133, lo: 0x91, hi: 0x91}, - {value: 0x812e, lo: 0x92, hi: 0x92}, - {value: 0x8133, lo: 0x93, hi: 0x93}, - {value: 0x8133, lo: 0x94, hi: 0x94}, - {value: 0x45d5, lo: 0x98, hi: 0x9f}, - // Block 0x11, offset 0x8b - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x12, offset 0x8e - {value: 0x0008, lo: 0x07}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x3e4f, lo: 0x8b, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x4615, lo: 0x9c, hi: 0x9d}, - {value: 0x4625, lo: 0x9f, hi: 0x9f}, - {value: 0x8133, lo: 0xbe, hi: 0xbe}, - // Block 0x13, offset 0x96 - {value: 0x0000, lo: 0x03}, - {value: 0x464d, lo: 0xb3, hi: 0xb3}, - {value: 0x4655, lo: 0xb6, hi: 0xb6}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - // Block 0x14, offset 0x9a - {value: 0x0008, lo: 0x03}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x462d, lo: 0x99, hi: 0x9b}, - {value: 0x4645, lo: 0x9e, hi: 0x9e}, - // Block 0x15, offset 0x9e - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - // Block 0x16, offset 0xa0 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - // Block 0x17, offset 0xa2 - {value: 0x0000, lo: 0x08}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x3e67, lo: 0x88, hi: 0x88}, - {value: 0x3e5f, lo: 0x8b, hi: 0x8b}, - {value: 0x3e6f, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x96, hi: 0x97}, - {value: 0x465d, lo: 0x9c, hi: 0x9c}, - {value: 0x4665, lo: 0x9d, hi: 0x9d}, - // Block 0x18, offset 0xab - {value: 0x0000, lo: 0x03}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x3e77, lo: 0x94, hi: 0x94}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x19, offset 0xaf - {value: 0x0000, lo: 0x06}, - {value: 0xa000, lo: 0x86, hi: 0x87}, - {value: 0x3e7f, lo: 0x8a, hi: 0x8a}, - {value: 0x3e8f, lo: 0x8b, hi: 0x8b}, - {value: 0x3e87, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - // Block 0x1a, offset 0xb6 - {value: 0x1801, lo: 0x04}, - {value: 0xa000, lo: 0x86, hi: 0x86}, - {value: 0x3e97, lo: 0x88, hi: 0x88}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x8121, lo: 0x95, hi: 0x96}, - // Block 0x1b, offset 0xbb - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - {value: 0xa000, lo: 0xbf, hi: 0xbf}, - // Block 0x1c, offset 0xbe - {value: 0x0000, lo: 0x09}, - {value: 0x3e9f, lo: 0x80, hi: 0x80}, - {value: 0x9900, lo: 0x82, hi: 0x82}, - {value: 0xa000, lo: 0x86, hi: 0x86}, - {value: 0x3ea7, lo: 0x87, hi: 0x87}, - {value: 0x3eaf, lo: 0x88, hi: 0x88}, - {value: 0x4adf, lo: 0x8a, hi: 0x8a}, - {value: 0x42f9, lo: 0x8b, hi: 0x8b}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x95, hi: 0x96}, - // Block 0x1d, offset 0xc8 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xbb, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x1e, offset 0xcb - {value: 0x0000, lo: 0x06}, - {value: 0xa000, lo: 0x86, hi: 0x87}, - {value: 0x3eb7, lo: 0x8a, hi: 0x8a}, - {value: 0x3ec7, lo: 0x8b, hi: 0x8b}, - {value: 0x3ebf, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - // Block 0x1f, offset 0xd2 - {value: 0x5a29, lo: 0x07}, - {value: 0x9905, lo: 0x8a, hi: 0x8a}, - {value: 0x9900, lo: 0x8f, hi: 0x8f}, - {value: 0xa000, lo: 0x99, hi: 0x99}, - {value: 0x3ecf, lo: 0x9a, hi: 0x9a}, - {value: 0x4ae7, lo: 0x9c, hi: 0x9c}, - {value: 0x4304, lo: 0x9d, hi: 0x9d}, - {value: 0x3ed7, lo: 0x9e, hi: 0x9f}, - // Block 0x20, offset 0xda - {value: 0x0000, lo: 0x03}, - {value: 0x2751, lo: 0xb3, hi: 0xb3}, - {value: 0x8123, lo: 0xb8, hi: 0xb9}, - {value: 0x8105, lo: 0xba, hi: 0xba}, - // Block 0x21, offset 0xde - {value: 0x0000, lo: 0x01}, - {value: 0x8124, lo: 0x88, hi: 0x8b}, - // Block 0x22, offset 0xe0 - {value: 0x0000, lo: 0x03}, - {value: 0x2766, lo: 0xb3, hi: 0xb3}, - {value: 0x8125, lo: 0xb8, hi: 0xb9}, - {value: 0x8105, lo: 0xba, hi: 0xba}, - // Block 0x23, offset 0xe4 - {value: 0x0000, lo: 0x03}, - {value: 0x8126, lo: 0x88, hi: 0x8b}, - {value: 0x2758, lo: 0x9c, hi: 0x9c}, - {value: 0x275f, lo: 0x9d, hi: 0x9d}, - // Block 0x24, offset 0xe8 - {value: 0x0000, lo: 0x05}, - {value: 0x03fe, lo: 0x8c, hi: 0x8c}, - {value: 0x812e, lo: 0x98, hi: 0x99}, - {value: 0x812e, lo: 0xb5, hi: 0xb5}, - {value: 0x812e, lo: 0xb7, hi: 0xb7}, - {value: 0x812c, lo: 0xb9, hi: 0xb9}, - // Block 0x25, offset 0xee - {value: 0x0000, lo: 0x10}, - {value: 0x2774, lo: 0x83, hi: 0x83}, - {value: 0x277b, lo: 0x8d, hi: 0x8d}, - {value: 0x2782, lo: 0x92, hi: 0x92}, - {value: 0x2789, lo: 0x97, hi: 0x97}, - {value: 0x2790, lo: 0x9c, hi: 0x9c}, - {value: 0x276d, lo: 0xa9, hi: 0xa9}, - {value: 0x8127, lo: 0xb1, hi: 0xb1}, - {value: 0x8128, lo: 0xb2, hi: 0xb2}, - {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, - {value: 0x8129, lo: 0xb4, hi: 0xb4}, - {value: 0x4bce, lo: 0xb5, hi: 0xb5}, - {value: 0x466d, lo: 0xb6, hi: 0xb6}, - {value: 0x4725, lo: 0xb7, hi: 0xb7}, - {value: 0x4675, lo: 0xb8, hi: 0xb8}, - {value: 0x4730, lo: 0xb9, hi: 0xb9}, - {value: 0x8128, lo: 0xba, hi: 0xbd}, - // Block 0x26, offset 0xff - {value: 0x0000, lo: 0x0b}, - {value: 0x8128, lo: 0x80, hi: 0x80}, - {value: 0x4bd7, lo: 0x81, hi: 0x81}, - {value: 0x8133, lo: 0x82, hi: 0x83}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0x86, hi: 0x87}, - {value: 0x279e, lo: 0x93, hi: 0x93}, - {value: 0x27a5, lo: 0x9d, hi: 0x9d}, - {value: 0x27ac, lo: 0xa2, hi: 0xa2}, - {value: 0x27b3, lo: 0xa7, hi: 0xa7}, - {value: 0x27ba, lo: 0xac, hi: 0xac}, - {value: 0x2797, lo: 0xb9, hi: 0xb9}, - // Block 0x27, offset 0x10b - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x86, hi: 0x86}, - // Block 0x28, offset 0x10d - {value: 0x0000, lo: 0x05}, - {value: 0xa000, lo: 0xa5, hi: 0xa5}, - {value: 0x3edf, lo: 0xa6, hi: 0xa6}, - {value: 0x9900, lo: 0xae, hi: 0xae}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - {value: 0x8105, lo: 0xb9, hi: 0xba}, - // Block 0x29, offset 0x113 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x8d, hi: 0x8d}, - // Block 0x2a, offset 0x115 - {value: 0x0000, lo: 0x01}, - {value: 0x0402, lo: 0xbc, hi: 0xbc}, - // Block 0x2b, offset 0x117 - {value: 0x0000, lo: 0x01}, - {value: 0xa000, lo: 0x80, hi: 0x92}, - // Block 0x2c, offset 0x119 - {value: 0x0000, lo: 0x01}, - {value: 0xb900, lo: 0xa1, hi: 0xb5}, - // Block 0x2d, offset 0x11b - {value: 0x0000, lo: 0x01}, - {value: 0x9900, lo: 0xa8, hi: 0xbf}, - // Block 0x2e, offset 0x11d - {value: 0x0000, lo: 0x01}, - {value: 0x9900, lo: 0x80, hi: 0x82}, - // Block 0x2f, offset 0x11f - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x9d, hi: 0x9f}, - // Block 0x30, offset 0x121 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x94, hi: 0x95}, - {value: 0x8105, lo: 0xb4, hi: 0xb4}, - // Block 0x31, offset 0x124 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x92, hi: 0x92}, - {value: 0x8133, lo: 0x9d, hi: 0x9d}, - // Block 0x32, offset 0x127 - {value: 0x0000, lo: 0x01}, - {value: 0x8132, lo: 0xa9, hi: 0xa9}, - // Block 0x33, offset 0x129 - {value: 0x0004, lo: 0x02}, - {value: 0x812f, lo: 0xb9, hi: 0xba}, - {value: 0x812e, lo: 0xbb, hi: 0xbb}, - // Block 0x34, offset 0x12c - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x97, hi: 0x97}, - {value: 0x812e, lo: 0x98, hi: 0x98}, - // Block 0x35, offset 0x12f - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0xa0, hi: 0xa0}, - {value: 0x8133, lo: 0xb5, hi: 0xbc}, - {value: 0x812e, lo: 0xbf, hi: 0xbf}, - // Block 0x36, offset 0x133 - {value: 0x0000, lo: 0x05}, - {value: 0x8133, lo: 0xb0, hi: 0xb4}, - {value: 0x812e, lo: 0xb5, hi: 0xba}, - {value: 0x8133, lo: 0xbb, hi: 0xbc}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - {value: 0x812e, lo: 0xbf, hi: 0xbf}, - // Block 0x37, offset 0x139 - {value: 0x0000, lo: 0x06}, - {value: 0x812e, lo: 0x80, hi: 0x80}, - {value: 0x8133, lo: 0x81, hi: 0x82}, - {value: 0x812e, lo: 0x83, hi: 0x84}, - {value: 0x8133, lo: 0x85, hi: 0x89}, - {value: 0x812e, lo: 0x8a, hi: 0x8a}, - {value: 0x8133, lo: 0x8b, hi: 0x8e}, - // Block 0x38, offset 0x140 - {value: 0x0000, lo: 0x08}, - {value: 0x3f27, lo: 0x80, hi: 0x80}, - {value: 0x3f2f, lo: 0x81, hi: 0x81}, - {value: 0xa000, lo: 0x82, hi: 0x82}, - {value: 0x3f37, lo: 0x83, hi: 0x83}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0xab, hi: 0xab}, - {value: 0x812e, lo: 0xac, hi: 0xac}, - {value: 0x8133, lo: 0xad, hi: 0xb3}, - // Block 0x39, offset 0x149 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xaa, hi: 0xab}, - // Block 0x3a, offset 0x14b - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xa6, hi: 0xa6}, - {value: 0x8105, lo: 0xb2, hi: 0xb3}, - // Block 0x3b, offset 0x14e - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - // Block 0x3c, offset 0x150 - {value: 0x0000, lo: 0x0a}, - {value: 0x8133, lo: 0x90, hi: 0x92}, - {value: 0x8101, lo: 0x94, hi: 0x94}, - {value: 0x812e, lo: 0x95, hi: 0x99}, - {value: 0x8133, lo: 0x9a, hi: 0x9b}, - {value: 0x812e, lo: 0x9c, hi: 0x9f}, - {value: 0x8133, lo: 0xa0, hi: 0xa0}, - {value: 0x8101, lo: 0xa2, hi: 0xa8}, - {value: 0x812e, lo: 0xad, hi: 0xad}, - {value: 0x8133, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb8, hi: 0xb9}, - // Block 0x3d, offset 0x15b - {value: 0x0002, lo: 0x0a}, - {value: 0x0043, lo: 0xac, hi: 0xac}, - {value: 0x00d1, lo: 0xad, hi: 0xad}, - {value: 0x0045, lo: 0xae, hi: 0xae}, - {value: 0x0049, lo: 0xb0, hi: 0xb1}, - {value: 0x00ec, lo: 0xb2, hi: 0xb2}, - {value: 0x004f, lo: 0xb3, hi: 0xba}, - {value: 0x005f, lo: 0xbc, hi: 0xbc}, - {value: 0x00fe, lo: 0xbd, hi: 0xbd}, - {value: 0x0061, lo: 0xbe, hi: 0xbe}, - {value: 0x0065, lo: 0xbf, hi: 0xbf}, - // Block 0x3e, offset 0x166 - {value: 0x0000, lo: 0x0d}, - {value: 0x0001, lo: 0x80, hi: 0x8a}, - {value: 0x0532, lo: 0x91, hi: 0x91}, - {value: 0x4354, lo: 0x97, hi: 0x97}, - {value: 0x001d, lo: 0xa4, hi: 0xa4}, - {value: 0x19a0, lo: 0xa5, hi: 0xa5}, - {value: 0x1c8c, lo: 0xa6, hi: 0xa6}, - {value: 0x0001, lo: 0xaf, hi: 0xaf}, - {value: 0x27c1, lo: 0xb3, hi: 0xb3}, - {value: 0x2935, lo: 0xb4, hi: 0xb4}, - {value: 0x27c8, lo: 0xb6, hi: 0xb6}, - {value: 0x293f, lo: 0xb7, hi: 0xb7}, - {value: 0x199a, lo: 0xbc, hi: 0xbc}, - {value: 0x4322, lo: 0xbe, hi: 0xbe}, - // Block 0x3f, offset 0x174 - {value: 0x0002, lo: 0x0d}, - {value: 0x1a60, lo: 0x87, hi: 0x87}, - {value: 0x1a5d, lo: 0x88, hi: 0x88}, - {value: 0x199d, lo: 0x89, hi: 0x89}, - {value: 0x2ac5, lo: 0x97, hi: 0x97}, - {value: 0x0001, lo: 0x9f, hi: 0x9f}, - {value: 0x0021, lo: 0xb0, hi: 0xb0}, - {value: 0x0093, lo: 0xb1, hi: 0xb1}, - {value: 0x0029, lo: 0xb4, hi: 0xb9}, - {value: 0x0017, lo: 0xba, hi: 0xba}, - {value: 0x055e, lo: 0xbb, hi: 0xbb}, - {value: 0x003b, lo: 0xbc, hi: 0xbc}, - {value: 0x0011, lo: 0xbd, hi: 0xbe}, - {value: 0x009d, lo: 0xbf, hi: 0xbf}, - // Block 0x40, offset 0x182 - {value: 0x0002, lo: 0x0f}, - {value: 0x0021, lo: 0x80, hi: 0x89}, - {value: 0x0017, lo: 0x8a, hi: 0x8a}, - {value: 0x055e, lo: 0x8b, hi: 0x8b}, - {value: 0x003b, lo: 0x8c, hi: 0x8c}, - {value: 0x0011, lo: 0x8d, hi: 0x8e}, - {value: 0x0083, lo: 0x90, hi: 0x90}, - {value: 0x008b, lo: 0x91, hi: 0x91}, - {value: 0x009f, lo: 0x92, hi: 0x92}, - {value: 0x00b1, lo: 0x93, hi: 0x93}, - {value: 0x011f, lo: 0x94, hi: 0x94}, - {value: 0x0091, lo: 0x95, hi: 0x95}, - {value: 0x0097, lo: 0x96, hi: 0x99}, - {value: 0x00a1, lo: 0x9a, hi: 0x9a}, - {value: 0x00a7, lo: 0x9b, hi: 0x9c}, - {value: 0x1ac9, lo: 0xa8, hi: 0xa8}, - // Block 0x41, offset 0x192 - {value: 0x0000, lo: 0x0d}, - {value: 0x8133, lo: 0x90, hi: 0x91}, - {value: 0x8101, lo: 0x92, hi: 0x93}, - {value: 0x8133, lo: 0x94, hi: 0x97}, - {value: 0x8101, lo: 0x98, hi: 0x9a}, - {value: 0x8133, lo: 0x9b, hi: 0x9c}, - {value: 0x8133, lo: 0xa1, hi: 0xa1}, - {value: 0x8101, lo: 0xa5, hi: 0xa6}, - {value: 0x8133, lo: 0xa7, hi: 0xa7}, - {value: 0x812e, lo: 0xa8, hi: 0xa8}, - {value: 0x8133, lo: 0xa9, hi: 0xa9}, - {value: 0x8101, lo: 0xaa, hi: 0xab}, - {value: 0x812e, lo: 0xac, hi: 0xaf}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - // Block 0x42, offset 0x1a0 - {value: 0x0007, lo: 0x06}, - {value: 0x22b0, lo: 0x89, hi: 0x89}, - {value: 0xa000, lo: 0x90, hi: 0x90}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0xa000, lo: 0x94, hi: 0x94}, - {value: 0x3b18, lo: 0x9a, hi: 0x9b}, - {value: 0x3b26, lo: 0xae, hi: 0xae}, - // Block 0x43, offset 0x1a7 - {value: 0x000e, lo: 0x05}, - {value: 0x3b2d, lo: 0x8d, hi: 0x8e}, - {value: 0x3b34, lo: 0x8f, hi: 0x8f}, - {value: 0xa000, lo: 0x90, hi: 0x90}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0xa000, lo: 0x94, hi: 0x94}, - // Block 0x44, offset 0x1ad - {value: 0x017a, lo: 0x0e}, - {value: 0xa000, lo: 0x83, hi: 0x83}, - {value: 0x3b42, lo: 0x84, hi: 0x84}, - {value: 0xa000, lo: 0x88, hi: 0x88}, - {value: 0x3b49, lo: 0x89, hi: 0x89}, - {value: 0xa000, lo: 0x8b, hi: 0x8b}, - {value: 0x3b50, lo: 0x8c, hi: 0x8c}, - {value: 0xa000, lo: 0xa3, hi: 0xa3}, - {value: 0x3b57, lo: 0xa4, hi: 0xa4}, - {value: 0xa000, lo: 0xa5, hi: 0xa5}, - {value: 0x3b5e, lo: 0xa6, hi: 0xa6}, - {value: 0x27cf, lo: 0xac, hi: 0xad}, - {value: 0x27d6, lo: 0xaf, hi: 0xaf}, - {value: 0x2953, lo: 0xb0, hi: 0xb0}, - {value: 0xa000, lo: 0xbc, hi: 0xbc}, - // Block 0x45, offset 0x1bc - {value: 0x0007, lo: 0x03}, - {value: 0x3bc7, lo: 0xa0, hi: 0xa1}, - {value: 0x3bf1, lo: 0xa2, hi: 0xa3}, - {value: 0x3c1b, lo: 0xaa, hi: 0xad}, - // Block 0x46, offset 0x1c0 - {value: 0x0004, lo: 0x01}, - {value: 0x0586, lo: 0xa9, hi: 0xaa}, - // Block 0x47, offset 0x1c2 - {value: 0x0002, lo: 0x03}, - {value: 0x0057, lo: 0x80, hi: 0x8f}, - {value: 0x0083, lo: 0x90, hi: 0xa9}, - {value: 0x0021, lo: 0xaa, hi: 0xaa}, - // Block 0x48, offset 0x1c6 - {value: 0x0000, lo: 0x01}, - {value: 0x2ad2, lo: 0x8c, hi: 0x8c}, - // Block 0x49, offset 0x1c8 - {value: 0x0266, lo: 0x02}, - {value: 0x1cbc, lo: 0xb4, hi: 0xb4}, - {value: 0x1a5a, lo: 0xb5, hi: 0xb6}, - // Block 0x4a, offset 0x1cb - {value: 0x0000, lo: 0x01}, - {value: 0x4596, lo: 0x9c, hi: 0x9c}, - // Block 0x4b, offset 0x1cd - {value: 0x0000, lo: 0x02}, - {value: 0x0095, lo: 0xbc, hi: 0xbc}, - {value: 0x006d, lo: 0xbd, hi: 0xbd}, - // Block 0x4c, offset 0x1d0 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xaf, hi: 0xb1}, - // Block 0x4d, offset 0x1d2 - {value: 0x0000, lo: 0x02}, - {value: 0x057a, lo: 0xaf, hi: 0xaf}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x4e, offset 0x1d5 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xa0, hi: 0xbf}, - // Block 0x4f, offset 0x1d7 - {value: 0x0000, lo: 0x01}, - {value: 0x0ebe, lo: 0x9f, hi: 0x9f}, - // Block 0x50, offset 0x1d9 - {value: 0x0000, lo: 0x01}, - {value: 0x172a, lo: 0xb3, hi: 0xb3}, - // Block 0x51, offset 0x1db - {value: 0x0004, lo: 0x0b}, - {value: 0x1692, lo: 0x80, hi: 0x82}, - {value: 0x16aa, lo: 0x83, hi: 0x83}, - {value: 0x16c2, lo: 0x84, hi: 0x85}, - {value: 0x16d2, lo: 0x86, hi: 0x89}, - {value: 0x16e6, lo: 0x8a, hi: 0x8c}, - {value: 0x16fa, lo: 0x8d, hi: 0x8d}, - {value: 0x1702, lo: 0x8e, hi: 0x8e}, - {value: 0x170a, lo: 0x8f, hi: 0x90}, - {value: 0x1716, lo: 0x91, hi: 0x93}, - {value: 0x1726, lo: 0x94, hi: 0x94}, - {value: 0x172e, lo: 0x95, hi: 0x95}, - // Block 0x52, offset 0x1e7 - {value: 0x0004, lo: 0x09}, - {value: 0x0001, lo: 0x80, hi: 0x80}, - {value: 0x812d, lo: 0xaa, hi: 0xaa}, - {value: 0x8132, lo: 0xab, hi: 0xab}, - {value: 0x8134, lo: 0xac, hi: 0xac}, - {value: 0x812f, lo: 0xad, hi: 0xad}, - {value: 0x8130, lo: 0xae, hi: 0xae}, - {value: 0x8130, lo: 0xaf, hi: 0xaf}, - {value: 0x05ae, lo: 0xb6, hi: 0xb6}, - {value: 0x0982, lo: 0xb8, hi: 0xba}, - // Block 0x53, offset 0x1f1 - {value: 0x0006, lo: 0x09}, - {value: 0x0406, lo: 0xb1, hi: 0xb1}, - {value: 0x040a, lo: 0xb2, hi: 0xb2}, - {value: 0x4b7c, lo: 0xb3, hi: 0xb3}, - {value: 0x040e, lo: 0xb4, hi: 0xb4}, - {value: 0x4b82, lo: 0xb5, hi: 0xb6}, - {value: 0x0412, lo: 0xb7, hi: 0xb7}, - {value: 0x0416, lo: 0xb8, hi: 0xb8}, - {value: 0x041a, lo: 0xb9, hi: 0xb9}, - {value: 0x4b8e, lo: 0xba, hi: 0xbf}, - // Block 0x54, offset 0x1fb - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0xaf, hi: 0xaf}, - {value: 0x8133, lo: 0xb4, hi: 0xbd}, - // Block 0x55, offset 0x1fe - {value: 0x0000, lo: 0x03}, - {value: 0x02d8, lo: 0x9c, hi: 0x9c}, - {value: 0x02de, lo: 0x9d, hi: 0x9d}, - {value: 0x8133, lo: 0x9e, hi: 0x9f}, - // Block 0x56, offset 0x202 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb0, hi: 0xb1}, - // Block 0x57, offset 0x204 - {value: 0x0000, lo: 0x01}, - {value: 0x173e, lo: 0xb0, hi: 0xb0}, - // Block 0x58, offset 0x206 - {value: 0x0006, lo: 0x04}, - {value: 0x0047, lo: 0xb2, hi: 0xb3}, - {value: 0x0063, lo: 0xb4, hi: 0xb4}, - {value: 0x00dd, lo: 0xb8, hi: 0xb8}, - {value: 0x00e9, lo: 0xb9, hi: 0xb9}, - // Block 0x59, offset 0x20b - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x86, hi: 0x86}, - {value: 0x8105, lo: 0xac, hi: 0xac}, - // Block 0x5a, offset 0x20e - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0xa0, hi: 0xb1}, - // Block 0x5b, offset 0x211 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xab, hi: 0xad}, - // Block 0x5c, offset 0x213 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x93, hi: 0x93}, - // Block 0x5d, offset 0x215 - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xb3, hi: 0xb3}, - // Block 0x5e, offset 0x217 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x80, hi: 0x80}, - // Block 0x5f, offset 0x219 - {value: 0x0000, lo: 0x05}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - {value: 0x8133, lo: 0xb2, hi: 0xb3}, - {value: 0x812e, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb7, hi: 0xb8}, - {value: 0x8133, lo: 0xbe, hi: 0xbf}, - // Block 0x60, offset 0x21f - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x81, hi: 0x81}, - {value: 0x8105, lo: 0xb6, hi: 0xb6}, - // Block 0x61, offset 0x222 - {value: 0x000c, lo: 0x04}, - {value: 0x173a, lo: 0x9c, hi: 0x9d}, - {value: 0x014f, lo: 0x9e, hi: 0x9e}, - {value: 0x174a, lo: 0x9f, hi: 0x9f}, - {value: 0x01a6, lo: 0xa9, hi: 0xa9}, - // Block 0x62, offset 0x227 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xad, hi: 0xad}, - // Block 0x63, offset 0x229 - {value: 0x0000, lo: 0x06}, - {value: 0xe500, lo: 0x80, hi: 0x80}, - {value: 0xc600, lo: 0x81, hi: 0x9b}, - {value: 0xe500, lo: 0x9c, hi: 0x9c}, - {value: 0xc600, lo: 0x9d, hi: 0xb7}, - {value: 0xe500, lo: 0xb8, hi: 0xb8}, - {value: 0xc600, lo: 0xb9, hi: 0xbf}, - // Block 0x64, offset 0x230 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x93}, - {value: 0xe500, lo: 0x94, hi: 0x94}, - {value: 0xc600, lo: 0x95, hi: 0xaf}, - {value: 0xe500, lo: 0xb0, hi: 0xb0}, - {value: 0xc600, lo: 0xb1, hi: 0xbf}, - // Block 0x65, offset 0x236 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x8b}, - {value: 0xe500, lo: 0x8c, hi: 0x8c}, - {value: 0xc600, lo: 0x8d, hi: 0xa7}, - {value: 0xe500, lo: 0xa8, hi: 0xa8}, - {value: 0xc600, lo: 0xa9, hi: 0xbf}, - // Block 0x66, offset 0x23c - {value: 0x0000, lo: 0x07}, - {value: 0xc600, lo: 0x80, hi: 0x83}, - {value: 0xe500, lo: 0x84, hi: 0x84}, - {value: 0xc600, lo: 0x85, hi: 0x9f}, - {value: 0xe500, lo: 0xa0, hi: 0xa0}, - {value: 0xc600, lo: 0xa1, hi: 0xbb}, - {value: 0xe500, lo: 0xbc, hi: 0xbc}, - {value: 0xc600, lo: 0xbd, hi: 0xbf}, - // Block 0x67, offset 0x244 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x97}, - {value: 0xe500, lo: 0x98, hi: 0x98}, - {value: 0xc600, lo: 0x99, hi: 0xb3}, - {value: 0xe500, lo: 0xb4, hi: 0xb4}, - {value: 0xc600, lo: 0xb5, hi: 0xbf}, - // Block 0x68, offset 0x24a - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x8f}, - {value: 0xe500, lo: 0x90, hi: 0x90}, - {value: 0xc600, lo: 0x91, hi: 0xab}, - {value: 0xe500, lo: 0xac, hi: 0xac}, - {value: 0xc600, lo: 0xad, hi: 0xbf}, - // Block 0x69, offset 0x250 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x87}, - {value: 0xe500, lo: 0x88, hi: 0x88}, - {value: 0xc600, lo: 0x89, hi: 0xa3}, - {value: 0xe500, lo: 0xa4, hi: 0xa4}, - {value: 0xc600, lo: 0xa5, hi: 0xbf}, - // Block 0x6a, offset 0x256 - {value: 0x0000, lo: 0x03}, - {value: 0xc600, lo: 0x80, hi: 0x87}, - {value: 0xe500, lo: 0x88, hi: 0x88}, - {value: 0xc600, lo: 0x89, hi: 0xa3}, - // Block 0x6b, offset 0x25a - {value: 0x0002, lo: 0x01}, - {value: 0x0003, lo: 0x81, hi: 0xbf}, - // Block 0x6c, offset 0x25c - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - // Block 0x6d, offset 0x25e - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xa0, hi: 0xa0}, - // Block 0x6e, offset 0x260 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb6, hi: 0xba}, - // Block 0x6f, offset 0x262 - {value: 0x002d, lo: 0x05}, - {value: 0x812e, lo: 0x8d, hi: 0x8d}, - {value: 0x8133, lo: 0x8f, hi: 0x8f}, - {value: 0x8133, lo: 0xb8, hi: 0xb8}, - {value: 0x8101, lo: 0xb9, hi: 0xba}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x70, offset 0x268 - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0xa5, hi: 0xa5}, - {value: 0x812e, lo: 0xa6, hi: 0xa6}, - // Block 0x71, offset 0x26b - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xa4, hi: 0xa7}, - // Block 0x72, offset 0x26d - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xab, hi: 0xac}, - // Block 0x73, offset 0x26f - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xbd, hi: 0xbf}, - // Block 0x74, offset 0x271 - {value: 0x0000, lo: 0x05}, - {value: 0x812e, lo: 0x86, hi: 0x87}, - {value: 0x8133, lo: 0x88, hi: 0x8a}, - {value: 0x812e, lo: 0x8b, hi: 0x8b}, - {value: 0x8133, lo: 0x8c, hi: 0x8c}, - {value: 0x812e, lo: 0x8d, hi: 0x90}, - // Block 0x75, offset 0x277 - {value: 0x0005, lo: 0x03}, - {value: 0x8133, lo: 0x82, hi: 0x82}, - {value: 0x812e, lo: 0x83, hi: 0x84}, - {value: 0x812e, lo: 0x85, hi: 0x85}, - // Block 0x76, offset 0x27b - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0x86, hi: 0x86}, - {value: 0x8105, lo: 0xb0, hi: 0xb0}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x77, offset 0x27f - {value: 0x17fe, lo: 0x07}, - {value: 0xa000, lo: 0x99, hi: 0x99}, - {value: 0x4277, lo: 0x9a, hi: 0x9a}, - {value: 0xa000, lo: 0x9b, hi: 0x9b}, - {value: 0x4281, lo: 0x9c, hi: 0x9c}, - {value: 0xa000, lo: 0xa5, hi: 0xa5}, - {value: 0x428b, lo: 0xab, hi: 0xab}, - {value: 0x8105, lo: 0xb9, hi: 0xba}, - // Block 0x78, offset 0x287 - {value: 0x0000, lo: 0x06}, - {value: 0x8133, lo: 0x80, hi: 0x82}, - {value: 0x9900, lo: 0xa7, hi: 0xa7}, - {value: 0x4295, lo: 0xae, hi: 0xae}, - {value: 0x429f, lo: 0xaf, hi: 0xaf}, - {value: 0xa000, lo: 0xb1, hi: 0xb2}, - {value: 0x8105, lo: 0xb3, hi: 0xb4}, - // Block 0x79, offset 0x28e - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x80, hi: 0x80}, - {value: 0x8103, lo: 0x8a, hi: 0x8a}, - // Block 0x7a, offset 0x291 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb5, hi: 0xb5}, - {value: 0x8103, lo: 0xb6, hi: 0xb6}, - // Block 0x7b, offset 0x294 - {value: 0x0002, lo: 0x01}, - {value: 0x8103, lo: 0xa9, hi: 0xaa}, - // Block 0x7c, offset 0x296 - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbb, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x7d, offset 0x299 - {value: 0x0000, lo: 0x07}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x42a9, lo: 0x8b, hi: 0x8b}, - {value: 0x42b3, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x8133, lo: 0xa6, hi: 0xac}, - {value: 0x8133, lo: 0xb0, hi: 0xb4}, - // Block 0x7e, offset 0x2a1 - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0x82, hi: 0x82}, - {value: 0x8103, lo: 0x86, hi: 0x86}, - {value: 0x8133, lo: 0x9e, hi: 0x9e}, - // Block 0x7f, offset 0x2a5 - {value: 0x5643, lo: 0x06}, - {value: 0x9900, lo: 0xb0, hi: 0xb0}, - {value: 0xa000, lo: 0xb9, hi: 0xb9}, - {value: 0x9900, lo: 0xba, hi: 0xba}, - {value: 0x42c7, lo: 0xbb, hi: 0xbb}, - {value: 0x42bd, lo: 0xbc, hi: 0xbd}, - {value: 0x42d1, lo: 0xbe, hi: 0xbe}, - // Block 0x80, offset 0x2ac - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x82, hi: 0x82}, - {value: 0x8103, lo: 0x83, hi: 0x83}, - // Block 0x81, offset 0x2af - {value: 0x0000, lo: 0x05}, - {value: 0x9900, lo: 0xaf, hi: 0xaf}, - {value: 0xa000, lo: 0xb8, hi: 0xb9}, - {value: 0x42db, lo: 0xba, hi: 0xba}, - {value: 0x42e5, lo: 0xbb, hi: 0xbb}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x82, offset 0x2b5 - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0x80, hi: 0x80}, - // Block 0x83, offset 0x2b7 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x84, offset 0x2b9 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb6, hi: 0xb6}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - // Block 0x85, offset 0x2bc - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xab, hi: 0xab}, - // Block 0x86, offset 0x2be - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb9, hi: 0xb9}, - {value: 0x8103, lo: 0xba, hi: 0xba}, - // Block 0x87, offset 0x2c1 - {value: 0x0000, lo: 0x04}, - {value: 0x9900, lo: 0xb0, hi: 0xb0}, - {value: 0xa000, lo: 0xb5, hi: 0xb5}, - {value: 0x42ef, lo: 0xb8, hi: 0xb8}, - {value: 0x8105, lo: 0xbd, hi: 0xbe}, - // Block 0x88, offset 0x2c6 - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0x83, hi: 0x83}, - // Block 0x89, offset 0x2c8 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xa0, hi: 0xa0}, - // Block 0x8a, offset 0x2ca - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xb4, hi: 0xb4}, - // Block 0x8b, offset 0x2cc - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x87, hi: 0x87}, - // Block 0x8c, offset 0x2ce - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x99, hi: 0x99}, - // Block 0x8d, offset 0x2d0 - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0x82, hi: 0x82}, - {value: 0x8105, lo: 0x84, hi: 0x85}, - // Block 0x8e, offset 0x2d3 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x97, hi: 0x97}, - // Block 0x8f, offset 0x2d5 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x81, hi: 0x82}, - // Block 0x90, offset 0x2d7 - {value: 0x0000, lo: 0x01}, - {value: 0x8101, lo: 0xb0, hi: 0xb4}, - // Block 0x91, offset 0x2d9 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb0, hi: 0xb6}, - // Block 0x92, offset 0x2db - {value: 0x0000, lo: 0x01}, - {value: 0x8102, lo: 0xb0, hi: 0xb1}, - // Block 0x93, offset 0x2dd - {value: 0x0000, lo: 0x01}, - {value: 0x8101, lo: 0x9e, hi: 0x9e}, - // Block 0x94, offset 0x2df - {value: 0x0000, lo: 0x0c}, - {value: 0x46fd, lo: 0x9e, hi: 0x9e}, - {value: 0x4707, lo: 0x9f, hi: 0x9f}, - {value: 0x473b, lo: 0xa0, hi: 0xa0}, - {value: 0x4749, lo: 0xa1, hi: 0xa1}, - {value: 0x4757, lo: 0xa2, hi: 0xa2}, - {value: 0x4765, lo: 0xa3, hi: 0xa3}, - {value: 0x4773, lo: 0xa4, hi: 0xa4}, - {value: 0x812c, lo: 0xa5, hi: 0xa6}, - {value: 0x8101, lo: 0xa7, hi: 0xa9}, - {value: 0x8131, lo: 0xad, hi: 0xad}, - {value: 0x812c, lo: 0xae, hi: 0xb2}, - {value: 0x812e, lo: 0xbb, hi: 0xbf}, - // Block 0x95, offset 0x2ec - {value: 0x0000, lo: 0x09}, - {value: 0x812e, lo: 0x80, hi: 0x82}, - {value: 0x8133, lo: 0x85, hi: 0x89}, - {value: 0x812e, lo: 0x8a, hi: 0x8b}, - {value: 0x8133, lo: 0xaa, hi: 0xad}, - {value: 0x4711, lo: 0xbb, hi: 0xbb}, - {value: 0x471b, lo: 0xbc, hi: 0xbc}, - {value: 0x4781, lo: 0xbd, hi: 0xbd}, - {value: 0x479d, lo: 0xbe, hi: 0xbe}, - {value: 0x478f, lo: 0xbf, hi: 0xbf}, - // Block 0x96, offset 0x2f6 - {value: 0x0000, lo: 0x01}, - {value: 0x47ab, lo: 0x80, hi: 0x80}, - // Block 0x97, offset 0x2f8 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x82, hi: 0x84}, - // Block 0x98, offset 0x2fa - {value: 0x0002, lo: 0x03}, - {value: 0x0043, lo: 0x80, hi: 0x99}, - {value: 0x0083, lo: 0x9a, hi: 0xb3}, - {value: 0x0043, lo: 0xb4, hi: 0xbf}, - // Block 0x99, offset 0x2fe - {value: 0x0002, lo: 0x04}, - {value: 0x005b, lo: 0x80, hi: 0x8d}, - {value: 0x0083, lo: 0x8e, hi: 0x94}, - {value: 0x0093, lo: 0x96, hi: 0xa7}, - {value: 0x0043, lo: 0xa8, hi: 0xbf}, - // Block 0x9a, offset 0x303 - {value: 0x0002, lo: 0x0b}, - {value: 0x0073, lo: 0x80, hi: 0x81}, - {value: 0x0083, lo: 0x82, hi: 0x9b}, - {value: 0x0043, lo: 0x9c, hi: 0x9c}, - {value: 0x0047, lo: 0x9e, hi: 0x9f}, - {value: 0x004f, lo: 0xa2, hi: 0xa2}, - {value: 0x0055, lo: 0xa5, hi: 0xa6}, - {value: 0x005d, lo: 0xa9, hi: 0xac}, - {value: 0x0067, lo: 0xae, hi: 0xb5}, - {value: 0x0083, lo: 0xb6, hi: 0xb9}, - {value: 0x008d, lo: 0xbb, hi: 0xbb}, - {value: 0x0091, lo: 0xbd, hi: 0xbf}, - // Block 0x9b, offset 0x30f - {value: 0x0002, lo: 0x04}, - {value: 0x0097, lo: 0x80, hi: 0x83}, - {value: 0x00a1, lo: 0x85, hi: 0x8f}, - {value: 0x0043, lo: 0x90, hi: 0xa9}, - {value: 0x0083, lo: 0xaa, hi: 0xbf}, - // Block 0x9c, offset 0x314 - {value: 0x0002, lo: 0x08}, - {value: 0x00af, lo: 0x80, hi: 0x83}, - {value: 0x0043, lo: 0x84, hi: 0x85}, - {value: 0x0049, lo: 0x87, hi: 0x8a}, - {value: 0x0055, lo: 0x8d, hi: 0x94}, - {value: 0x0067, lo: 0x96, hi: 0x9c}, - {value: 0x0083, lo: 0x9e, hi: 0xb7}, - {value: 0x0043, lo: 0xb8, hi: 0xb9}, - {value: 0x0049, lo: 0xbb, hi: 0xbe}, - // Block 0x9d, offset 0x31d - {value: 0x0002, lo: 0x05}, - {value: 0x0053, lo: 0x80, hi: 0x84}, - {value: 0x005f, lo: 0x86, hi: 0x86}, - {value: 0x0067, lo: 0x8a, hi: 0x90}, - {value: 0x0083, lo: 0x92, hi: 0xab}, - {value: 0x0043, lo: 0xac, hi: 0xbf}, - // Block 0x9e, offset 0x323 - {value: 0x0002, lo: 0x04}, - {value: 0x006b, lo: 0x80, hi: 0x85}, - {value: 0x0083, lo: 0x86, hi: 0x9f}, - {value: 0x0043, lo: 0xa0, hi: 0xb9}, - {value: 0x0083, lo: 0xba, hi: 0xbf}, - // Block 0x9f, offset 0x328 - {value: 0x0002, lo: 0x03}, - {value: 0x008f, lo: 0x80, hi: 0x93}, - {value: 0x0043, lo: 0x94, hi: 0xad}, - {value: 0x0083, lo: 0xae, hi: 0xbf}, - // Block 0xa0, offset 0x32c - {value: 0x0002, lo: 0x04}, - {value: 0x00a7, lo: 0x80, hi: 0x87}, - {value: 0x0043, lo: 0x88, hi: 0xa1}, - {value: 0x0083, lo: 0xa2, hi: 0xbb}, - {value: 0x0043, lo: 0xbc, hi: 0xbf}, - // Block 0xa1, offset 0x331 - {value: 0x0002, lo: 0x03}, - {value: 0x004b, lo: 0x80, hi: 0x95}, - {value: 0x0083, lo: 0x96, hi: 0xaf}, - {value: 0x0043, lo: 0xb0, hi: 0xbf}, - // Block 0xa2, offset 0x335 - {value: 0x0003, lo: 0x0f}, - {value: 0x023c, lo: 0x80, hi: 0x80}, - {value: 0x0556, lo: 0x81, hi: 0x81}, - {value: 0x023f, lo: 0x82, hi: 0x9a}, - {value: 0x0552, lo: 0x9b, hi: 0x9b}, - {value: 0x024b, lo: 0x9c, hi: 0x9c}, - {value: 0x0254, lo: 0x9d, hi: 0x9d}, - {value: 0x025a, lo: 0x9e, hi: 0x9e}, - {value: 0x027e, lo: 0x9f, hi: 0x9f}, - {value: 0x026f, lo: 0xa0, hi: 0xa0}, - {value: 0x026c, lo: 0xa1, hi: 0xa1}, - {value: 0x01f7, lo: 0xa2, hi: 0xb2}, - {value: 0x020c, lo: 0xb3, hi: 0xb3}, - {value: 0x022a, lo: 0xb4, hi: 0xba}, - {value: 0x0556, lo: 0xbb, hi: 0xbb}, - {value: 0x023f, lo: 0xbc, hi: 0xbf}, - // Block 0xa3, offset 0x345 - {value: 0x0003, lo: 0x0d}, - {value: 0x024b, lo: 0x80, hi: 0x94}, - {value: 0x0552, lo: 0x95, hi: 0x95}, - {value: 0x024b, lo: 0x96, hi: 0x96}, - {value: 0x0254, lo: 0x97, hi: 0x97}, - {value: 0x025a, lo: 0x98, hi: 0x98}, - {value: 0x027e, lo: 0x99, hi: 0x99}, - {value: 0x026f, lo: 0x9a, hi: 0x9a}, - {value: 0x026c, lo: 0x9b, hi: 0x9b}, - {value: 0x01f7, lo: 0x9c, hi: 0xac}, - {value: 0x020c, lo: 0xad, hi: 0xad}, - {value: 0x022a, lo: 0xae, hi: 0xb4}, - {value: 0x0556, lo: 0xb5, hi: 0xb5}, - {value: 0x023f, lo: 0xb6, hi: 0xbf}, - // Block 0xa4, offset 0x353 - {value: 0x0003, lo: 0x0d}, - {value: 0x025d, lo: 0x80, hi: 0x8e}, - {value: 0x0552, lo: 0x8f, hi: 0x8f}, - {value: 0x024b, lo: 0x90, hi: 0x90}, - {value: 0x0254, lo: 0x91, hi: 0x91}, - {value: 0x025a, lo: 0x92, hi: 0x92}, - {value: 0x027e, lo: 0x93, hi: 0x93}, - {value: 0x026f, lo: 0x94, hi: 0x94}, - {value: 0x026c, lo: 0x95, hi: 0x95}, - {value: 0x01f7, lo: 0x96, hi: 0xa6}, - {value: 0x020c, lo: 0xa7, hi: 0xa7}, - {value: 0x022a, lo: 0xa8, hi: 0xae}, - {value: 0x0556, lo: 0xaf, hi: 0xaf}, - {value: 0x023f, lo: 0xb0, hi: 0xbf}, - // Block 0xa5, offset 0x361 - {value: 0x0003, lo: 0x0d}, - {value: 0x026f, lo: 0x80, hi: 0x88}, - {value: 0x0552, lo: 0x89, hi: 0x89}, - {value: 0x024b, lo: 0x8a, hi: 0x8a}, - {value: 0x0254, lo: 0x8b, hi: 0x8b}, - {value: 0x025a, lo: 0x8c, hi: 0x8c}, - {value: 0x027e, lo: 0x8d, hi: 0x8d}, - {value: 0x026f, lo: 0x8e, hi: 0x8e}, - {value: 0x026c, lo: 0x8f, hi: 0x8f}, - {value: 0x01f7, lo: 0x90, hi: 0xa0}, - {value: 0x020c, lo: 0xa1, hi: 0xa1}, - {value: 0x022a, lo: 0xa2, hi: 0xa8}, - {value: 0x0556, lo: 0xa9, hi: 0xa9}, - {value: 0x023f, lo: 0xaa, hi: 0xbf}, - // Block 0xa6, offset 0x36f - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x8f, hi: 0x8f}, - // Block 0xa7, offset 0x371 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xae, hi: 0xae}, - // Block 0xa8, offset 0x373 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xac, hi: 0xaf}, - // Block 0xa9, offset 0x375 - {value: 0x0000, lo: 0x03}, - {value: 0x8134, lo: 0xac, hi: 0xad}, - {value: 0x812e, lo: 0xae, hi: 0xae}, - {value: 0x8133, lo: 0xaf, hi: 0xaf}, - // Block 0xaa, offset 0x379 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x90, hi: 0x96}, - // Block 0xab, offset 0x37b - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x84, hi: 0x89}, - {value: 0x8103, lo: 0x8a, hi: 0x8a}, - // Block 0xac, offset 0x37e - {value: 0x0002, lo: 0x0a}, - {value: 0x0063, lo: 0x80, hi: 0x89}, - {value: 0x1a7e, lo: 0x8a, hi: 0x8a}, - {value: 0x1ab1, lo: 0x8b, hi: 0x8b}, - {value: 0x1acc, lo: 0x8c, hi: 0x8c}, - {value: 0x1ad2, lo: 0x8d, hi: 0x8d}, - {value: 0x1cf0, lo: 0x8e, hi: 0x8e}, - {value: 0x1ade, lo: 0x8f, hi: 0x8f}, - {value: 0x1aa8, lo: 0xaa, hi: 0xaa}, - {value: 0x1aab, lo: 0xab, hi: 0xab}, - {value: 0x1aae, lo: 0xac, hi: 0xac}, - // Block 0xad, offset 0x389 - {value: 0x0000, lo: 0x01}, - {value: 0x1a6c, lo: 0x90, hi: 0x90}, - // Block 0xae, offset 0x38b - {value: 0x0028, lo: 0x09}, - {value: 0x2999, lo: 0x80, hi: 0x80}, - {value: 0x295d, lo: 0x81, hi: 0x81}, - {value: 0x2967, lo: 0x82, hi: 0x82}, - {value: 0x297b, lo: 0x83, hi: 0x84}, - {value: 0x2985, lo: 0x85, hi: 0x86}, - {value: 0x2971, lo: 0x87, hi: 0x87}, - {value: 0x298f, lo: 0x88, hi: 0x88}, - {value: 0x0c6a, lo: 0x90, hi: 0x90}, - {value: 0x09e2, lo: 0x91, hi: 0x91}, - // Block 0xaf, offset 0x395 - {value: 0x0002, lo: 0x01}, - {value: 0x0021, lo: 0xb0, hi: 0xb9}, -} - -// recompMap: 7528 bytes (entries only) -var recompMap map[uint32]rune -var recompMapOnce sync.Once - -const recompMapPacked = "" + - "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 - "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 - "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 - "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 - "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 - "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 - "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 - "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 - "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 - "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA - "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB - "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC - "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD - "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE - "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF - "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 - "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 - "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 - "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 - "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 - "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 - "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 - "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA - "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB - "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC - "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD - "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 - "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 - "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 - "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 - "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 - "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 - "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 - "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 - "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 - "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA - "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB - "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC - "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED - "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE - "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF - "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 - "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 - "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 - "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 - "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 - "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 - "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 - "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA - "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB - "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC - "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD - "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF - "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 - "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 - "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 - "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 - "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 - "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 - "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 - "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 - "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 - "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 - "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A - "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B - "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C - "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D - "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E - "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F - "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 - "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 - "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 - "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 - "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 - "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 - "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 - "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 - "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A - "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B - "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C - "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D - "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E - "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F - "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 - "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 - "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 - "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 - "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 - "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 - "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 - "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 - "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A - "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B - "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C - "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D - "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E - "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F - "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 - "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 - "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 - "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 - "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 - "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 - "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A - "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B - "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C - "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D - "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E - "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 - "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 - "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 - "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 - "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 - "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 - "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C - "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D - "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E - "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F - "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 - "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 - "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 - "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 - "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 - "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 - "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 - "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 - "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A - "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B - "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C - "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D - "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E - "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F - "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 - "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 - "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 - "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 - "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 - "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 - "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 - "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 - "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A - "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B - "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C - "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D - "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E - "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F - "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 - "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 - "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 - "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 - "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 - "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 - "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 - "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 - "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 - "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 - "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A - "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B - "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C - "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D - "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E - "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 - "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 - "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF - "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 - "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD - "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE - "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF - "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 - "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 - "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 - "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 - "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 - "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 - "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 - "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 - "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 - "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 - "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA - "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB - "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC - "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE - "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF - "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 - "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 - "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 - "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 - "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 - "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 - "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 - "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 - "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA - "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB - "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC - "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED - "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE - "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF - "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 - "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 - "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 - "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 - "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 - "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA - "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB - "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC - "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD - "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE - "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF - "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 - "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 - "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 - "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 - "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 - "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 - "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 - "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 - "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 - "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 - "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A - "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B - "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C - "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D - "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E - "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F - "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 - "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 - "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 - "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 - "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 - "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 - "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 - "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 - "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 - "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 - "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A - "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B - "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E - "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F - "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 - "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 - "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 - "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 - "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A - "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B - "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C - "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D - "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E - "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F - "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 - "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 - "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 - "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 - "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 - "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 - "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 - "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 - "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A - "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C - "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E - "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F - "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 - "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA - "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB - "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC - "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD - "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE - "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF - "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 - "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA - "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB - "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC - "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD - "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE - "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 - "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 - "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 - "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 - "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 - "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 - "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C - "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D - "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E - "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 - "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 - "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 - "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 - "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 - "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 - "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C - "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D - "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E - "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 - "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 - "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 - "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 - "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 - "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 - "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 - "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 - "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 - "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 - "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA - "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB - "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC - "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD - "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE - "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF - "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 - "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 - "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 - "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 - "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 - "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 - "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA - "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB - "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC - "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED - "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE - "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF - "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 - "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 - "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 - "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 - "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 - "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 - "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 - "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 - "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 - "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 - "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 - "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 - "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 - "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 - "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 - "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 - "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 - "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 - "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 - "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB - "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC - "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 - "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B - "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C - "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 - "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA - "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB - "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC - "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 - "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 - "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 - "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 - "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA - "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB - "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A - "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B - "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C - "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA - "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC - "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD - "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE - "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 - "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 - "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 - "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A - "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C - "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E - "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 - "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B - "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D - "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 - "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 - "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 - "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 - "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 - "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 - "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 - "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 - "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 - "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 - "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 - "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 - "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 - "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A - "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B - "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C - "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D - "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E - "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F - "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 - "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 - "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 - "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 - "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 - "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 - "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 - "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 - "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 - "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 - "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A - "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B - "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C - "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D - "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E - "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F - "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 - "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 - "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 - "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 - "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 - "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 - "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 - "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 - "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 - "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 - "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A - "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B - "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C - "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D - "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E - "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F - "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 - "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 - "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 - "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 - "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 - "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 - "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 - "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 - "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 - "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 - "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A - "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B - "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C - "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D - "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E - "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F - "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 - "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 - "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 - "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 - "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 - "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 - "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 - "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 - "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 - "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 - "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A - "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B - "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C - "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D - "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E - "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F - "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 - "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 - "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 - "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 - "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 - "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 - "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 - "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 - "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 - "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 - "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A - "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B - "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C - "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D - "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E - "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F - "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 - "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 - "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 - "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 - "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 - "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 - "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 - "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 - "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 - "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 - "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A - "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B - "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C - "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D - "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E - "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F - "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 - "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 - "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 - "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 - "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 - "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 - "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 - "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 - "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 - "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 - "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A - "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B - "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C - "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D - "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E - "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F - "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 - "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 - "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 - "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 - "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 - "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 - "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 - "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 - "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 - "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 - "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A - "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B - "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C - "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D - "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E - "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F - "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 - "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 - "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 - "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 - "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 - "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 - "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 - "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 - "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 - "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 - "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B - "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 - "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 - "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 - "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 - "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 - "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 - "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 - "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 - "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 - "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 - "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA - "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB - "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC - "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD - "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE - "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF - "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 - "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 - "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 - "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 - "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 - "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 - "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 - "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 - "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 - "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 - "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA - "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB - "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC - "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD - "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE - "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF - "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 - "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 - "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 - "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 - "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 - "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 - "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 - "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 - "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 - "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 - "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA - "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB - "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC - "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD - "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE - "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF - "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 - "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 - "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 - "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 - "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 - "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 - "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 - "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 - "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 - "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 - "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA - "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB - "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC - "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD - "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE - "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF - "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 - "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 - "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 - "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 - "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 - "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 - "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 - "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 - "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 - "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 - "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA - "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB - "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC - "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED - "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE - "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF - "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 - "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 - "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 - "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 - "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 - "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 - "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 - "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 - "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 - "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 - "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 - "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 - "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 - "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 - "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 - "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 - "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 - "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 - "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 - "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 - "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A - "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B - "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C - "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D - "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E - "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F - "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 - "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 - "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 - "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 - "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 - "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 - "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 - "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 - "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A - "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B - "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C - "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D - "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 - "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 - "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 - "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 - "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 - "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 - "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 - "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 - "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 - "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 - "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A - "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B - "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C - "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D - "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E - "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F - "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 - "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 - "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 - "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 - "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 - "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 - "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 - "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 - "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 - "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 - "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A - "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B - "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C - "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D - "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E - "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F - "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 - "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 - "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 - "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 - "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 - "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 - "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 - "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 - "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A - "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B - "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C - "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D - "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 - "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 - "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 - "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 - "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 - "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 - "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 - "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 - "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 - "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B - "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D - "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F - "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 - "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 - "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 - "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 - "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 - "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 - "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 - "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 - "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 - "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 - "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A - "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B - "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C - "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D - "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E - "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F - "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 - "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 - "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 - "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 - "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 - "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A - "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C - "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 - "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 - "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 - "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 - "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 - "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 - "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 - "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 - "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 - "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 - "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A - "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B - "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C - "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D - "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E - "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F - "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 - "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 - "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 - "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 - "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 - "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 - "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 - "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 - "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 - "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 - "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A - "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B - "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C - "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D - "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E - "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F - "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 - "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 - "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 - "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 - "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 - "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 - "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 - "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 - "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 - "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 - "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA - "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB - "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC - "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD - "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE - "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF - "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 - "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 - "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 - "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 - "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 - "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 - "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 - "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 - "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 - "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA - "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC - "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 - "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 - "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 - "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 - "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 - "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 - "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 - "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA - "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC - "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD - "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE - "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF - "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 - "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 - "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 - "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 - "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 - "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 - "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 - "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA - "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD - "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE - "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF - "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 - "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 - "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 - "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 - "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 - "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 - "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 - "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 - "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 - "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA - "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC - "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED - "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 - "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 - "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 - "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 - "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 - "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 - "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA - "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC - "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A - "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B - "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE - "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD - "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE - "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF - "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 - "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 - "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C - "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 - "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 - "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 - "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 - "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 - "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 - "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 - "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 - "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D - "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E - "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F - "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 - "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 - "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 - "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 - "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 - "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 - "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 - "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 - "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 - "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 - "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 - "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 - "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC - "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD - "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE - "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF - "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 - "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 - "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 - "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 - "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA - "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB - "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC - "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED - "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C - "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E - "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 - "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 - "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 - "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 - "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 - "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A - "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C - "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E - "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 - "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 - "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 - "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 - "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 - "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 - "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 - "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 - "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 - "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 - "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 - "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 - "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A - "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C - "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D - "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 - "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E - "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC - "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE - "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 - "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 - "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 - "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 - "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 - "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA - "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC - "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE - "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 - "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 - "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 - "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 - "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 - "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 - "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 - "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 - "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 - "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 - "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 - "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 - "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA - "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC - "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD - "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 - "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 - "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 - "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 - "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA - "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE - "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A - "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C - "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB - "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E - "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F - "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B - "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C - "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB - "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC - "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE - "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA - "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB - "\x195\x190\x00\x01\x198" + // 0x19351930: 0x00011938 - "" - // Total size of tables: 56KB (57068 bytes) diff --git a/embed/vendor/golang.org/x/text/unicode/norm/tables17.0.0.go b/embed/vendor/golang.org/x/text/unicode/norm/tables17.0.0.go deleted file mode 100644 index dfd555fc..00000000 --- a/embed/vendor/golang.org/x/text/unicode/norm/tables17.0.0.go +++ /dev/null @@ -1,8104 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -//go:build go1.27 - -package norm - -import "sync" - -const ( - // Version is the Unicode edition from which the tables are derived. - Version = "17.0.0" - - // MaxTransformChunkSize indicates the maximum number of bytes that Transform - // may need to write atomically for any Form. Making a destination buffer at - // least this size ensures that Transform can always make progress and that - // the user does not need to grow the buffer on an ErrShortDst. - MaxTransformChunkSize = 35 + maxNonStarters*4 -) - -var ccc = [56]uint8{ - 0, 1, 6, 7, 8, 9, 10, 11, - 12, 13, 14, 15, 16, 17, 18, 19, - 20, 21, 22, 23, 24, 25, 26, 27, - 28, 29, 30, 31, 32, 33, 34, 35, - 36, 84, 91, 103, 107, 118, 122, 129, - 130, 132, 202, 214, 216, 218, 220, 222, - 224, 226, 228, 230, 232, 233, 234, 240, -} - -const ( - firstMulti = 0x199A - firstCCC = 0x2DD5 - endMulti = 0x2EBF - firstLeadingCCC = 0x4B3F - firstCCCZeroExcept = 0x4C99 - firstStarterWithNLead = 0x4CC0 - lastDecomp = 0x4CC2 - maxDecomp = 0x8000 -) - -// decomps: 19650 bytes -var decomps = [...]byte{ - // Bytes 0 - 3f - 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, - 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41, - 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41, - 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41, - 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41, - 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41, - 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41, - 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41, - // Bytes 40 - 7f - 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41, - 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41, - 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41, - 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41, - 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41, - 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41, - 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41, - 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41, - // Bytes 80 - bf - 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41, - 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41, - 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41, - 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41, - 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41, - 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41, - 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41, - 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42, - // Bytes c0 - ff - 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5, - 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2, - 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xA6, 0x42, - 0xC3, 0xB0, 0x42, 0xC3, 0xB8, 0x42, 0xC4, 0xA6, - 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, 0x42, 0xC5, - 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, 0x8E, 0x42, - 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, 0xC7, 0x80, - 0x42, 0xC7, 0x81, 0x42, 0xC7, 0x82, 0x42, 0xC8, - // Bytes 100 - 13f - 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, 0x42, - 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, 0x93, - 0x42, 0xC9, 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, - 0x96, 0x42, 0xC9, 0x97, 0x42, 0xC9, 0x98, 0x42, - 0xC9, 0x99, 0x42, 0xC9, 0x9B, 0x42, 0xC9, 0x9C, - 0x42, 0xC9, 0x9E, 0x42, 0xC9, 0x9F, 0x42, 0xC9, - 0xA0, 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA2, 0x42, - 0xC9, 0xA3, 0x42, 0xC9, 0xA4, 0x42, 0xC9, 0xA5, - // Bytes 140 - 17f - 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA7, 0x42, 0xC9, - 0xA8, 0x42, 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, - 0xC9, 0xAB, 0x42, 0xC9, 0xAC, 0x42, 0xC9, 0xAD, - 0x42, 0xC9, 0xAE, 0x42, 0xC9, 0xAF, 0x42, 0xC9, - 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42, - 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5, - 0x42, 0xC9, 0xB6, 0x42, 0xC9, 0xB7, 0x42, 0xC9, - 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, 0xBA, 0x42, - // Bytes 180 - 1bf - 0xC9, 0xBB, 0x42, 0xC9, 0xBD, 0x42, 0xC9, 0xBE, - 0x42, 0xCA, 0x80, 0x42, 0xCA, 0x81, 0x42, 0xCA, - 0x82, 0x42, 0xCA, 0x83, 0x42, 0xCA, 0x84, 0x42, - 0xCA, 0x88, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A, - 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA, - 0x8D, 0x42, 0xCA, 0x8E, 0x42, 0xCA, 0x8F, 0x42, - 0xCA, 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, - 0x42, 0xCA, 0x95, 0x42, 0xCA, 0x98, 0x42, 0xCA, - // Bytes 1c0 - 1ff - 0x99, 0x42, 0xCA, 0x9B, 0x42, 0xCA, 0x9C, 0x42, - 0xCA, 0x9D, 0x42, 0xCA, 0x9F, 0x42, 0xCA, 0xA1, - 0x42, 0xCA, 0xA2, 0x42, 0xCA, 0xA3, 0x42, 0xCA, - 0xA4, 0x42, 0xCA, 0xA5, 0x42, 0xCA, 0xA6, 0x42, - 0xCA, 0xA7, 0x42, 0xCA, 0xA8, 0x42, 0xCA, 0xA9, - 0x42, 0xCA, 0xAA, 0x42, 0xCA, 0xAB, 0x42, 0xCA, - 0xB9, 0x42, 0xCB, 0x90, 0x42, 0xCB, 0x91, 0x42, - 0xCE, 0x91, 0x42, 0xCE, 0x92, 0x42, 0xCE, 0x93, - // Bytes 200 - 23f - 0x42, 0xCE, 0x94, 0x42, 0xCE, 0x95, 0x42, 0xCE, - 0x96, 0x42, 0xCE, 0x97, 0x42, 0xCE, 0x98, 0x42, - 0xCE, 0x99, 0x42, 0xCE, 0x9A, 0x42, 0xCE, 0x9B, - 0x42, 0xCE, 0x9C, 0x42, 0xCE, 0x9D, 0x42, 0xCE, - 0x9E, 0x42, 0xCE, 0x9F, 0x42, 0xCE, 0xA0, 0x42, - 0xCE, 0xA1, 0x42, 0xCE, 0xA3, 0x42, 0xCE, 0xA4, - 0x42, 0xCE, 0xA5, 0x42, 0xCE, 0xA6, 0x42, 0xCE, - 0xA7, 0x42, 0xCE, 0xA8, 0x42, 0xCE, 0xA9, 0x42, - // Bytes 240 - 27f - 0xCE, 0xB1, 0x42, 0xCE, 0xB2, 0x42, 0xCE, 0xB3, - 0x42, 0xCE, 0xB4, 0x42, 0xCE, 0xB5, 0x42, 0xCE, - 0xB6, 0x42, 0xCE, 0xB7, 0x42, 0xCE, 0xB8, 0x42, - 0xCE, 0xB9, 0x42, 0xCE, 0xBA, 0x42, 0xCE, 0xBB, - 0x42, 0xCE, 0xBC, 0x42, 0xCE, 0xBD, 0x42, 0xCE, - 0xBE, 0x42, 0xCE, 0xBF, 0x42, 0xCF, 0x80, 0x42, - 0xCF, 0x81, 0x42, 0xCF, 0x82, 0x42, 0xCF, 0x83, - 0x42, 0xCF, 0x84, 0x42, 0xCF, 0x85, 0x42, 0xCF, - // Bytes 280 - 2bf - 0x86, 0x42, 0xCF, 0x87, 0x42, 0xCF, 0x88, 0x42, - 0xCF, 0x89, 0x42, 0xCF, 0x9C, 0x42, 0xCF, 0x9D, - 0x42, 0xD0, 0xB0, 0x42, 0xD0, 0xB1, 0x42, 0xD0, - 0xB2, 0x42, 0xD0, 0xB3, 0x42, 0xD0, 0xB4, 0x42, - 0xD0, 0xB5, 0x42, 0xD0, 0xB6, 0x42, 0xD0, 0xB7, - 0x42, 0xD0, 0xB8, 0x42, 0xD0, 0xBA, 0x42, 0xD0, - 0xBB, 0x42, 0xD0, 0xBC, 0x42, 0xD0, 0xBD, 0x42, - 0xD0, 0xBE, 0x42, 0xD0, 0xBF, 0x42, 0xD1, 0x80, - // Bytes 2c0 - 2ff - 0x42, 0xD1, 0x81, 0x42, 0xD1, 0x82, 0x42, 0xD1, - 0x83, 0x42, 0xD1, 0x84, 0x42, 0xD1, 0x85, 0x42, - 0xD1, 0x86, 0x42, 0xD1, 0x87, 0x42, 0xD1, 0x88, - 0x42, 0xD1, 0x8A, 0x42, 0xD1, 0x8B, 0x42, 0xD1, - 0x8C, 0x42, 0xD1, 0x8D, 0x42, 0xD1, 0x8E, 0x42, - 0xD1, 0x95, 0x42, 0xD1, 0x96, 0x42, 0xD1, 0x98, - 0x42, 0xD1, 0x9F, 0x42, 0xD2, 0x91, 0x42, 0xD2, - 0xAB, 0x42, 0xD2, 0xAF, 0x42, 0xD2, 0xB1, 0x42, - // Bytes 300 - 33f - 0xD3, 0x8F, 0x42, 0xD3, 0x99, 0x42, 0xD3, 0xA9, - 0x42, 0xD7, 0x90, 0x42, 0xD7, 0x91, 0x42, 0xD7, - 0x92, 0x42, 0xD7, 0x93, 0x42, 0xD7, 0x94, 0x42, - 0xD7, 0x9B, 0x42, 0xD7, 0x9C, 0x42, 0xD7, 0x9D, - 0x42, 0xD7, 0xA2, 0x42, 0xD7, 0xA8, 0x42, 0xD7, - 0xAA, 0x42, 0xD8, 0xA1, 0x42, 0xD8, 0xA7, 0x42, - 0xD8, 0xA8, 0x42, 0xD8, 0xA9, 0x42, 0xD8, 0xAA, - 0x42, 0xD8, 0xAB, 0x42, 0xD8, 0xAC, 0x42, 0xD8, - // Bytes 340 - 37f - 0xAD, 0x42, 0xD8, 0xAE, 0x42, 0xD8, 0xAF, 0x42, - 0xD8, 0xB0, 0x42, 0xD8, 0xB1, 0x42, 0xD8, 0xB2, - 0x42, 0xD8, 0xB3, 0x42, 0xD8, 0xB4, 0x42, 0xD8, - 0xB5, 0x42, 0xD8, 0xB6, 0x42, 0xD8, 0xB7, 0x42, - 0xD8, 0xB8, 0x42, 0xD8, 0xB9, 0x42, 0xD8, 0xBA, - 0x42, 0xD9, 0x81, 0x42, 0xD9, 0x82, 0x42, 0xD9, - 0x83, 0x42, 0xD9, 0x84, 0x42, 0xD9, 0x85, 0x42, - 0xD9, 0x86, 0x42, 0xD9, 0x87, 0x42, 0xD9, 0x88, - // Bytes 380 - 3bf - 0x42, 0xD9, 0x89, 0x42, 0xD9, 0x8A, 0x42, 0xD9, - 0xAE, 0x42, 0xD9, 0xAF, 0x42, 0xD9, 0xB1, 0x42, - 0xD9, 0xB9, 0x42, 0xD9, 0xBA, 0x42, 0xD9, 0xBB, - 0x42, 0xD9, 0xBE, 0x42, 0xD9, 0xBF, 0x42, 0xDA, - 0x80, 0x42, 0xDA, 0x83, 0x42, 0xDA, 0x84, 0x42, - 0xDA, 0x86, 0x42, 0xDA, 0x87, 0x42, 0xDA, 0x88, - 0x42, 0xDA, 0x8C, 0x42, 0xDA, 0x8D, 0x42, 0xDA, - 0x8E, 0x42, 0xDA, 0x91, 0x42, 0xDA, 0x98, 0x42, - // Bytes 3c0 - 3ff - 0xDA, 0xA1, 0x42, 0xDA, 0xA4, 0x42, 0xDA, 0xA6, - 0x42, 0xDA, 0xA9, 0x42, 0xDA, 0xAD, 0x42, 0xDA, - 0xAF, 0x42, 0xDA, 0xB1, 0x42, 0xDA, 0xB3, 0x42, - 0xDA, 0xBA, 0x42, 0xDA, 0xBB, 0x42, 0xDA, 0xBE, - 0x42, 0xDB, 0x81, 0x42, 0xDB, 0x85, 0x42, 0xDB, - 0x86, 0x42, 0xDB, 0x87, 0x42, 0xDB, 0x88, 0x42, - 0xDB, 0x89, 0x42, 0xDB, 0x8B, 0x42, 0xDB, 0x8C, - 0x42, 0xDB, 0x90, 0x42, 0xDB, 0x92, 0x43, 0xE0, - // Bytes 400 - 43f - 0xBC, 0x8B, 0x43, 0xE1, 0x83, 0x9C, 0x43, 0xE1, - 0x84, 0x80, 0x43, 0xE1, 0x84, 0x81, 0x43, 0xE1, - 0x84, 0x82, 0x43, 0xE1, 0x84, 0x83, 0x43, 0xE1, - 0x84, 0x84, 0x43, 0xE1, 0x84, 0x85, 0x43, 0xE1, - 0x84, 0x86, 0x43, 0xE1, 0x84, 0x87, 0x43, 0xE1, - 0x84, 0x88, 0x43, 0xE1, 0x84, 0x89, 0x43, 0xE1, - 0x84, 0x8A, 0x43, 0xE1, 0x84, 0x8B, 0x43, 0xE1, - 0x84, 0x8C, 0x43, 0xE1, 0x84, 0x8D, 0x43, 0xE1, - // Bytes 440 - 47f - 0x84, 0x8E, 0x43, 0xE1, 0x84, 0x8F, 0x43, 0xE1, - 0x84, 0x90, 0x43, 0xE1, 0x84, 0x91, 0x43, 0xE1, - 0x84, 0x92, 0x43, 0xE1, 0x84, 0x94, 0x43, 0xE1, - 0x84, 0x95, 0x43, 0xE1, 0x84, 0x9A, 0x43, 0xE1, - 0x84, 0x9C, 0x43, 0xE1, 0x84, 0x9D, 0x43, 0xE1, - 0x84, 0x9E, 0x43, 0xE1, 0x84, 0xA0, 0x43, 0xE1, - 0x84, 0xA1, 0x43, 0xE1, 0x84, 0xA2, 0x43, 0xE1, - 0x84, 0xA3, 0x43, 0xE1, 0x84, 0xA7, 0x43, 0xE1, - // Bytes 480 - 4bf - 0x84, 0xA9, 0x43, 0xE1, 0x84, 0xAB, 0x43, 0xE1, - 0x84, 0xAC, 0x43, 0xE1, 0x84, 0xAD, 0x43, 0xE1, - 0x84, 0xAE, 0x43, 0xE1, 0x84, 0xAF, 0x43, 0xE1, - 0x84, 0xB2, 0x43, 0xE1, 0x84, 0xB6, 0x43, 0xE1, - 0x85, 0x80, 0x43, 0xE1, 0x85, 0x87, 0x43, 0xE1, - 0x85, 0x8C, 0x43, 0xE1, 0x85, 0x97, 0x43, 0xE1, - 0x85, 0x98, 0x43, 0xE1, 0x85, 0x99, 0x43, 0xE1, - 0x85, 0xA0, 0x43, 0xE1, 0x86, 0x84, 0x43, 0xE1, - // Bytes 4c0 - 4ff - 0x86, 0x85, 0x43, 0xE1, 0x86, 0x88, 0x43, 0xE1, - 0x86, 0x91, 0x43, 0xE1, 0x86, 0x92, 0x43, 0xE1, - 0x86, 0x94, 0x43, 0xE1, 0x86, 0x9E, 0x43, 0xE1, - 0x86, 0xA1, 0x43, 0xE1, 0x87, 0x87, 0x43, 0xE1, - 0x87, 0x88, 0x43, 0xE1, 0x87, 0x8C, 0x43, 0xE1, - 0x87, 0x8E, 0x43, 0xE1, 0x87, 0x93, 0x43, 0xE1, - 0x87, 0x97, 0x43, 0xE1, 0x87, 0x99, 0x43, 0xE1, - 0x87, 0x9D, 0x43, 0xE1, 0x87, 0x9F, 0x43, 0xE1, - // Bytes 500 - 53f - 0x87, 0xB1, 0x43, 0xE1, 0x87, 0xB2, 0x43, 0xE1, - 0xB4, 0x82, 0x43, 0xE1, 0xB4, 0x96, 0x43, 0xE1, - 0xB4, 0x97, 0x43, 0xE1, 0xB4, 0x9C, 0x43, 0xE1, - 0xB4, 0x9D, 0x43, 0xE1, 0xB4, 0xA5, 0x43, 0xE1, - 0xB5, 0xBB, 0x43, 0xE1, 0xB6, 0x85, 0x43, 0xE1, - 0xB6, 0x91, 0x43, 0xE2, 0x80, 0x82, 0x43, 0xE2, - 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, 0xE2, - 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, 0xE2, - // Bytes 540 - 57f - 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, 0xE2, - 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, 0xE2, - 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, 0xE2, - 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, 0xE2, - 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, 0xE2, - 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, 0xE2, - 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, 0xE2, - 0xB1, 0xB1, 0x43, 0xE2, 0xB5, 0xA1, 0x43, 0xE3, - // Bytes 580 - 5bf - 0x80, 0x81, 0x43, 0xE3, 0x80, 0x82, 0x43, 0xE3, - 0x80, 0x88, 0x43, 0xE3, 0x80, 0x89, 0x43, 0xE3, - 0x80, 0x8A, 0x43, 0xE3, 0x80, 0x8B, 0x43, 0xE3, - 0x80, 0x8C, 0x43, 0xE3, 0x80, 0x8D, 0x43, 0xE3, - 0x80, 0x8E, 0x43, 0xE3, 0x80, 0x8F, 0x43, 0xE3, - 0x80, 0x90, 0x43, 0xE3, 0x80, 0x91, 0x43, 0xE3, - 0x80, 0x92, 0x43, 0xE3, 0x80, 0x94, 0x43, 0xE3, - 0x80, 0x95, 0x43, 0xE3, 0x80, 0x96, 0x43, 0xE3, - // Bytes 5c0 - 5ff - 0x80, 0x97, 0x43, 0xE3, 0x82, 0xA1, 0x43, 0xE3, - 0x82, 0xA2, 0x43, 0xE3, 0x82, 0xA3, 0x43, 0xE3, - 0x82, 0xA4, 0x43, 0xE3, 0x82, 0xA5, 0x43, 0xE3, - 0x82, 0xA6, 0x43, 0xE3, 0x82, 0xA7, 0x43, 0xE3, - 0x82, 0xA8, 0x43, 0xE3, 0x82, 0xA9, 0x43, 0xE3, - 0x82, 0xAA, 0x43, 0xE3, 0x82, 0xAB, 0x43, 0xE3, - 0x82, 0xAD, 0x43, 0xE3, 0x82, 0xAF, 0x43, 0xE3, - 0x82, 0xB1, 0x43, 0xE3, 0x82, 0xB3, 0x43, 0xE3, - // Bytes 600 - 63f - 0x82, 0xB5, 0x43, 0xE3, 0x82, 0xB7, 0x43, 0xE3, - 0x82, 0xB9, 0x43, 0xE3, 0x82, 0xBB, 0x43, 0xE3, - 0x82, 0xBD, 0x43, 0xE3, 0x82, 0xBF, 0x43, 0xE3, - 0x83, 0x81, 0x43, 0xE3, 0x83, 0x83, 0x43, 0xE3, - 0x83, 0x84, 0x43, 0xE3, 0x83, 0x86, 0x43, 0xE3, - 0x83, 0x88, 0x43, 0xE3, 0x83, 0x8A, 0x43, 0xE3, - 0x83, 0x8B, 0x43, 0xE3, 0x83, 0x8C, 0x43, 0xE3, - 0x83, 0x8D, 0x43, 0xE3, 0x83, 0x8E, 0x43, 0xE3, - // Bytes 640 - 67f - 0x83, 0x8F, 0x43, 0xE3, 0x83, 0x92, 0x43, 0xE3, - 0x83, 0x95, 0x43, 0xE3, 0x83, 0x98, 0x43, 0xE3, - 0x83, 0x9B, 0x43, 0xE3, 0x83, 0x9E, 0x43, 0xE3, - 0x83, 0x9F, 0x43, 0xE3, 0x83, 0xA0, 0x43, 0xE3, - 0x83, 0xA1, 0x43, 0xE3, 0x83, 0xA2, 0x43, 0xE3, - 0x83, 0xA3, 0x43, 0xE3, 0x83, 0xA4, 0x43, 0xE3, - 0x83, 0xA5, 0x43, 0xE3, 0x83, 0xA6, 0x43, 0xE3, - 0x83, 0xA7, 0x43, 0xE3, 0x83, 0xA8, 0x43, 0xE3, - // Bytes 680 - 6bf - 0x83, 0xA9, 0x43, 0xE3, 0x83, 0xAA, 0x43, 0xE3, - 0x83, 0xAB, 0x43, 0xE3, 0x83, 0xAC, 0x43, 0xE3, - 0x83, 0xAD, 0x43, 0xE3, 0x83, 0xAF, 0x43, 0xE3, - 0x83, 0xB0, 0x43, 0xE3, 0x83, 0xB1, 0x43, 0xE3, - 0x83, 0xB2, 0x43, 0xE3, 0x83, 0xB3, 0x43, 0xE3, - 0x83, 0xBB, 0x43, 0xE3, 0x83, 0xBC, 0x43, 0xE3, - 0x92, 0x9E, 0x43, 0xE3, 0x92, 0xB9, 0x43, 0xE3, - 0x92, 0xBB, 0x43, 0xE3, 0x93, 0x9F, 0x43, 0xE3, - // Bytes 6c0 - 6ff - 0x94, 0x95, 0x43, 0xE3, 0x9B, 0xAE, 0x43, 0xE3, - 0x9B, 0xBC, 0x43, 0xE3, 0x9E, 0x81, 0x43, 0xE3, - 0xA0, 0xAF, 0x43, 0xE3, 0xA1, 0xA2, 0x43, 0xE3, - 0xA1, 0xBC, 0x43, 0xE3, 0xA3, 0x87, 0x43, 0xE3, - 0xA3, 0xA3, 0x43, 0xE3, 0xA4, 0x9C, 0x43, 0xE3, - 0xA4, 0xBA, 0x43, 0xE3, 0xA8, 0xAE, 0x43, 0xE3, - 0xA9, 0xAC, 0x43, 0xE3, 0xAB, 0xA4, 0x43, 0xE3, - 0xAC, 0x88, 0x43, 0xE3, 0xAC, 0x99, 0x43, 0xE3, - // Bytes 700 - 73f - 0xAD, 0x89, 0x43, 0xE3, 0xAE, 0x9D, 0x43, 0xE3, - 0xB0, 0x98, 0x43, 0xE3, 0xB1, 0x8E, 0x43, 0xE3, - 0xB4, 0xB3, 0x43, 0xE3, 0xB6, 0x96, 0x43, 0xE3, - 0xBA, 0xAC, 0x43, 0xE3, 0xBA, 0xB8, 0x43, 0xE3, - 0xBC, 0x9B, 0x43, 0xE3, 0xBF, 0xBC, 0x43, 0xE4, - 0x80, 0x88, 0x43, 0xE4, 0x80, 0x98, 0x43, 0xE4, - 0x80, 0xB9, 0x43, 0xE4, 0x81, 0x86, 0x43, 0xE4, - 0x82, 0x96, 0x43, 0xE4, 0x83, 0xA3, 0x43, 0xE4, - // Bytes 740 - 77f - 0x84, 0xAF, 0x43, 0xE4, 0x88, 0x82, 0x43, 0xE4, - 0x88, 0xA7, 0x43, 0xE4, 0x8A, 0xA0, 0x43, 0xE4, - 0x8C, 0x81, 0x43, 0xE4, 0x8C, 0xB4, 0x43, 0xE4, - 0x8D, 0x99, 0x43, 0xE4, 0x8F, 0x95, 0x43, 0xE4, - 0x8F, 0x99, 0x43, 0xE4, 0x90, 0x8B, 0x43, 0xE4, - 0x91, 0xAB, 0x43, 0xE4, 0x94, 0xAB, 0x43, 0xE4, - 0x95, 0x9D, 0x43, 0xE4, 0x95, 0xA1, 0x43, 0xE4, - 0x95, 0xAB, 0x43, 0xE4, 0x97, 0x97, 0x43, 0xE4, - // Bytes 780 - 7bf - 0x97, 0xB9, 0x43, 0xE4, 0x98, 0xB5, 0x43, 0xE4, - 0x9A, 0xBE, 0x43, 0xE4, 0x9B, 0x87, 0x43, 0xE4, - 0xA6, 0x95, 0x43, 0xE4, 0xA7, 0xA6, 0x43, 0xE4, - 0xA9, 0xAE, 0x43, 0xE4, 0xA9, 0xB6, 0x43, 0xE4, - 0xAA, 0xB2, 0x43, 0xE4, 0xAC, 0xB3, 0x43, 0xE4, - 0xAF, 0x8E, 0x43, 0xE4, 0xB3, 0x8E, 0x43, 0xE4, - 0xB3, 0xAD, 0x43, 0xE4, 0xB3, 0xB8, 0x43, 0xE4, - 0xB5, 0x96, 0x43, 0xE4, 0xB8, 0x80, 0x43, 0xE4, - // Bytes 7c0 - 7ff - 0xB8, 0x81, 0x43, 0xE4, 0xB8, 0x83, 0x43, 0xE4, - 0xB8, 0x89, 0x43, 0xE4, 0xB8, 0x8A, 0x43, 0xE4, - 0xB8, 0x8B, 0x43, 0xE4, 0xB8, 0x8D, 0x43, 0xE4, - 0xB8, 0x99, 0x43, 0xE4, 0xB8, 0xA6, 0x43, 0xE4, - 0xB8, 0xA8, 0x43, 0xE4, 0xB8, 0xAD, 0x43, 0xE4, - 0xB8, 0xB2, 0x43, 0xE4, 0xB8, 0xB6, 0x43, 0xE4, - 0xB8, 0xB8, 0x43, 0xE4, 0xB8, 0xB9, 0x43, 0xE4, - 0xB8, 0xBD, 0x43, 0xE4, 0xB8, 0xBF, 0x43, 0xE4, - // Bytes 800 - 83f - 0xB9, 0x81, 0x43, 0xE4, 0xB9, 0x99, 0x43, 0xE4, - 0xB9, 0x9D, 0x43, 0xE4, 0xBA, 0x82, 0x43, 0xE4, - 0xBA, 0x85, 0x43, 0xE4, 0xBA, 0x86, 0x43, 0xE4, - 0xBA, 0x8C, 0x43, 0xE4, 0xBA, 0x94, 0x43, 0xE4, - 0xBA, 0xA0, 0x43, 0xE4, 0xBA, 0xA4, 0x43, 0xE4, - 0xBA, 0xAE, 0x43, 0xE4, 0xBA, 0xBA, 0x43, 0xE4, - 0xBB, 0x80, 0x43, 0xE4, 0xBB, 0x8C, 0x43, 0xE4, - 0xBB, 0xA4, 0x43, 0xE4, 0xBC, 0x81, 0x43, 0xE4, - // Bytes 840 - 87f - 0xBC, 0x91, 0x43, 0xE4, 0xBD, 0xA0, 0x43, 0xE4, - 0xBE, 0x80, 0x43, 0xE4, 0xBE, 0x86, 0x43, 0xE4, - 0xBE, 0x8B, 0x43, 0xE4, 0xBE, 0xAE, 0x43, 0xE4, - 0xBE, 0xBB, 0x43, 0xE4, 0xBE, 0xBF, 0x43, 0xE5, - 0x80, 0x82, 0x43, 0xE5, 0x80, 0xAB, 0x43, 0xE5, - 0x81, 0xBA, 0x43, 0xE5, 0x82, 0x99, 0x43, 0xE5, - 0x83, 0x8F, 0x43, 0xE5, 0x83, 0x9A, 0x43, 0xE5, - 0x83, 0xA7, 0x43, 0xE5, 0x84, 0xAA, 0x43, 0xE5, - // Bytes 880 - 8bf - 0x84, 0xBF, 0x43, 0xE5, 0x85, 0x80, 0x43, 0xE5, - 0x85, 0x85, 0x43, 0xE5, 0x85, 0x8D, 0x43, 0xE5, - 0x85, 0x94, 0x43, 0xE5, 0x85, 0xA4, 0x43, 0xE5, - 0x85, 0xA5, 0x43, 0xE5, 0x85, 0xA7, 0x43, 0xE5, - 0x85, 0xA8, 0x43, 0xE5, 0x85, 0xA9, 0x43, 0xE5, - 0x85, 0xAB, 0x43, 0xE5, 0x85, 0xAD, 0x43, 0xE5, - 0x85, 0xB7, 0x43, 0xE5, 0x86, 0x80, 0x43, 0xE5, - 0x86, 0x82, 0x43, 0xE5, 0x86, 0x8D, 0x43, 0xE5, - // Bytes 8c0 - 8ff - 0x86, 0x92, 0x43, 0xE5, 0x86, 0x95, 0x43, 0xE5, - 0x86, 0x96, 0x43, 0xE5, 0x86, 0x97, 0x43, 0xE5, - 0x86, 0x99, 0x43, 0xE5, 0x86, 0xA4, 0x43, 0xE5, - 0x86, 0xAB, 0x43, 0xE5, 0x86, 0xAC, 0x43, 0xE5, - 0x86, 0xB5, 0x43, 0xE5, 0x86, 0xB7, 0x43, 0xE5, - 0x87, 0x89, 0x43, 0xE5, 0x87, 0x8C, 0x43, 0xE5, - 0x87, 0x9C, 0x43, 0xE5, 0x87, 0x9E, 0x43, 0xE5, - 0x87, 0xA0, 0x43, 0xE5, 0x87, 0xB5, 0x43, 0xE5, - // Bytes 900 - 93f - 0x88, 0x80, 0x43, 0xE5, 0x88, 0x83, 0x43, 0xE5, - 0x88, 0x87, 0x43, 0xE5, 0x88, 0x97, 0x43, 0xE5, - 0x88, 0x9D, 0x43, 0xE5, 0x88, 0xA9, 0x43, 0xE5, - 0x88, 0xBA, 0x43, 0xE5, 0x88, 0xBB, 0x43, 0xE5, - 0x89, 0x86, 0x43, 0xE5, 0x89, 0x8D, 0x43, 0xE5, - 0x89, 0xB2, 0x43, 0xE5, 0x89, 0xB7, 0x43, 0xE5, - 0x8A, 0x89, 0x43, 0xE5, 0x8A, 0x9B, 0x43, 0xE5, - 0x8A, 0xA3, 0x43, 0xE5, 0x8A, 0xB3, 0x43, 0xE5, - // Bytes 940 - 97f - 0x8A, 0xB4, 0x43, 0xE5, 0x8B, 0x87, 0x43, 0xE5, - 0x8B, 0x89, 0x43, 0xE5, 0x8B, 0x92, 0x43, 0xE5, - 0x8B, 0x9E, 0x43, 0xE5, 0x8B, 0xA4, 0x43, 0xE5, - 0x8B, 0xB5, 0x43, 0xE5, 0x8B, 0xB9, 0x43, 0xE5, - 0x8B, 0xBA, 0x43, 0xE5, 0x8C, 0x85, 0x43, 0xE5, - 0x8C, 0x86, 0x43, 0xE5, 0x8C, 0x95, 0x43, 0xE5, - 0x8C, 0x97, 0x43, 0xE5, 0x8C, 0x9A, 0x43, 0xE5, - 0x8C, 0xB8, 0x43, 0xE5, 0x8C, 0xBB, 0x43, 0xE5, - // Bytes 980 - 9bf - 0x8C, 0xBF, 0x43, 0xE5, 0x8D, 0x81, 0x43, 0xE5, - 0x8D, 0x84, 0x43, 0xE5, 0x8D, 0x85, 0x43, 0xE5, - 0x8D, 0x89, 0x43, 0xE5, 0x8D, 0x91, 0x43, 0xE5, - 0x8D, 0x94, 0x43, 0xE5, 0x8D, 0x9A, 0x43, 0xE5, - 0x8D, 0x9C, 0x43, 0xE5, 0x8D, 0xA9, 0x43, 0xE5, - 0x8D, 0xB0, 0x43, 0xE5, 0x8D, 0xB3, 0x43, 0xE5, - 0x8D, 0xB5, 0x43, 0xE5, 0x8D, 0xBD, 0x43, 0xE5, - 0x8D, 0xBF, 0x43, 0xE5, 0x8E, 0x82, 0x43, 0xE5, - // Bytes 9c0 - 9ff - 0x8E, 0xB6, 0x43, 0xE5, 0x8F, 0x83, 0x43, 0xE5, - 0x8F, 0x88, 0x43, 0xE5, 0x8F, 0x8A, 0x43, 0xE5, - 0x8F, 0x8C, 0x43, 0xE5, 0x8F, 0x9F, 0x43, 0xE5, - 0x8F, 0xA3, 0x43, 0xE5, 0x8F, 0xA5, 0x43, 0xE5, - 0x8F, 0xAB, 0x43, 0xE5, 0x8F, 0xAF, 0x43, 0xE5, - 0x8F, 0xB1, 0x43, 0xE5, 0x8F, 0xB3, 0x43, 0xE5, - 0x90, 0x86, 0x43, 0xE5, 0x90, 0x88, 0x43, 0xE5, - 0x90, 0x8D, 0x43, 0xE5, 0x90, 0x8F, 0x43, 0xE5, - // Bytes a00 - a3f - 0x90, 0x9D, 0x43, 0xE5, 0x90, 0xB8, 0x43, 0xE5, - 0x90, 0xB9, 0x43, 0xE5, 0x91, 0x82, 0x43, 0xE5, - 0x91, 0x88, 0x43, 0xE5, 0x91, 0xA8, 0x43, 0xE5, - 0x92, 0x9E, 0x43, 0xE5, 0x92, 0xA2, 0x43, 0xE5, - 0x92, 0xBD, 0x43, 0xE5, 0x93, 0xB6, 0x43, 0xE5, - 0x94, 0x90, 0x43, 0xE5, 0x95, 0x8F, 0x43, 0xE5, - 0x95, 0x93, 0x43, 0xE5, 0x95, 0x95, 0x43, 0xE5, - 0x95, 0xA3, 0x43, 0xE5, 0x96, 0x84, 0x43, 0xE5, - // Bytes a40 - a7f - 0x96, 0x87, 0x43, 0xE5, 0x96, 0x99, 0x43, 0xE5, - 0x96, 0x9D, 0x43, 0xE5, 0x96, 0xAB, 0x43, 0xE5, - 0x96, 0xB3, 0x43, 0xE5, 0x96, 0xB6, 0x43, 0xE5, - 0x97, 0x80, 0x43, 0xE5, 0x97, 0x82, 0x43, 0xE5, - 0x97, 0xA2, 0x43, 0xE5, 0x98, 0x86, 0x43, 0xE5, - 0x99, 0x91, 0x43, 0xE5, 0x99, 0xA8, 0x43, 0xE5, - 0x99, 0xB4, 0x43, 0xE5, 0x9B, 0x97, 0x43, 0xE5, - 0x9B, 0x9B, 0x43, 0xE5, 0x9B, 0xB9, 0x43, 0xE5, - // Bytes a80 - abf - 0x9C, 0x96, 0x43, 0xE5, 0x9C, 0x97, 0x43, 0xE5, - 0x9C, 0x9F, 0x43, 0xE5, 0x9C, 0xB0, 0x43, 0xE5, - 0x9E, 0x8B, 0x43, 0xE5, 0x9F, 0x8E, 0x43, 0xE5, - 0x9F, 0xB4, 0x43, 0xE5, 0xA0, 0x8D, 0x43, 0xE5, - 0xA0, 0xB1, 0x43, 0xE5, 0xA0, 0xB2, 0x43, 0xE5, - 0xA1, 0x80, 0x43, 0xE5, 0xA1, 0x9A, 0x43, 0xE5, - 0xA1, 0x9E, 0x43, 0xE5, 0xA2, 0xA8, 0x43, 0xE5, - 0xA2, 0xAC, 0x43, 0xE5, 0xA2, 0xB3, 0x43, 0xE5, - // Bytes ac0 - aff - 0xA3, 0x98, 0x43, 0xE5, 0xA3, 0x9F, 0x43, 0xE5, - 0xA3, 0xAB, 0x43, 0xE5, 0xA3, 0xAE, 0x43, 0xE5, - 0xA3, 0xB0, 0x43, 0xE5, 0xA3, 0xB2, 0x43, 0xE5, - 0xA3, 0xB7, 0x43, 0xE5, 0xA4, 0x82, 0x43, 0xE5, - 0xA4, 0x86, 0x43, 0xE5, 0xA4, 0x8A, 0x43, 0xE5, - 0xA4, 0x95, 0x43, 0xE5, 0xA4, 0x9A, 0x43, 0xE5, - 0xA4, 0x9C, 0x43, 0xE5, 0xA4, 0xA2, 0x43, 0xE5, - 0xA4, 0xA7, 0x43, 0xE5, 0xA4, 0xA9, 0x43, 0xE5, - // Bytes b00 - b3f - 0xA5, 0x84, 0x43, 0xE5, 0xA5, 0x88, 0x43, 0xE5, - 0xA5, 0x91, 0x43, 0xE5, 0xA5, 0x94, 0x43, 0xE5, - 0xA5, 0xA2, 0x43, 0xE5, 0xA5, 0xB3, 0x43, 0xE5, - 0xA7, 0x98, 0x43, 0xE5, 0xA7, 0xAC, 0x43, 0xE5, - 0xA8, 0x9B, 0x43, 0xE5, 0xA8, 0xA7, 0x43, 0xE5, - 0xA9, 0xA2, 0x43, 0xE5, 0xA9, 0xA6, 0x43, 0xE5, - 0xAA, 0xB5, 0x43, 0xE5, 0xAC, 0x88, 0x43, 0xE5, - 0xAC, 0xA8, 0x43, 0xE5, 0xAC, 0xBE, 0x43, 0xE5, - // Bytes b40 - b7f - 0xAD, 0x90, 0x43, 0xE5, 0xAD, 0x97, 0x43, 0xE5, - 0xAD, 0xA6, 0x43, 0xE5, 0xAE, 0x80, 0x43, 0xE5, - 0xAE, 0x85, 0x43, 0xE5, 0xAE, 0x97, 0x43, 0xE5, - 0xAF, 0x83, 0x43, 0xE5, 0xAF, 0x98, 0x43, 0xE5, - 0xAF, 0xA7, 0x43, 0xE5, 0xAF, 0xAE, 0x43, 0xE5, - 0xAF, 0xB3, 0x43, 0xE5, 0xAF, 0xB8, 0x43, 0xE5, - 0xAF, 0xBF, 0x43, 0xE5, 0xB0, 0x86, 0x43, 0xE5, - 0xB0, 0x8F, 0x43, 0xE5, 0xB0, 0xA2, 0x43, 0xE5, - // Bytes b80 - bbf - 0xB0, 0xB8, 0x43, 0xE5, 0xB0, 0xBF, 0x43, 0xE5, - 0xB1, 0xA0, 0x43, 0xE5, 0xB1, 0xA2, 0x43, 0xE5, - 0xB1, 0xA4, 0x43, 0xE5, 0xB1, 0xA5, 0x43, 0xE5, - 0xB1, 0xAE, 0x43, 0xE5, 0xB1, 0xB1, 0x43, 0xE5, - 0xB2, 0x8D, 0x43, 0xE5, 0xB3, 0x80, 0x43, 0xE5, - 0xB4, 0x99, 0x43, 0xE5, 0xB5, 0x83, 0x43, 0xE5, - 0xB5, 0x90, 0x43, 0xE5, 0xB5, 0xAB, 0x43, 0xE5, - 0xB5, 0xAE, 0x43, 0xE5, 0xB5, 0xBC, 0x43, 0xE5, - // Bytes bc0 - bff - 0xB6, 0xB2, 0x43, 0xE5, 0xB6, 0xBA, 0x43, 0xE5, - 0xB7, 0x9B, 0x43, 0xE5, 0xB7, 0xA1, 0x43, 0xE5, - 0xB7, 0xA2, 0x43, 0xE5, 0xB7, 0xA5, 0x43, 0xE5, - 0xB7, 0xA6, 0x43, 0xE5, 0xB7, 0xB1, 0x43, 0xE5, - 0xB7, 0xBD, 0x43, 0xE5, 0xB7, 0xBE, 0x43, 0xE5, - 0xB8, 0xA8, 0x43, 0xE5, 0xB8, 0xBD, 0x43, 0xE5, - 0xB9, 0xA9, 0x43, 0xE5, 0xB9, 0xB2, 0x43, 0xE5, - 0xB9, 0xB4, 0x43, 0xE5, 0xB9, 0xBA, 0x43, 0xE5, - // Bytes c00 - c3f - 0xB9, 0xBC, 0x43, 0xE5, 0xB9, 0xBF, 0x43, 0xE5, - 0xBA, 0xA6, 0x43, 0xE5, 0xBA, 0xB0, 0x43, 0xE5, - 0xBA, 0xB3, 0x43, 0xE5, 0xBA, 0xB6, 0x43, 0xE5, - 0xBB, 0x89, 0x43, 0xE5, 0xBB, 0x8A, 0x43, 0xE5, - 0xBB, 0x92, 0x43, 0xE5, 0xBB, 0x93, 0x43, 0xE5, - 0xBB, 0x99, 0x43, 0xE5, 0xBB, 0xAC, 0x43, 0xE5, - 0xBB, 0xB4, 0x43, 0xE5, 0xBB, 0xBE, 0x43, 0xE5, - 0xBC, 0x84, 0x43, 0xE5, 0xBC, 0x8B, 0x43, 0xE5, - // Bytes c40 - c7f - 0xBC, 0x93, 0x43, 0xE5, 0xBC, 0xA2, 0x43, 0xE5, - 0xBD, 0x90, 0x43, 0xE5, 0xBD, 0x93, 0x43, 0xE5, - 0xBD, 0xA1, 0x43, 0xE5, 0xBD, 0xA2, 0x43, 0xE5, - 0xBD, 0xA9, 0x43, 0xE5, 0xBD, 0xAB, 0x43, 0xE5, - 0xBD, 0xB3, 0x43, 0xE5, 0xBE, 0x8B, 0x43, 0xE5, - 0xBE, 0x8C, 0x43, 0xE5, 0xBE, 0x97, 0x43, 0xE5, - 0xBE, 0x9A, 0x43, 0xE5, 0xBE, 0xA9, 0x43, 0xE5, - 0xBE, 0xAD, 0x43, 0xE5, 0xBF, 0x83, 0x43, 0xE5, - // Bytes c80 - cbf - 0xBF, 0x8D, 0x43, 0xE5, 0xBF, 0x97, 0x43, 0xE5, - 0xBF, 0xB5, 0x43, 0xE5, 0xBF, 0xB9, 0x43, 0xE6, - 0x80, 0x92, 0x43, 0xE6, 0x80, 0x9C, 0x43, 0xE6, - 0x81, 0xB5, 0x43, 0xE6, 0x82, 0x81, 0x43, 0xE6, - 0x82, 0x94, 0x43, 0xE6, 0x83, 0x87, 0x43, 0xE6, - 0x83, 0x98, 0x43, 0xE6, 0x83, 0xA1, 0x43, 0xE6, - 0x84, 0x88, 0x43, 0xE6, 0x85, 0x84, 0x43, 0xE6, - 0x85, 0x88, 0x43, 0xE6, 0x85, 0x8C, 0x43, 0xE6, - // Bytes cc0 - cff - 0x85, 0x8E, 0x43, 0xE6, 0x85, 0xA0, 0x43, 0xE6, - 0x85, 0xA8, 0x43, 0xE6, 0x85, 0xBA, 0x43, 0xE6, - 0x86, 0x8E, 0x43, 0xE6, 0x86, 0x90, 0x43, 0xE6, - 0x86, 0xA4, 0x43, 0xE6, 0x86, 0xAF, 0x43, 0xE6, - 0x86, 0xB2, 0x43, 0xE6, 0x87, 0x9E, 0x43, 0xE6, - 0x87, 0xB2, 0x43, 0xE6, 0x87, 0xB6, 0x43, 0xE6, - 0x88, 0x80, 0x43, 0xE6, 0x88, 0x88, 0x43, 0xE6, - 0x88, 0x90, 0x43, 0xE6, 0x88, 0x9B, 0x43, 0xE6, - // Bytes d00 - d3f - 0x88, 0xAE, 0x43, 0xE6, 0x88, 0xB4, 0x43, 0xE6, - 0x88, 0xB6, 0x43, 0xE6, 0x89, 0x8B, 0x43, 0xE6, - 0x89, 0x93, 0x43, 0xE6, 0x89, 0x9D, 0x43, 0xE6, - 0x8A, 0x95, 0x43, 0xE6, 0x8A, 0xB1, 0x43, 0xE6, - 0x8B, 0x89, 0x43, 0xE6, 0x8B, 0x8F, 0x43, 0xE6, - 0x8B, 0x93, 0x43, 0xE6, 0x8B, 0x94, 0x43, 0xE6, - 0x8B, 0xBC, 0x43, 0xE6, 0x8B, 0xBE, 0x43, 0xE6, - 0x8C, 0x87, 0x43, 0xE6, 0x8C, 0xBD, 0x43, 0xE6, - // Bytes d40 - d7f - 0x8D, 0x90, 0x43, 0xE6, 0x8D, 0x95, 0x43, 0xE6, - 0x8D, 0xA8, 0x43, 0xE6, 0x8D, 0xBB, 0x43, 0xE6, - 0x8E, 0x83, 0x43, 0xE6, 0x8E, 0xA0, 0x43, 0xE6, - 0x8E, 0xA9, 0x43, 0xE6, 0x8F, 0x84, 0x43, 0xE6, - 0x8F, 0x85, 0x43, 0xE6, 0x8F, 0xA4, 0x43, 0xE6, - 0x90, 0x9C, 0x43, 0xE6, 0x90, 0xA2, 0x43, 0xE6, - 0x91, 0x92, 0x43, 0xE6, 0x91, 0xA9, 0x43, 0xE6, - 0x91, 0xB7, 0x43, 0xE6, 0x91, 0xBE, 0x43, 0xE6, - // Bytes d80 - dbf - 0x92, 0x9A, 0x43, 0xE6, 0x92, 0x9D, 0x43, 0xE6, - 0x93, 0x84, 0x43, 0xE6, 0x94, 0xAF, 0x43, 0xE6, - 0x94, 0xB4, 0x43, 0xE6, 0x95, 0x8F, 0x43, 0xE6, - 0x95, 0x96, 0x43, 0xE6, 0x95, 0xAC, 0x43, 0xE6, - 0x95, 0xB8, 0x43, 0xE6, 0x96, 0x87, 0x43, 0xE6, - 0x96, 0x97, 0x43, 0xE6, 0x96, 0x99, 0x43, 0xE6, - 0x96, 0xA4, 0x43, 0xE6, 0x96, 0xB0, 0x43, 0xE6, - 0x96, 0xB9, 0x43, 0xE6, 0x97, 0x85, 0x43, 0xE6, - // Bytes dc0 - dff - 0x97, 0xA0, 0x43, 0xE6, 0x97, 0xA2, 0x43, 0xE6, - 0x97, 0xA3, 0x43, 0xE6, 0x97, 0xA5, 0x43, 0xE6, - 0x98, 0x93, 0x43, 0xE6, 0x98, 0xA0, 0x43, 0xE6, - 0x99, 0x89, 0x43, 0xE6, 0x99, 0xB4, 0x43, 0xE6, - 0x9A, 0x88, 0x43, 0xE6, 0x9A, 0x91, 0x43, 0xE6, - 0x9A, 0x9C, 0x43, 0xE6, 0x9A, 0xB4, 0x43, 0xE6, - 0x9B, 0x86, 0x43, 0xE6, 0x9B, 0xB0, 0x43, 0xE6, - 0x9B, 0xB4, 0x43, 0xE6, 0x9B, 0xB8, 0x43, 0xE6, - // Bytes e00 - e3f - 0x9C, 0x80, 0x43, 0xE6, 0x9C, 0x88, 0x43, 0xE6, - 0x9C, 0x89, 0x43, 0xE6, 0x9C, 0x97, 0x43, 0xE6, - 0x9C, 0x9B, 0x43, 0xE6, 0x9C, 0xA1, 0x43, 0xE6, - 0x9C, 0xA8, 0x43, 0xE6, 0x9D, 0x8E, 0x43, 0xE6, - 0x9D, 0x93, 0x43, 0xE6, 0x9D, 0x96, 0x43, 0xE6, - 0x9D, 0x9E, 0x43, 0xE6, 0x9D, 0xBB, 0x43, 0xE6, - 0x9E, 0x85, 0x43, 0xE6, 0x9E, 0x97, 0x43, 0xE6, - 0x9F, 0xB3, 0x43, 0xE6, 0x9F, 0xBA, 0x43, 0xE6, - // Bytes e40 - e7f - 0xA0, 0x97, 0x43, 0xE6, 0xA0, 0x9F, 0x43, 0xE6, - 0xA0, 0xAA, 0x43, 0xE6, 0xA1, 0x92, 0x43, 0xE6, - 0xA2, 0x81, 0x43, 0xE6, 0xA2, 0x85, 0x43, 0xE6, - 0xA2, 0x8E, 0x43, 0xE6, 0xA2, 0xA8, 0x43, 0xE6, - 0xA4, 0x94, 0x43, 0xE6, 0xA5, 0x82, 0x43, 0xE6, - 0xA6, 0xA3, 0x43, 0xE6, 0xA7, 0xAA, 0x43, 0xE6, - 0xA8, 0x82, 0x43, 0xE6, 0xA8, 0x93, 0x43, 0xE6, - 0xAA, 0xA8, 0x43, 0xE6, 0xAB, 0x93, 0x43, 0xE6, - // Bytes e80 - ebf - 0xAB, 0x9B, 0x43, 0xE6, 0xAC, 0x84, 0x43, 0xE6, - 0xAC, 0xA0, 0x43, 0xE6, 0xAC, 0xA1, 0x43, 0xE6, - 0xAD, 0x94, 0x43, 0xE6, 0xAD, 0xA2, 0x43, 0xE6, - 0xAD, 0xA3, 0x43, 0xE6, 0xAD, 0xB2, 0x43, 0xE6, - 0xAD, 0xB7, 0x43, 0xE6, 0xAD, 0xB9, 0x43, 0xE6, - 0xAE, 0x9F, 0x43, 0xE6, 0xAE, 0xAE, 0x43, 0xE6, - 0xAE, 0xB3, 0x43, 0xE6, 0xAE, 0xBA, 0x43, 0xE6, - 0xAE, 0xBB, 0x43, 0xE6, 0xAF, 0x8B, 0x43, 0xE6, - // Bytes ec0 - eff - 0xAF, 0x8D, 0x43, 0xE6, 0xAF, 0x94, 0x43, 0xE6, - 0xAF, 0x9B, 0x43, 0xE6, 0xB0, 0x8F, 0x43, 0xE6, - 0xB0, 0x94, 0x43, 0xE6, 0xB0, 0xB4, 0x43, 0xE6, - 0xB1, 0x8E, 0x43, 0xE6, 0xB1, 0xA7, 0x43, 0xE6, - 0xB2, 0x88, 0x43, 0xE6, 0xB2, 0xBF, 0x43, 0xE6, - 0xB3, 0x8C, 0x43, 0xE6, 0xB3, 0x8D, 0x43, 0xE6, - 0xB3, 0xA5, 0x43, 0xE6, 0xB3, 0xA8, 0x43, 0xE6, - 0xB4, 0x96, 0x43, 0xE6, 0xB4, 0x9B, 0x43, 0xE6, - // Bytes f00 - f3f - 0xB4, 0x9E, 0x43, 0xE6, 0xB4, 0xB4, 0x43, 0xE6, - 0xB4, 0xBE, 0x43, 0xE6, 0xB5, 0x81, 0x43, 0xE6, - 0xB5, 0xA9, 0x43, 0xE6, 0xB5, 0xAA, 0x43, 0xE6, - 0xB5, 0xB7, 0x43, 0xE6, 0xB5, 0xB8, 0x43, 0xE6, - 0xB6, 0x85, 0x43, 0xE6, 0xB7, 0x8B, 0x43, 0xE6, - 0xB7, 0x9A, 0x43, 0xE6, 0xB7, 0xAA, 0x43, 0xE6, - 0xB7, 0xB9, 0x43, 0xE6, 0xB8, 0x9A, 0x43, 0xE6, - 0xB8, 0xAF, 0x43, 0xE6, 0xB9, 0xAE, 0x43, 0xE6, - // Bytes f40 - f7f - 0xBA, 0x80, 0x43, 0xE6, 0xBA, 0x9C, 0x43, 0xE6, - 0xBA, 0xBA, 0x43, 0xE6, 0xBB, 0x87, 0x43, 0xE6, - 0xBB, 0x8B, 0x43, 0xE6, 0xBB, 0x91, 0x43, 0xE6, - 0xBB, 0x9B, 0x43, 0xE6, 0xBC, 0x8F, 0x43, 0xE6, - 0xBC, 0x94, 0x43, 0xE6, 0xBC, 0xA2, 0x43, 0xE6, - 0xBC, 0xA3, 0x43, 0xE6, 0xBD, 0xAE, 0x43, 0xE6, - 0xBF, 0x86, 0x43, 0xE6, 0xBF, 0xAB, 0x43, 0xE6, - 0xBF, 0xBE, 0x43, 0xE7, 0x80, 0x9B, 0x43, 0xE7, - // Bytes f80 - fbf - 0x80, 0x9E, 0x43, 0xE7, 0x80, 0xB9, 0x43, 0xE7, - 0x81, 0x8A, 0x43, 0xE7, 0x81, 0xAB, 0x43, 0xE7, - 0x81, 0xB0, 0x43, 0xE7, 0x81, 0xB7, 0x43, 0xE7, - 0x81, 0xBD, 0x43, 0xE7, 0x82, 0x99, 0x43, 0xE7, - 0x82, 0xAD, 0x43, 0xE7, 0x83, 0x88, 0x43, 0xE7, - 0x83, 0x99, 0x43, 0xE7, 0x84, 0xA1, 0x43, 0xE7, - 0x85, 0x85, 0x43, 0xE7, 0x85, 0x89, 0x43, 0xE7, - 0x85, 0xAE, 0x43, 0xE7, 0x86, 0x9C, 0x43, 0xE7, - // Bytes fc0 - fff - 0x87, 0x8E, 0x43, 0xE7, 0x87, 0x90, 0x43, 0xE7, - 0x88, 0x90, 0x43, 0xE7, 0x88, 0x9B, 0x43, 0xE7, - 0x88, 0xA8, 0x43, 0xE7, 0x88, 0xAA, 0x43, 0xE7, - 0x88, 0xAB, 0x43, 0xE7, 0x88, 0xB5, 0x43, 0xE7, - 0x88, 0xB6, 0x43, 0xE7, 0x88, 0xBB, 0x43, 0xE7, - 0x88, 0xBF, 0x43, 0xE7, 0x89, 0x87, 0x43, 0xE7, - 0x89, 0x90, 0x43, 0xE7, 0x89, 0x99, 0x43, 0xE7, - 0x89, 0x9B, 0x43, 0xE7, 0x89, 0xA2, 0x43, 0xE7, - // Bytes 1000 - 103f - 0x89, 0xB9, 0x43, 0xE7, 0x8A, 0x80, 0x43, 0xE7, - 0x8A, 0x95, 0x43, 0xE7, 0x8A, 0xAC, 0x43, 0xE7, - 0x8A, 0xAF, 0x43, 0xE7, 0x8B, 0x80, 0x43, 0xE7, - 0x8B, 0xBC, 0x43, 0xE7, 0x8C, 0xAA, 0x43, 0xE7, - 0x8D, 0xB5, 0x43, 0xE7, 0x8D, 0xBA, 0x43, 0xE7, - 0x8E, 0x84, 0x43, 0xE7, 0x8E, 0x87, 0x43, 0xE7, - 0x8E, 0x89, 0x43, 0xE7, 0x8E, 0x8B, 0x43, 0xE7, - 0x8E, 0xA5, 0x43, 0xE7, 0x8E, 0xB2, 0x43, 0xE7, - // Bytes 1040 - 107f - 0x8F, 0x9E, 0x43, 0xE7, 0x90, 0x86, 0x43, 0xE7, - 0x90, 0x89, 0x43, 0xE7, 0x90, 0xA2, 0x43, 0xE7, - 0x91, 0x87, 0x43, 0xE7, 0x91, 0x9C, 0x43, 0xE7, - 0x91, 0xA9, 0x43, 0xE7, 0x91, 0xB1, 0x43, 0xE7, - 0x92, 0x85, 0x43, 0xE7, 0x92, 0x89, 0x43, 0xE7, - 0x92, 0x98, 0x43, 0xE7, 0x93, 0x8A, 0x43, 0xE7, - 0x93, 0x9C, 0x43, 0xE7, 0x93, 0xA6, 0x43, 0xE7, - 0x94, 0x86, 0x43, 0xE7, 0x94, 0x98, 0x43, 0xE7, - // Bytes 1080 - 10bf - 0x94, 0x9F, 0x43, 0xE7, 0x94, 0xA4, 0x43, 0xE7, - 0x94, 0xA8, 0x43, 0xE7, 0x94, 0xB0, 0x43, 0xE7, - 0x94, 0xB2, 0x43, 0xE7, 0x94, 0xB3, 0x43, 0xE7, - 0x94, 0xB7, 0x43, 0xE7, 0x94, 0xBB, 0x43, 0xE7, - 0x94, 0xBE, 0x43, 0xE7, 0x95, 0x99, 0x43, 0xE7, - 0x95, 0xA5, 0x43, 0xE7, 0x95, 0xB0, 0x43, 0xE7, - 0x96, 0x8B, 0x43, 0xE7, 0x96, 0x92, 0x43, 0xE7, - 0x97, 0xA2, 0x43, 0xE7, 0x98, 0x90, 0x43, 0xE7, - // Bytes 10c0 - 10ff - 0x98, 0x9D, 0x43, 0xE7, 0x98, 0x9F, 0x43, 0xE7, - 0x99, 0x82, 0x43, 0xE7, 0x99, 0xA9, 0x43, 0xE7, - 0x99, 0xB6, 0x43, 0xE7, 0x99, 0xBD, 0x43, 0xE7, - 0x9A, 0xAE, 0x43, 0xE7, 0x9A, 0xBF, 0x43, 0xE7, - 0x9B, 0x8A, 0x43, 0xE7, 0x9B, 0x9B, 0x43, 0xE7, - 0x9B, 0xA3, 0x43, 0xE7, 0x9B, 0xA7, 0x43, 0xE7, - 0x9B, 0xAE, 0x43, 0xE7, 0x9B, 0xB4, 0x43, 0xE7, - 0x9C, 0x81, 0x43, 0xE7, 0x9C, 0x9E, 0x43, 0xE7, - // Bytes 1100 - 113f - 0x9C, 0x9F, 0x43, 0xE7, 0x9D, 0x80, 0x43, 0xE7, - 0x9D, 0x8A, 0x43, 0xE7, 0x9E, 0x8B, 0x43, 0xE7, - 0x9E, 0xA7, 0x43, 0xE7, 0x9F, 0x9B, 0x43, 0xE7, - 0x9F, 0xA2, 0x43, 0xE7, 0x9F, 0xB3, 0x43, 0xE7, - 0xA1, 0x8E, 0x43, 0xE7, 0xA1, 0xAB, 0x43, 0xE7, - 0xA2, 0x8C, 0x43, 0xE7, 0xA2, 0x91, 0x43, 0xE7, - 0xA3, 0x8A, 0x43, 0xE7, 0xA3, 0x8C, 0x43, 0xE7, - 0xA3, 0xBB, 0x43, 0xE7, 0xA4, 0xAA, 0x43, 0xE7, - // Bytes 1140 - 117f - 0xA4, 0xBA, 0x43, 0xE7, 0xA4, 0xBC, 0x43, 0xE7, - 0xA4, 0xBE, 0x43, 0xE7, 0xA5, 0x88, 0x43, 0xE7, - 0xA5, 0x89, 0x43, 0xE7, 0xA5, 0x90, 0x43, 0xE7, - 0xA5, 0x96, 0x43, 0xE7, 0xA5, 0x9D, 0x43, 0xE7, - 0xA5, 0x9E, 0x43, 0xE7, 0xA5, 0xA5, 0x43, 0xE7, - 0xA5, 0xBF, 0x43, 0xE7, 0xA6, 0x81, 0x43, 0xE7, - 0xA6, 0x8D, 0x43, 0xE7, 0xA6, 0x8E, 0x43, 0xE7, - 0xA6, 0x8F, 0x43, 0xE7, 0xA6, 0xAE, 0x43, 0xE7, - // Bytes 1180 - 11bf - 0xA6, 0xB8, 0x43, 0xE7, 0xA6, 0xBE, 0x43, 0xE7, - 0xA7, 0x8A, 0x43, 0xE7, 0xA7, 0x98, 0x43, 0xE7, - 0xA7, 0xAB, 0x43, 0xE7, 0xA8, 0x9C, 0x43, 0xE7, - 0xA9, 0x80, 0x43, 0xE7, 0xA9, 0x8A, 0x43, 0xE7, - 0xA9, 0x8F, 0x43, 0xE7, 0xA9, 0xB4, 0x43, 0xE7, - 0xA9, 0xBA, 0x43, 0xE7, 0xAA, 0x81, 0x43, 0xE7, - 0xAA, 0xB1, 0x43, 0xE7, 0xAB, 0x8B, 0x43, 0xE7, - 0xAB, 0xAE, 0x43, 0xE7, 0xAB, 0xB9, 0x43, 0xE7, - // Bytes 11c0 - 11ff - 0xAC, 0xA0, 0x43, 0xE7, 0xAE, 0x8F, 0x43, 0xE7, - 0xAF, 0x80, 0x43, 0xE7, 0xAF, 0x86, 0x43, 0xE7, - 0xAF, 0x89, 0x43, 0xE7, 0xB0, 0xBE, 0x43, 0xE7, - 0xB1, 0xA0, 0x43, 0xE7, 0xB1, 0xB3, 0x43, 0xE7, - 0xB1, 0xBB, 0x43, 0xE7, 0xB2, 0x92, 0x43, 0xE7, - 0xB2, 0xBE, 0x43, 0xE7, 0xB3, 0x92, 0x43, 0xE7, - 0xB3, 0x96, 0x43, 0xE7, 0xB3, 0xA3, 0x43, 0xE7, - 0xB3, 0xA7, 0x43, 0xE7, 0xB3, 0xA8, 0x43, 0xE7, - // Bytes 1200 - 123f - 0xB3, 0xB8, 0x43, 0xE7, 0xB4, 0x80, 0x43, 0xE7, - 0xB4, 0x90, 0x43, 0xE7, 0xB4, 0xA2, 0x43, 0xE7, - 0xB4, 0xAF, 0x43, 0xE7, 0xB5, 0x82, 0x43, 0xE7, - 0xB5, 0x9B, 0x43, 0xE7, 0xB5, 0xA3, 0x43, 0xE7, - 0xB6, 0xA0, 0x43, 0xE7, 0xB6, 0xBE, 0x43, 0xE7, - 0xB7, 0x87, 0x43, 0xE7, 0xB7, 0xB4, 0x43, 0xE7, - 0xB8, 0x82, 0x43, 0xE7, 0xB8, 0x89, 0x43, 0xE7, - 0xB8, 0xB7, 0x43, 0xE7, 0xB9, 0x81, 0x43, 0xE7, - // Bytes 1240 - 127f - 0xB9, 0x85, 0x43, 0xE7, 0xBC, 0xB6, 0x43, 0xE7, - 0xBC, 0xBE, 0x43, 0xE7, 0xBD, 0x91, 0x43, 0xE7, - 0xBD, 0xB2, 0x43, 0xE7, 0xBD, 0xB9, 0x43, 0xE7, - 0xBD, 0xBA, 0x43, 0xE7, 0xBE, 0x85, 0x43, 0xE7, - 0xBE, 0x8A, 0x43, 0xE7, 0xBE, 0x95, 0x43, 0xE7, - 0xBE, 0x9A, 0x43, 0xE7, 0xBE, 0xBD, 0x43, 0xE7, - 0xBF, 0xBA, 0x43, 0xE8, 0x80, 0x81, 0x43, 0xE8, - 0x80, 0x85, 0x43, 0xE8, 0x80, 0x8C, 0x43, 0xE8, - // Bytes 1280 - 12bf - 0x80, 0x92, 0x43, 0xE8, 0x80, 0xB3, 0x43, 0xE8, - 0x81, 0x86, 0x43, 0xE8, 0x81, 0xA0, 0x43, 0xE8, - 0x81, 0xAF, 0x43, 0xE8, 0x81, 0xB0, 0x43, 0xE8, - 0x81, 0xBE, 0x43, 0xE8, 0x81, 0xBF, 0x43, 0xE8, - 0x82, 0x89, 0x43, 0xE8, 0x82, 0x8B, 0x43, 0xE8, - 0x82, 0xAD, 0x43, 0xE8, 0x82, 0xB2, 0x43, 0xE8, - 0x84, 0x83, 0x43, 0xE8, 0x84, 0xBE, 0x43, 0xE8, - 0x87, 0x98, 0x43, 0xE8, 0x87, 0xA3, 0x43, 0xE8, - // Bytes 12c0 - 12ff - 0x87, 0xA8, 0x43, 0xE8, 0x87, 0xAA, 0x43, 0xE8, - 0x87, 0xAD, 0x43, 0xE8, 0x87, 0xB3, 0x43, 0xE8, - 0x87, 0xBC, 0x43, 0xE8, 0x88, 0x81, 0x43, 0xE8, - 0x88, 0x84, 0x43, 0xE8, 0x88, 0x8C, 0x43, 0xE8, - 0x88, 0x98, 0x43, 0xE8, 0x88, 0x9B, 0x43, 0xE8, - 0x88, 0x9F, 0x43, 0xE8, 0x89, 0xAE, 0x43, 0xE8, - 0x89, 0xAF, 0x43, 0xE8, 0x89, 0xB2, 0x43, 0xE8, - 0x89, 0xB8, 0x43, 0xE8, 0x89, 0xB9, 0x43, 0xE8, - // Bytes 1300 - 133f - 0x8A, 0x8B, 0x43, 0xE8, 0x8A, 0x91, 0x43, 0xE8, - 0x8A, 0x9D, 0x43, 0xE8, 0x8A, 0xB1, 0x43, 0xE8, - 0x8A, 0xB3, 0x43, 0xE8, 0x8A, 0xBD, 0x43, 0xE8, - 0x8B, 0xA5, 0x43, 0xE8, 0x8B, 0xA6, 0x43, 0xE8, - 0x8C, 0x9D, 0x43, 0xE8, 0x8C, 0xA3, 0x43, 0xE8, - 0x8C, 0xB6, 0x43, 0xE8, 0x8D, 0x92, 0x43, 0xE8, - 0x8D, 0x93, 0x43, 0xE8, 0x8D, 0xA3, 0x43, 0xE8, - 0x8E, 0xAD, 0x43, 0xE8, 0x8E, 0xBD, 0x43, 0xE8, - // Bytes 1340 - 137f - 0x8F, 0x89, 0x43, 0xE8, 0x8F, 0x8A, 0x43, 0xE8, - 0x8F, 0x8C, 0x43, 0xE8, 0x8F, 0x9C, 0x43, 0xE8, - 0x8F, 0xA7, 0x43, 0xE8, 0x8F, 0xAF, 0x43, 0xE8, - 0x8F, 0xB1, 0x43, 0xE8, 0x90, 0xBD, 0x43, 0xE8, - 0x91, 0x89, 0x43, 0xE8, 0x91, 0x97, 0x43, 0xE8, - 0x93, 0xAE, 0x43, 0xE8, 0x93, 0xB1, 0x43, 0xE8, - 0x93, 0xB3, 0x43, 0xE8, 0x93, 0xBC, 0x43, 0xE8, - 0x94, 0x96, 0x43, 0xE8, 0x95, 0xA4, 0x43, 0xE8, - // Bytes 1380 - 13bf - 0x97, 0x8D, 0x43, 0xE8, 0x97, 0xBA, 0x43, 0xE8, - 0x98, 0x86, 0x43, 0xE8, 0x98, 0x92, 0x43, 0xE8, - 0x98, 0xAD, 0x43, 0xE8, 0x98, 0xBF, 0x43, 0xE8, - 0x99, 0x8D, 0x43, 0xE8, 0x99, 0x90, 0x43, 0xE8, - 0x99, 0x9C, 0x43, 0xE8, 0x99, 0xA7, 0x43, 0xE8, - 0x99, 0xA9, 0x43, 0xE8, 0x99, 0xAB, 0x43, 0xE8, - 0x9A, 0x88, 0x43, 0xE8, 0x9A, 0xA9, 0x43, 0xE8, - 0x9B, 0xA2, 0x43, 0xE8, 0x9C, 0x8E, 0x43, 0xE8, - // Bytes 13c0 - 13ff - 0x9C, 0xA8, 0x43, 0xE8, 0x9D, 0xAB, 0x43, 0xE8, - 0x9D, 0xB9, 0x43, 0xE8, 0x9E, 0x86, 0x43, 0xE8, - 0x9E, 0xBA, 0x43, 0xE8, 0x9F, 0xA1, 0x43, 0xE8, - 0xA0, 0x81, 0x43, 0xE8, 0xA0, 0x9F, 0x43, 0xE8, - 0xA1, 0x80, 0x43, 0xE8, 0xA1, 0x8C, 0x43, 0xE8, - 0xA1, 0xA0, 0x43, 0xE8, 0xA1, 0xA3, 0x43, 0xE8, - 0xA3, 0x82, 0x43, 0xE8, 0xA3, 0x8F, 0x43, 0xE8, - 0xA3, 0x97, 0x43, 0xE8, 0xA3, 0x9E, 0x43, 0xE8, - // Bytes 1400 - 143f - 0xA3, 0xA1, 0x43, 0xE8, 0xA3, 0xB8, 0x43, 0xE8, - 0xA3, 0xBA, 0x43, 0xE8, 0xA4, 0x90, 0x43, 0xE8, - 0xA5, 0x81, 0x43, 0xE8, 0xA5, 0xA4, 0x43, 0xE8, - 0xA5, 0xBE, 0x43, 0xE8, 0xA6, 0x86, 0x43, 0xE8, - 0xA6, 0x8B, 0x43, 0xE8, 0xA6, 0x96, 0x43, 0xE8, - 0xA7, 0x92, 0x43, 0xE8, 0xA7, 0xA3, 0x43, 0xE8, - 0xA8, 0x80, 0x43, 0xE8, 0xAA, 0xA0, 0x43, 0xE8, - 0xAA, 0xAA, 0x43, 0xE8, 0xAA, 0xBF, 0x43, 0xE8, - // Bytes 1440 - 147f - 0xAB, 0x8B, 0x43, 0xE8, 0xAB, 0x92, 0x43, 0xE8, - 0xAB, 0x96, 0x43, 0xE8, 0xAB, 0xAD, 0x43, 0xE8, - 0xAB, 0xB8, 0x43, 0xE8, 0xAB, 0xBE, 0x43, 0xE8, - 0xAC, 0x81, 0x43, 0xE8, 0xAC, 0xB9, 0x43, 0xE8, - 0xAD, 0x98, 0x43, 0xE8, 0xAE, 0x80, 0x43, 0xE8, - 0xAE, 0x8A, 0x43, 0xE8, 0xB0, 0xB7, 0x43, 0xE8, - 0xB1, 0x86, 0x43, 0xE8, 0xB1, 0x88, 0x43, 0xE8, - 0xB1, 0x95, 0x43, 0xE8, 0xB1, 0xB8, 0x43, 0xE8, - // Bytes 1480 - 14bf - 0xB2, 0x9D, 0x43, 0xE8, 0xB2, 0xA1, 0x43, 0xE8, - 0xB2, 0xA9, 0x43, 0xE8, 0xB2, 0xAB, 0x43, 0xE8, - 0xB3, 0x81, 0x43, 0xE8, 0xB3, 0x82, 0x43, 0xE8, - 0xB3, 0x87, 0x43, 0xE8, 0xB3, 0x88, 0x43, 0xE8, - 0xB3, 0x93, 0x43, 0xE8, 0xB4, 0x88, 0x43, 0xE8, - 0xB4, 0x9B, 0x43, 0xE8, 0xB5, 0xA4, 0x43, 0xE8, - 0xB5, 0xB0, 0x43, 0xE8, 0xB5, 0xB7, 0x43, 0xE8, - 0xB6, 0xB3, 0x43, 0xE8, 0xB6, 0xBC, 0x43, 0xE8, - // Bytes 14c0 - 14ff - 0xB7, 0x8B, 0x43, 0xE8, 0xB7, 0xAF, 0x43, 0xE8, - 0xB7, 0xB0, 0x43, 0xE8, 0xBA, 0xAB, 0x43, 0xE8, - 0xBB, 0x8A, 0x43, 0xE8, 0xBB, 0x94, 0x43, 0xE8, - 0xBC, 0xA6, 0x43, 0xE8, 0xBC, 0xAA, 0x43, 0xE8, - 0xBC, 0xB8, 0x43, 0xE8, 0xBC, 0xBB, 0x43, 0xE8, - 0xBD, 0xA2, 0x43, 0xE8, 0xBE, 0x9B, 0x43, 0xE8, - 0xBE, 0x9E, 0x43, 0xE8, 0xBE, 0xB0, 0x43, 0xE8, - 0xBE, 0xB5, 0x43, 0xE8, 0xBE, 0xB6, 0x43, 0xE9, - // Bytes 1500 - 153f - 0x80, 0xA3, 0x43, 0xE9, 0x80, 0xB8, 0x43, 0xE9, - 0x81, 0x8A, 0x43, 0xE9, 0x81, 0xA9, 0x43, 0xE9, - 0x81, 0xB2, 0x43, 0xE9, 0x81, 0xBC, 0x43, 0xE9, - 0x82, 0x8F, 0x43, 0xE9, 0x82, 0x91, 0x43, 0xE9, - 0x82, 0x94, 0x43, 0xE9, 0x83, 0x8E, 0x43, 0xE9, - 0x83, 0x9E, 0x43, 0xE9, 0x83, 0xB1, 0x43, 0xE9, - 0x83, 0xBD, 0x43, 0xE9, 0x84, 0x91, 0x43, 0xE9, - 0x84, 0x9B, 0x43, 0xE9, 0x85, 0x89, 0x43, 0xE9, - // Bytes 1540 - 157f - 0x85, 0x8D, 0x43, 0xE9, 0x85, 0xAA, 0x43, 0xE9, - 0x86, 0x99, 0x43, 0xE9, 0x86, 0xB4, 0x43, 0xE9, - 0x87, 0x86, 0x43, 0xE9, 0x87, 0x8C, 0x43, 0xE9, - 0x87, 0x8F, 0x43, 0xE9, 0x87, 0x91, 0x43, 0xE9, - 0x88, 0xB4, 0x43, 0xE9, 0x88, 0xB8, 0x43, 0xE9, - 0x89, 0xB6, 0x43, 0xE9, 0x89, 0xBC, 0x43, 0xE9, - 0x8B, 0x97, 0x43, 0xE9, 0x8B, 0x98, 0x43, 0xE9, - 0x8C, 0x84, 0x43, 0xE9, 0x8D, 0x8A, 0x43, 0xE9, - // Bytes 1580 - 15bf - 0x8F, 0xB9, 0x43, 0xE9, 0x90, 0x95, 0x43, 0xE9, - 0x95, 0xB7, 0x43, 0xE9, 0x96, 0x80, 0x43, 0xE9, - 0x96, 0x8B, 0x43, 0xE9, 0x96, 0xAD, 0x43, 0xE9, - 0x96, 0xB7, 0x43, 0xE9, 0x98, 0x9C, 0x43, 0xE9, - 0x98, 0xAE, 0x43, 0xE9, 0x99, 0x8B, 0x43, 0xE9, - 0x99, 0x8D, 0x43, 0xE9, 0x99, 0xB5, 0x43, 0xE9, - 0x99, 0xB8, 0x43, 0xE9, 0x99, 0xBC, 0x43, 0xE9, - 0x9A, 0x86, 0x43, 0xE9, 0x9A, 0xA3, 0x43, 0xE9, - // Bytes 15c0 - 15ff - 0x9A, 0xB6, 0x43, 0xE9, 0x9A, 0xB7, 0x43, 0xE9, - 0x9A, 0xB8, 0x43, 0xE9, 0x9A, 0xB9, 0x43, 0xE9, - 0x9B, 0x83, 0x43, 0xE9, 0x9B, 0xA2, 0x43, 0xE9, - 0x9B, 0xA3, 0x43, 0xE9, 0x9B, 0xA8, 0x43, 0xE9, - 0x9B, 0xB6, 0x43, 0xE9, 0x9B, 0xB7, 0x43, 0xE9, - 0x9C, 0xA3, 0x43, 0xE9, 0x9C, 0xB2, 0x43, 0xE9, - 0x9D, 0x88, 0x43, 0xE9, 0x9D, 0x91, 0x43, 0xE9, - 0x9D, 0x96, 0x43, 0xE9, 0x9D, 0x9E, 0x43, 0xE9, - // Bytes 1600 - 163f - 0x9D, 0xA2, 0x43, 0xE9, 0x9D, 0xA9, 0x43, 0xE9, - 0x9F, 0x8B, 0x43, 0xE9, 0x9F, 0x9B, 0x43, 0xE9, - 0x9F, 0xA0, 0x43, 0xE9, 0x9F, 0xAD, 0x43, 0xE9, - 0x9F, 0xB3, 0x43, 0xE9, 0x9F, 0xBF, 0x43, 0xE9, - 0xA0, 0x81, 0x43, 0xE9, 0xA0, 0x85, 0x43, 0xE9, - 0xA0, 0x8B, 0x43, 0xE9, 0xA0, 0x98, 0x43, 0xE9, - 0xA0, 0xA9, 0x43, 0xE9, 0xA0, 0xBB, 0x43, 0xE9, - 0xA1, 0x9E, 0x43, 0xE9, 0xA2, 0xA8, 0x43, 0xE9, - // Bytes 1640 - 167f - 0xA3, 0x9B, 0x43, 0xE9, 0xA3, 0x9F, 0x43, 0xE9, - 0xA3, 0xA2, 0x43, 0xE9, 0xA3, 0xAF, 0x43, 0xE9, - 0xA3, 0xBC, 0x43, 0xE9, 0xA4, 0xA8, 0x43, 0xE9, - 0xA4, 0xA9, 0x43, 0xE9, 0xA6, 0x96, 0x43, 0xE9, - 0xA6, 0x99, 0x43, 0xE9, 0xA6, 0xA7, 0x43, 0xE9, - 0xA6, 0xAC, 0x43, 0xE9, 0xA7, 0x82, 0x43, 0xE9, - 0xA7, 0xB1, 0x43, 0xE9, 0xA7, 0xBE, 0x43, 0xE9, - 0xA9, 0xAA, 0x43, 0xE9, 0xAA, 0xA8, 0x43, 0xE9, - // Bytes 1680 - 16bf - 0xAB, 0x98, 0x43, 0xE9, 0xAB, 0x9F, 0x43, 0xE9, - 0xAC, 0x92, 0x43, 0xE9, 0xAC, 0xA5, 0x43, 0xE9, - 0xAC, 0xAF, 0x43, 0xE9, 0xAC, 0xB2, 0x43, 0xE9, - 0xAC, 0xBC, 0x43, 0xE9, 0xAD, 0x9A, 0x43, 0xE9, - 0xAD, 0xAF, 0x43, 0xE9, 0xB1, 0x80, 0x43, 0xE9, - 0xB1, 0x97, 0x43, 0xE9, 0xB3, 0xA5, 0x43, 0xE9, - 0xB3, 0xBD, 0x43, 0xE9, 0xB5, 0xA7, 0x43, 0xE9, - 0xB6, 0xB4, 0x43, 0xE9, 0xB7, 0xBA, 0x43, 0xE9, - // Bytes 16c0 - 16ff - 0xB8, 0x9E, 0x43, 0xE9, 0xB9, 0xB5, 0x43, 0xE9, - 0xB9, 0xBF, 0x43, 0xE9, 0xBA, 0x97, 0x43, 0xE9, - 0xBA, 0x9F, 0x43, 0xE9, 0xBA, 0xA5, 0x43, 0xE9, - 0xBA, 0xBB, 0x43, 0xE9, 0xBB, 0x83, 0x43, 0xE9, - 0xBB, 0x8D, 0x43, 0xE9, 0xBB, 0x8E, 0x43, 0xE9, - 0xBB, 0x91, 0x43, 0xE9, 0xBB, 0xB9, 0x43, 0xE9, - 0xBB, 0xBD, 0x43, 0xE9, 0xBB, 0xBE, 0x43, 0xE9, - 0xBC, 0x85, 0x43, 0xE9, 0xBC, 0x8E, 0x43, 0xE9, - // Bytes 1700 - 173f - 0xBC, 0x8F, 0x43, 0xE9, 0xBC, 0x93, 0x43, 0xE9, - 0xBC, 0x96, 0x43, 0xE9, 0xBC, 0xA0, 0x43, 0xE9, - 0xBC, 0xBB, 0x43, 0xE9, 0xBD, 0x83, 0x43, 0xE9, - 0xBD, 0x8A, 0x43, 0xE9, 0xBD, 0x92, 0x43, 0xE9, - 0xBE, 0x8D, 0x43, 0xE9, 0xBE, 0x8E, 0x43, 0xE9, - 0xBE, 0x9C, 0x43, 0xE9, 0xBE, 0x9F, 0x43, 0xE9, - 0xBE, 0xA0, 0x43, 0xEA, 0x99, 0x91, 0x43, 0xEA, - 0x9A, 0x89, 0x43, 0xEA, 0x9C, 0xA7, 0x43, 0xEA, - // Bytes 1740 - 177f - 0x9D, 0xAF, 0x43, 0xEA, 0x9E, 0x8E, 0x43, 0xEA, - 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x43, 0xEA, - 0xAD, 0xA6, 0x43, 0xEA, 0xAD, 0xA7, 0x44, 0xF0, - 0x9D, 0xBC, 0x84, 0x44, 0xF0, 0x9D, 0xBC, 0x85, - 0x44, 0xF0, 0x9D, 0xBC, 0x86, 0x44, 0xF0, 0x9D, - 0xBC, 0x88, 0x44, 0xF0, 0x9D, 0xBC, 0x8A, 0x44, - 0xF0, 0x9D, 0xBC, 0x9E, 0x44, 0xF0, 0xA0, 0x84, - 0xA2, 0x44, 0xF0, 0xA0, 0x94, 0x9C, 0x44, 0xF0, - // Bytes 1780 - 17bf - 0xA0, 0x94, 0xA5, 0x44, 0xF0, 0xA0, 0x95, 0x8B, - 0x44, 0xF0, 0xA0, 0x98, 0xBA, 0x44, 0xF0, 0xA0, - 0xA0, 0x84, 0x44, 0xF0, 0xA0, 0xA3, 0x9E, 0x44, - 0xF0, 0xA0, 0xA8, 0xAC, 0x44, 0xF0, 0xA0, 0xAD, - 0xA3, 0x44, 0xF0, 0xA1, 0x93, 0xA4, 0x44, 0xF0, - 0xA1, 0x9A, 0xA8, 0x44, 0xF0, 0xA1, 0x9B, 0xAA, - 0x44, 0xF0, 0xA1, 0xA7, 0x88, 0x44, 0xF0, 0xA1, - 0xAC, 0x98, 0x44, 0xF0, 0xA1, 0xB4, 0x8B, 0x44, - // Bytes 17c0 - 17ff - 0xF0, 0xA1, 0xB7, 0xA4, 0x44, 0xF0, 0xA1, 0xB7, - 0xA6, 0x44, 0xF0, 0xA2, 0x86, 0x83, 0x44, 0xF0, - 0xA2, 0x86, 0x9F, 0x44, 0xF0, 0xA2, 0x8C, 0xB1, - 0x44, 0xF0, 0xA2, 0x9B, 0x94, 0x44, 0xF0, 0xA2, - 0xA1, 0x84, 0x44, 0xF0, 0xA2, 0xA1, 0x8A, 0x44, - 0xF0, 0xA2, 0xAC, 0x8C, 0x44, 0xF0, 0xA2, 0xAF, - 0xB1, 0x44, 0xF0, 0xA3, 0x80, 0x8A, 0x44, 0xF0, - 0xA3, 0x8A, 0xB8, 0x44, 0xF0, 0xA3, 0x8D, 0x9F, - // Bytes 1800 - 183f - 0x44, 0xF0, 0xA3, 0x8E, 0x93, 0x44, 0xF0, 0xA3, - 0x8E, 0x9C, 0x44, 0xF0, 0xA3, 0x8F, 0x83, 0x44, - 0xF0, 0xA3, 0x8F, 0x95, 0x44, 0xF0, 0xA3, 0x91, - 0xAD, 0x44, 0xF0, 0xA3, 0x9A, 0xA3, 0x44, 0xF0, - 0xA3, 0xA2, 0xA7, 0x44, 0xF0, 0xA3, 0xAA, 0x8D, - 0x44, 0xF0, 0xA3, 0xAB, 0xBA, 0x44, 0xF0, 0xA3, - 0xB2, 0xBC, 0x44, 0xF0, 0xA3, 0xB4, 0x9E, 0x44, - 0xF0, 0xA3, 0xBB, 0x91, 0x44, 0xF0, 0xA3, 0xBD, - // Bytes 1840 - 187f - 0x9E, 0x44, 0xF0, 0xA3, 0xBE, 0x8E, 0x44, 0xF0, - 0xA4, 0x89, 0xA3, 0x44, 0xF0, 0xA4, 0x8B, 0xAE, - 0x44, 0xF0, 0xA4, 0x8E, 0xAB, 0x44, 0xF0, 0xA4, - 0x98, 0x88, 0x44, 0xF0, 0xA4, 0x9C, 0xB5, 0x44, - 0xF0, 0xA4, 0xA0, 0x94, 0x44, 0xF0, 0xA4, 0xB0, - 0xB6, 0x44, 0xF0, 0xA4, 0xB2, 0x92, 0x44, 0xF0, - 0xA4, 0xBE, 0xA1, 0x44, 0xF0, 0xA4, 0xBE, 0xB8, - 0x44, 0xF0, 0xA5, 0x81, 0x84, 0x44, 0xF0, 0xA5, - // Bytes 1880 - 18bf - 0x83, 0xB2, 0x44, 0xF0, 0xA5, 0x83, 0xB3, 0x44, - 0xF0, 0xA5, 0x84, 0x99, 0x44, 0xF0, 0xA5, 0x84, - 0xB3, 0x44, 0xF0, 0xA5, 0x89, 0x89, 0x44, 0xF0, - 0xA5, 0x90, 0x9D, 0x44, 0xF0, 0xA5, 0x98, 0xA6, - 0x44, 0xF0, 0xA5, 0x9A, 0x9A, 0x44, 0xF0, 0xA5, - 0x9B, 0x85, 0x44, 0xF0, 0xA5, 0xA5, 0xBC, 0x44, - 0xF0, 0xA5, 0xAA, 0xA7, 0x44, 0xF0, 0xA5, 0xAE, - 0xAB, 0x44, 0xF0, 0xA5, 0xB2, 0x80, 0x44, 0xF0, - // Bytes 18c0 - 18ff - 0xA5, 0xB3, 0x90, 0x44, 0xF0, 0xA5, 0xBE, 0x86, - 0x44, 0xF0, 0xA6, 0x87, 0x9A, 0x44, 0xF0, 0xA6, - 0x88, 0xA8, 0x44, 0xF0, 0xA6, 0x89, 0x87, 0x44, - 0xF0, 0xA6, 0x8B, 0x99, 0x44, 0xF0, 0xA6, 0x8C, - 0xBE, 0x44, 0xF0, 0xA6, 0x93, 0x9A, 0x44, 0xF0, - 0xA6, 0x94, 0xA3, 0x44, 0xF0, 0xA6, 0x96, 0xA8, - 0x44, 0xF0, 0xA6, 0x9E, 0xA7, 0x44, 0xF0, 0xA6, - 0x9E, 0xB5, 0x44, 0xF0, 0xA6, 0xAC, 0xBC, 0x44, - // Bytes 1900 - 193f - 0xF0, 0xA6, 0xB0, 0xB6, 0x44, 0xF0, 0xA6, 0xB3, - 0x95, 0x44, 0xF0, 0xA6, 0xB5, 0xAB, 0x44, 0xF0, - 0xA6, 0xBC, 0xAC, 0x44, 0xF0, 0xA6, 0xBE, 0xB1, - 0x44, 0xF0, 0xA7, 0x83, 0x92, 0x44, 0xF0, 0xA7, - 0x8F, 0x8A, 0x44, 0xF0, 0xA7, 0x99, 0xA7, 0x44, - 0xF0, 0xA7, 0xA2, 0xAE, 0x44, 0xF0, 0xA7, 0xA5, - 0xA6, 0x44, 0xF0, 0xA7, 0xB2, 0xA8, 0x44, 0xF0, - 0xA7, 0xBB, 0x93, 0x44, 0xF0, 0xA7, 0xBC, 0xAF, - // Bytes 1940 - 197f - 0x44, 0xF0, 0xA8, 0x97, 0x92, 0x44, 0xF0, 0xA8, - 0x97, 0xAD, 0x44, 0xF0, 0xA8, 0x9C, 0xAE, 0x44, - 0xF0, 0xA8, 0xAF, 0xBA, 0x44, 0xF0, 0xA8, 0xB5, - 0xB7, 0x44, 0xF0, 0xA9, 0x85, 0x85, 0x44, 0xF0, - 0xA9, 0x87, 0x9F, 0x44, 0xF0, 0xA9, 0x88, 0x9A, - 0x44, 0xF0, 0xA9, 0x90, 0x8A, 0x44, 0xF0, 0xA9, - 0x92, 0x96, 0x44, 0xF0, 0xA9, 0x96, 0xB6, 0x44, - 0xF0, 0xA9, 0xAC, 0xB0, 0x44, 0xF0, 0xAA, 0x83, - // Bytes 1980 - 19bf - 0x8E, 0x44, 0xF0, 0xAA, 0x84, 0x85, 0x44, 0xF0, - 0xAA, 0x88, 0x8E, 0x44, 0xF0, 0xAA, 0x8A, 0x91, - 0x44, 0xF0, 0xAA, 0x8E, 0x92, 0x44, 0xF0, 0xAA, - 0x98, 0x80, 0x42, 0x21, 0x21, 0x42, 0x21, 0x3F, - 0x42, 0x2E, 0x2E, 0x42, 0x30, 0x2C, 0x42, 0x30, - 0x2E, 0x42, 0x31, 0x2C, 0x42, 0x31, 0x2E, 0x42, - 0x31, 0x30, 0x42, 0x31, 0x31, 0x42, 0x31, 0x32, - 0x42, 0x31, 0x33, 0x42, 0x31, 0x34, 0x42, 0x31, - // Bytes 19c0 - 19ff - 0x35, 0x42, 0x31, 0x36, 0x42, 0x31, 0x37, 0x42, - 0x31, 0x38, 0x42, 0x31, 0x39, 0x42, 0x32, 0x2C, - 0x42, 0x32, 0x2E, 0x42, 0x32, 0x30, 0x42, 0x32, - 0x31, 0x42, 0x32, 0x32, 0x42, 0x32, 0x33, 0x42, - 0x32, 0x34, 0x42, 0x32, 0x35, 0x42, 0x32, 0x36, - 0x42, 0x32, 0x37, 0x42, 0x32, 0x38, 0x42, 0x32, - 0x39, 0x42, 0x33, 0x2C, 0x42, 0x33, 0x2E, 0x42, - 0x33, 0x30, 0x42, 0x33, 0x31, 0x42, 0x33, 0x32, - // Bytes 1a00 - 1a3f - 0x42, 0x33, 0x33, 0x42, 0x33, 0x34, 0x42, 0x33, - 0x35, 0x42, 0x33, 0x36, 0x42, 0x33, 0x37, 0x42, - 0x33, 0x38, 0x42, 0x33, 0x39, 0x42, 0x34, 0x2C, - 0x42, 0x34, 0x2E, 0x42, 0x34, 0x30, 0x42, 0x34, - 0x31, 0x42, 0x34, 0x32, 0x42, 0x34, 0x33, 0x42, - 0x34, 0x34, 0x42, 0x34, 0x35, 0x42, 0x34, 0x36, - 0x42, 0x34, 0x37, 0x42, 0x34, 0x38, 0x42, 0x34, - 0x39, 0x42, 0x35, 0x2C, 0x42, 0x35, 0x2E, 0x42, - // Bytes 1a40 - 1a7f - 0x35, 0x30, 0x42, 0x36, 0x2C, 0x42, 0x36, 0x2E, - 0x42, 0x37, 0x2C, 0x42, 0x37, 0x2E, 0x42, 0x38, - 0x2C, 0x42, 0x38, 0x2E, 0x42, 0x39, 0x2C, 0x42, - 0x39, 0x2E, 0x42, 0x3D, 0x3D, 0x42, 0x3F, 0x21, - 0x42, 0x3F, 0x3F, 0x42, 0x41, 0x55, 0x42, 0x42, - 0x71, 0x42, 0x43, 0x44, 0x42, 0x44, 0x4A, 0x42, - 0x44, 0x5A, 0x42, 0x44, 0x7A, 0x42, 0x47, 0x42, - 0x42, 0x47, 0x79, 0x42, 0x48, 0x50, 0x42, 0x48, - // Bytes 1a80 - 1abf - 0x56, 0x42, 0x48, 0x67, 0x42, 0x48, 0x7A, 0x42, - 0x49, 0x49, 0x42, 0x49, 0x4A, 0x42, 0x49, 0x55, - 0x42, 0x49, 0x56, 0x42, 0x49, 0x58, 0x42, 0x4B, - 0x42, 0x42, 0x4B, 0x4B, 0x42, 0x4B, 0x4D, 0x42, - 0x4C, 0x4A, 0x42, 0x4C, 0x6A, 0x42, 0x4D, 0x42, - 0x42, 0x4D, 0x43, 0x42, 0x4D, 0x44, 0x42, 0x4D, - 0x52, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42, - 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F, - // Bytes 1ac0 - 1aff - 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50, - 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42, - 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76, - 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57, - 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42, - 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64, - 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64, - 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42, - // Bytes 1b00 - 1b3f - 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66, - 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66, - 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42, - 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76, - 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B, - 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42, - 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74, - 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C, - // Bytes 1b40 - 1b7f - 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42, - 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56, - 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D, - 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42, - 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46, - 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E, - 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42, - 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46, - // Bytes 1b80 - 1bbf - 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70, - 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42, - 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69, - 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29, - 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29, - 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29, - 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29, - 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29, - // Bytes 1bc0 - 1bff - 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29, - 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29, - 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29, - 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29, - 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29, - 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29, - 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29, - 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29, - // Bytes 1c00 - 1c3f - 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29, - 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29, - 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29, - 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29, - 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29, - 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29, - 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29, - 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29, - // Bytes 1c40 - 1c7f - 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29, - 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29, - 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29, - 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29, - 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29, - 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29, - 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29, - 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29, - // Bytes 1c80 - 1cbf - 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29, - 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E, - 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E, - 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E, - 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E, - 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E, - 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E, - 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D, - // Bytes 1cc0 - 1cff - 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E, - 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A, - 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49, - 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7, - 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61, - 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D, - 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45, - 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A, - // Bytes 1d00 - 1d3f - 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49, - 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73, - 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72, - 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75, - 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32, - 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32, - 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67, - 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C, - // Bytes 1d40 - 1d7f - 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61, - 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A, - 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32, - 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9, - 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7, - 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32, - 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C, - 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69, - // Bytes 1d80 - 1dbf - 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43, - 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E, - 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46, - 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57, - 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C, - 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73, - 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31, - 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44, - // Bytes 1dc0 - 1dff - 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34, - 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28, - 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29, - 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31, - 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44, - 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81, - 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31, - 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9, - // Bytes 1e00 - 1e3f - 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6, - 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44, - 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C, - 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34, - 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88, - 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6, - 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44, - 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97, - // Bytes 1e40 - 1e7f - 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36, - 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5, - 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7, - 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44, - 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82, - 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39, - 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9, - 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E, - // Bytes 1e80 - 1ebf - 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44, - 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69, - 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5, - 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB, - 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4, - 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44, - 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9, - 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8, - // Bytes 1ec0 - 1eff - 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE, - 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8, - 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44, - 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9, - 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8, - 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC, - 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA, - 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44, - // Bytes 1f00 - 1f3f - 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9, - 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8, - 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89, - 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB, - 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44, - 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9, - 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8, - 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89, - // Bytes 1f40 - 1f7f - 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC, - 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44, - 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9, - 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8, - 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89, - 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE, - 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44, - 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9, - // Bytes 1f80 - 1fbf - 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8, - 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD, - 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3, - 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44, - 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9, - 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8, - 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD, - 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4, - // Bytes 1fc0 - 1fff - 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44, - 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9, - 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8, - 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE, - 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5, - 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44, - 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8, - 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8, - // Bytes 2000 - 203f - 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1, - 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6, - 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44, - 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9, - 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8, - 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85, - 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9, - 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44, - // Bytes 2040 - 207f - 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8, - 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8, - 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A, - 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81, - 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44, - 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9, - 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9, - 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85, - // Bytes 2080 - 20bf - 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82, - 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44, - 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8, - 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9, - 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85, - 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83, - 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44, - 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8, - // Bytes 20c0 - 20ff - 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9, - 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87, - 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84, - 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44, - 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8, - 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9, - 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89, - 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86, - // Bytes 2100 - 213f - 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44, - 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8, - 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9, - 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86, - 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86, - 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44, - 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9, - 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9, - // Bytes 2140 - 217f - 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4, - 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A, - 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44, - 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8, - 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9, - 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87, - 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A, - 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44, - // Bytes 2180 - 21bf - 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84, - 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29, - 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28, - 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84, - 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29, - 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28, - 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84, - 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29, - // Bytes 21c0 - 21ff - 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28, - 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84, - 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29, - 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28, - 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8, - 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29, - 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28, - 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB, - // Bytes 2200 - 223f - 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29, - 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28, - 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85, - 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29, - 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28, - 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90, - 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29, - 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28, - // Bytes 2240 - 227f - 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD, - 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29, - 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28, - 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C, - 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29, - 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28, - 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89, - 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29, - // Bytes 2280 - 22bf - 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28, - 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5, - 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29, - 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28, - 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3, - 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29, - 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, - 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6, - // Bytes 22c0 - 22ff - 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9, - 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31, - 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7, - 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5, - 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31, - 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6, - 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9, - 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31, - // Bytes 2300 - 233f - 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6, - 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9, - 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31, - 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6, - 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9, - 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31, - 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6, - 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9, - // Bytes 2340 - 237f - 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31, - 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81, - 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35, - 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31, - 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81, - 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39, - 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32, - 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6, - // Bytes 2380 - 23bf - 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9, - 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32, - 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6, - 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9, - 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32, - 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6, - 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5, - 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32, - // Bytes 23c0 - 23ff - 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6, - 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33, - 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, - 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6, - 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34, - 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, - 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81, - 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36, - // Bytes 2400 - 243f - 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37, - 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88, - 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D, - 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31, - 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2, - 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88, - 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD, - 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9, - // Bytes 2440 - 247f - 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85, - 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46, - 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, - 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA, - 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, - 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, - 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9, - 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC, - // Bytes 2480 - 24bf - 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46, - 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8, - 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA, - 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8, - 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD, - 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8, - 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89, - 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46, - // Bytes 24c0 - 24ff - 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, - 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD, - 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8, - 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC, - 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8, - 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89, - 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46, - 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8, - // Bytes 2500 - 253f - 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, - 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, - 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, - 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9, - 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE, - 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46, - 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8, - 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5, - // Bytes 2540 - 257f - 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9, - 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85, - 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, - 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A, - 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46, - 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, - 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7, - 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8, - // Bytes 2580 - 25bf - 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, - 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, - 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A, - 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46, - 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, - 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81, - 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9, - 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84, - // Bytes 25c0 - 25ff - 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8, - 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85, - 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46, - 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, - 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84, - 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8, - 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC, - 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, - // Bytes 2600 - 263f - 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89, - 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, - 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, - 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84, - 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8, - 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC, - 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, - 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A, - // Bytes 2640 - 267f - 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, - 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, - 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85, - 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8, - 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE, - 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9, - 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD, - 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46, - // Bytes 2680 - 26bf - 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9, - 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86, - 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8, - 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD, - 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, - 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A, - 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46, - 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, - // Bytes 26c0 - 26ff - 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, - 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, - 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85, - 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, - 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC, - 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46, - 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9, - 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A, - // Bytes 2700 - 273f - 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9, - 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94, - 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, - 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88, - 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46, - 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9, - 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A, - 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9, - // Bytes 2740 - 277f - 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94, - 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB, - 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2, - 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46, - 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0, - 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD, - 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82, - 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0, - // Bytes 2780 - 27bf - 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE, - 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7, - 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46, - 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, - 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, - 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1, - 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0, - 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE, - // Bytes 27c0 - 27ff - 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, - 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46, - 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2, - 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81, - 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88, - 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3, - 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82, - 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88, - // Bytes 2800 - 283f - 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46, - 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3, - 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83, - 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA, - 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3, - 0x83, 0xA0, 0x46, 0xE4, 0xBB, 0xA4, 0xE5, 0x92, - 0x8C, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, 0xA3, - 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, 0x46, - // Bytes 2840 - 287f - 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, 0xE6, - 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, 0x61, - 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, 0x80, - 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, 0xE1, - 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, - 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, 0x48, - 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x29, - 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, - // Bytes 2880 - 28bf - 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, 0x85, - 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, 0xE1, - 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x89, - 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, - 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, - 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, - 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, 0x48, - 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x29, - // Bytes 28c0 - 28ff - 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, - 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, 0x85, - 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, 0xE1, - 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x92, - 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, 0x64, - 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, 0xA7, - 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, 0xD8, - 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, 0x48, - // Bytes 2900 - 293f - 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, 0x84, - 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, 0xD9, - 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, 0xB9, - 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, 0xD9, - 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, 0xAD, - 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, 0xD8, - 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, 0x80, - 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0x49, - // Bytes 2940 - 297f - 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, 0x80, - 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, - 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, 0xE2, - 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, 0x80, - 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, 0x49, - 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, 0x80, - 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, 0x9D, - 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, - // Bytes 2980 - 29bf - 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, - 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, 0x49, - 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, 0x80, - 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, 0xAC, - 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE7, - 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, - 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, 0x49, - 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, 0x83, - // Bytes 29c0 - 29ff - 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, - 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, 0xE3, - 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x82, - 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, 0x49, - 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, 0x83, - 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0xA4, - 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, 0xE3, - 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, 0x82, - // Bytes 2a00 - 2a3f - 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, 0x49, - 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, - 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, - 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, 0xE3, - 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, 0x83, - 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, - 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, 0x83, - 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0xA4, - // Bytes 2a40 - 2a7f - 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, 0xE3, - 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, - 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, 0x49, - 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, 0x83, - 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, - 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, 0xE3, - 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, - 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, 0x49, - // Bytes 2a80 - 2abf - 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, - 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, - 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, 0xE3, - 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, 0x83, - 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, 0x49, - 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, - 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, 0xA2, - 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, 0xE3, - // Bytes 2ac0 - 2aff - 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, 0x80, - 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, - 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, 0x88, - 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x4C, - 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, 0x83, - 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, 0xA8, - 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, 0x83, - 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, - // Bytes 2b00 - 2b3f - 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, 0xE3, - 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xB3, - 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, - 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, - 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, 0xE3, - 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, - 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, 0xE3, - 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x83, - // Bytes 2b40 - 2b7f - 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, - 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, - 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, 0xAF, - 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, 0x83, - 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0xA4, - 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, - 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, - 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, 0xE3, - // Bytes 2b80 - 2bbf - 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x84, - 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, - 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, - 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, 0xE3, - 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, - 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, 0x4C, - 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, - 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, 0x98, - // Bytes 2bc0 - 2bff - 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, 0x82, - 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, - 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, 0xE3, - 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, 0xAF, - 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, 0xE3, - 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, - 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, 0xE3, - 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, - // Bytes 2c00 - 2c3f - 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, - 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, 0x83, - 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0x4C, - 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, 0xBC, - 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, 0x84, - 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, 0xE1, - 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, 0x84, - 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, - // Bytes 2c40 - 2c7f - 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, - 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, - 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, - 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, - 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, 0xE3, - 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, 0x83, - 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, 0xE3, - 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, 0xBC, - // Bytes 2c80 - 2cbf - 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, 0xE3, - 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAC, - 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, 0xE3, - 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, 0xBC, - 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, 0xE3, - 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, - 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, 0xE3, - 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, 0xA7, - // Bytes 2cc0 - 2cff - 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, 0xE3, - 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x88, - 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, 0xE3, - 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, - 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, 0x8B, - 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, 0x85, - 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, 0x82, - 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0xE3, - // Bytes 2d00 - 2d3f - 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, - 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, 0xE3, - 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, - 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, 0xE3, - 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, - 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, 0xE3, - 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, - 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, 0x83, - // Bytes 2d40 - 2d7f - 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, - 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, 0x82, - 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, 0x8F, - 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x82, - 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, 0x52, - 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, - 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, 0xE3, - 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, 0x82, - // Bytes 2d80 - 2dbf - 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, 0xE3, - 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, - 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, 0xE3, - 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, - 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, 0xE3, - 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, - 0xE3, 0x83, 0xB3, 0x5F, 0xD8, 0xB5, 0xD9, 0x84, - 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, 0xD9, - // Bytes 2dc0 - 2dff - 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, 0x84, - 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, 0xD8, - 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x44, 0x44, 0x5A, - 0xCC, 0x8C, 0xCD, 0x44, 0x44, 0x7A, 0xCC, 0x8C, - 0xCD, 0x44, 0x64, 0x7A, 0xCC, 0x8C, 0xCD, 0x46, - 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x46, - 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, 0xCD, 0x46, - 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, 0xB9, 0x49, - // Bytes 2e00 - 2e3f - 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, 0xE3, 0x82, - 0x99, 0x11, 0x4C, 0xE1, 0x84, 0x8C, 0xE1, 0x85, - 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xB4, 0x01, - 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, 0xE3, - 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11, 0x4C, 0xE3, - 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x9B, - 0xE3, 0x82, 0x9A, 0x11, 0x4C, 0xE3, 0x83, 0xA4, - 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, 0xE3, 0x82, - // Bytes 2e40 - 2e7f - 0x99, 0x11, 0x4F, 0xE1, 0x84, 0x8E, 0xE1, 0x85, - 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, 0x80, 0xE1, - 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, 0xA4, 0xE3, - 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xAF, - 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, 0x82, 0xB7, - 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, - 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, 0x83, - 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, - // Bytes 2e80 - 2ebf - 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, - 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, - 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x11, 0x52, - 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, 0xE3, 0x82, - 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, 0xE3, - 0x82, 0x99, 0x11, 0x52, 0xE3, 0x83, 0x95, 0xE3, - 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, 0x83, 0x83, - 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x11, 0x03, - // Bytes 2ec0 - 2eff - 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, 0xCC, 0xB8, - 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, 0x03, 0x41, - 0xCC, 0x80, 0xCD, 0x03, 0x41, 0xCC, 0x81, 0xCD, - 0x03, 0x41, 0xCC, 0x83, 0xCD, 0x03, 0x41, 0xCC, - 0x84, 0xCD, 0x03, 0x41, 0xCC, 0x89, 0xCD, 0x03, - 0x41, 0xCC, 0x8C, 0xCD, 0x03, 0x41, 0xCC, 0x8F, - 0xCD, 0x03, 0x41, 0xCC, 0x91, 0xCD, 0x03, 0x41, - 0xCC, 0xA5, 0xB9, 0x03, 0x41, 0xCC, 0xA8, 0xA9, - // Bytes 2f00 - 2f3f - 0x03, 0x42, 0xCC, 0x87, 0xCD, 0x03, 0x42, 0xCC, - 0xA3, 0xB9, 0x03, 0x42, 0xCC, 0xB1, 0xB9, 0x03, - 0x43, 0xCC, 0x81, 0xCD, 0x03, 0x43, 0xCC, 0x82, - 0xCD, 0x03, 0x43, 0xCC, 0x87, 0xCD, 0x03, 0x43, - 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC, 0x87, 0xCD, - 0x03, 0x44, 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC, - 0xA3, 0xB9, 0x03, 0x44, 0xCC, 0xA7, 0xA9, 0x03, - 0x44, 0xCC, 0xAD, 0xB9, 0x03, 0x44, 0xCC, 0xB1, - // Bytes 2f40 - 2f7f - 0xB9, 0x03, 0x45, 0xCC, 0x80, 0xCD, 0x03, 0x45, - 0xCC, 0x81, 0xCD, 0x03, 0x45, 0xCC, 0x83, 0xCD, - 0x03, 0x45, 0xCC, 0x86, 0xCD, 0x03, 0x45, 0xCC, - 0x87, 0xCD, 0x03, 0x45, 0xCC, 0x88, 0xCD, 0x03, - 0x45, 0xCC, 0x89, 0xCD, 0x03, 0x45, 0xCC, 0x8C, - 0xCD, 0x03, 0x45, 0xCC, 0x8F, 0xCD, 0x03, 0x45, - 0xCC, 0x91, 0xCD, 0x03, 0x45, 0xCC, 0xA8, 0xA9, - 0x03, 0x45, 0xCC, 0xAD, 0xB9, 0x03, 0x45, 0xCC, - // Bytes 2f80 - 2fbf - 0xB0, 0xB9, 0x03, 0x46, 0xCC, 0x87, 0xCD, 0x03, - 0x47, 0xCC, 0x81, 0xCD, 0x03, 0x47, 0xCC, 0x82, - 0xCD, 0x03, 0x47, 0xCC, 0x84, 0xCD, 0x03, 0x47, - 0xCC, 0x86, 0xCD, 0x03, 0x47, 0xCC, 0x87, 0xCD, - 0x03, 0x47, 0xCC, 0x8C, 0xCD, 0x03, 0x47, 0xCC, - 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0x82, 0xCD, 0x03, - 0x48, 0xCC, 0x87, 0xCD, 0x03, 0x48, 0xCC, 0x88, - 0xCD, 0x03, 0x48, 0xCC, 0x8C, 0xCD, 0x03, 0x48, - // Bytes 2fc0 - 2fff - 0xCC, 0xA3, 0xB9, 0x03, 0x48, 0xCC, 0xA7, 0xA9, - 0x03, 0x48, 0xCC, 0xAE, 0xB9, 0x03, 0x49, 0xCC, - 0x80, 0xCD, 0x03, 0x49, 0xCC, 0x81, 0xCD, 0x03, - 0x49, 0xCC, 0x82, 0xCD, 0x03, 0x49, 0xCC, 0x83, - 0xCD, 0x03, 0x49, 0xCC, 0x84, 0xCD, 0x03, 0x49, - 0xCC, 0x86, 0xCD, 0x03, 0x49, 0xCC, 0x87, 0xCD, - 0x03, 0x49, 0xCC, 0x89, 0xCD, 0x03, 0x49, 0xCC, - 0x8C, 0xCD, 0x03, 0x49, 0xCC, 0x8F, 0xCD, 0x03, - // Bytes 3000 - 303f - 0x49, 0xCC, 0x91, 0xCD, 0x03, 0x49, 0xCC, 0xA3, - 0xB9, 0x03, 0x49, 0xCC, 0xA8, 0xA9, 0x03, 0x49, - 0xCC, 0xB0, 0xB9, 0x03, 0x4A, 0xCC, 0x82, 0xCD, - 0x03, 0x4B, 0xCC, 0x81, 0xCD, 0x03, 0x4B, 0xCC, - 0x8C, 0xCD, 0x03, 0x4B, 0xCC, 0xA3, 0xB9, 0x03, - 0x4B, 0xCC, 0xA7, 0xA9, 0x03, 0x4B, 0xCC, 0xB1, - 0xB9, 0x03, 0x4C, 0xCC, 0x81, 0xCD, 0x03, 0x4C, - 0xCC, 0x8C, 0xCD, 0x03, 0x4C, 0xCC, 0xA7, 0xA9, - // Bytes 3040 - 307f - 0x03, 0x4C, 0xCC, 0xAD, 0xB9, 0x03, 0x4C, 0xCC, - 0xB1, 0xB9, 0x03, 0x4D, 0xCC, 0x81, 0xCD, 0x03, - 0x4D, 0xCC, 0x87, 0xCD, 0x03, 0x4D, 0xCC, 0xA3, - 0xB9, 0x03, 0x4E, 0xCC, 0x80, 0xCD, 0x03, 0x4E, - 0xCC, 0x81, 0xCD, 0x03, 0x4E, 0xCC, 0x83, 0xCD, - 0x03, 0x4E, 0xCC, 0x87, 0xCD, 0x03, 0x4E, 0xCC, - 0x8C, 0xCD, 0x03, 0x4E, 0xCC, 0xA3, 0xB9, 0x03, - 0x4E, 0xCC, 0xA7, 0xA9, 0x03, 0x4E, 0xCC, 0xAD, - // Bytes 3080 - 30bf - 0xB9, 0x03, 0x4E, 0xCC, 0xB1, 0xB9, 0x03, 0x4F, - 0xCC, 0x80, 0xCD, 0x03, 0x4F, 0xCC, 0x81, 0xCD, - 0x03, 0x4F, 0xCC, 0x86, 0xCD, 0x03, 0x4F, 0xCC, - 0x89, 0xCD, 0x03, 0x4F, 0xCC, 0x8B, 0xCD, 0x03, - 0x4F, 0xCC, 0x8C, 0xCD, 0x03, 0x4F, 0xCC, 0x8F, - 0xCD, 0x03, 0x4F, 0xCC, 0x91, 0xCD, 0x03, 0x50, - 0xCC, 0x81, 0xCD, 0x03, 0x50, 0xCC, 0x87, 0xCD, - 0x03, 0x52, 0xCC, 0x81, 0xCD, 0x03, 0x52, 0xCC, - // Bytes 30c0 - 30ff - 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x8C, 0xCD, 0x03, - 0x52, 0xCC, 0x8F, 0xCD, 0x03, 0x52, 0xCC, 0x91, - 0xCD, 0x03, 0x52, 0xCC, 0xA7, 0xA9, 0x03, 0x52, - 0xCC, 0xB1, 0xB9, 0x03, 0x53, 0xCC, 0x82, 0xCD, - 0x03, 0x53, 0xCC, 0x87, 0xCD, 0x03, 0x53, 0xCC, - 0xA6, 0xB9, 0x03, 0x53, 0xCC, 0xA7, 0xA9, 0x03, - 0x54, 0xCC, 0x87, 0xCD, 0x03, 0x54, 0xCC, 0x8C, - 0xCD, 0x03, 0x54, 0xCC, 0xA3, 0xB9, 0x03, 0x54, - // Bytes 3100 - 313f - 0xCC, 0xA6, 0xB9, 0x03, 0x54, 0xCC, 0xA7, 0xA9, - 0x03, 0x54, 0xCC, 0xAD, 0xB9, 0x03, 0x54, 0xCC, - 0xB1, 0xB9, 0x03, 0x55, 0xCC, 0x80, 0xCD, 0x03, - 0x55, 0xCC, 0x81, 0xCD, 0x03, 0x55, 0xCC, 0x82, - 0xCD, 0x03, 0x55, 0xCC, 0x86, 0xCD, 0x03, 0x55, - 0xCC, 0x89, 0xCD, 0x03, 0x55, 0xCC, 0x8A, 0xCD, - 0x03, 0x55, 0xCC, 0x8B, 0xCD, 0x03, 0x55, 0xCC, - 0x8C, 0xCD, 0x03, 0x55, 0xCC, 0x8F, 0xCD, 0x03, - // Bytes 3140 - 317f - 0x55, 0xCC, 0x91, 0xCD, 0x03, 0x55, 0xCC, 0xA3, - 0xB9, 0x03, 0x55, 0xCC, 0xA4, 0xB9, 0x03, 0x55, - 0xCC, 0xA8, 0xA9, 0x03, 0x55, 0xCC, 0xAD, 0xB9, - 0x03, 0x55, 0xCC, 0xB0, 0xB9, 0x03, 0x56, 0xCC, - 0x83, 0xCD, 0x03, 0x56, 0xCC, 0xA3, 0xB9, 0x03, - 0x57, 0xCC, 0x80, 0xCD, 0x03, 0x57, 0xCC, 0x81, - 0xCD, 0x03, 0x57, 0xCC, 0x82, 0xCD, 0x03, 0x57, - 0xCC, 0x87, 0xCD, 0x03, 0x57, 0xCC, 0x88, 0xCD, - // Bytes 3180 - 31bf - 0x03, 0x57, 0xCC, 0xA3, 0xB9, 0x03, 0x58, 0xCC, - 0x87, 0xCD, 0x03, 0x58, 0xCC, 0x88, 0xCD, 0x03, - 0x59, 0xCC, 0x80, 0xCD, 0x03, 0x59, 0xCC, 0x81, - 0xCD, 0x03, 0x59, 0xCC, 0x82, 0xCD, 0x03, 0x59, - 0xCC, 0x83, 0xCD, 0x03, 0x59, 0xCC, 0x84, 0xCD, - 0x03, 0x59, 0xCC, 0x87, 0xCD, 0x03, 0x59, 0xCC, - 0x88, 0xCD, 0x03, 0x59, 0xCC, 0x89, 0xCD, 0x03, - 0x59, 0xCC, 0xA3, 0xB9, 0x03, 0x5A, 0xCC, 0x81, - // Bytes 31c0 - 31ff - 0xCD, 0x03, 0x5A, 0xCC, 0x82, 0xCD, 0x03, 0x5A, - 0xCC, 0x87, 0xCD, 0x03, 0x5A, 0xCC, 0x8C, 0xCD, - 0x03, 0x5A, 0xCC, 0xA3, 0xB9, 0x03, 0x5A, 0xCC, - 0xB1, 0xB9, 0x03, 0x61, 0xCC, 0x80, 0xCD, 0x03, - 0x61, 0xCC, 0x81, 0xCD, 0x03, 0x61, 0xCC, 0x83, - 0xCD, 0x03, 0x61, 0xCC, 0x84, 0xCD, 0x03, 0x61, - 0xCC, 0x89, 0xCD, 0x03, 0x61, 0xCC, 0x8C, 0xCD, - 0x03, 0x61, 0xCC, 0x8F, 0xCD, 0x03, 0x61, 0xCC, - // Bytes 3200 - 323f - 0x91, 0xCD, 0x03, 0x61, 0xCC, 0xA5, 0xB9, 0x03, - 0x61, 0xCC, 0xA8, 0xA9, 0x03, 0x62, 0xCC, 0x87, - 0xCD, 0x03, 0x62, 0xCC, 0xA3, 0xB9, 0x03, 0x62, - 0xCC, 0xB1, 0xB9, 0x03, 0x63, 0xCC, 0x81, 0xCD, - 0x03, 0x63, 0xCC, 0x82, 0xCD, 0x03, 0x63, 0xCC, - 0x87, 0xCD, 0x03, 0x63, 0xCC, 0x8C, 0xCD, 0x03, - 0x64, 0xCC, 0x87, 0xCD, 0x03, 0x64, 0xCC, 0x8C, - 0xCD, 0x03, 0x64, 0xCC, 0xA3, 0xB9, 0x03, 0x64, - // Bytes 3240 - 327f - 0xCC, 0xA7, 0xA9, 0x03, 0x64, 0xCC, 0xAD, 0xB9, - 0x03, 0x64, 0xCC, 0xB1, 0xB9, 0x03, 0x65, 0xCC, - 0x80, 0xCD, 0x03, 0x65, 0xCC, 0x81, 0xCD, 0x03, - 0x65, 0xCC, 0x83, 0xCD, 0x03, 0x65, 0xCC, 0x86, - 0xCD, 0x03, 0x65, 0xCC, 0x87, 0xCD, 0x03, 0x65, - 0xCC, 0x88, 0xCD, 0x03, 0x65, 0xCC, 0x89, 0xCD, - 0x03, 0x65, 0xCC, 0x8C, 0xCD, 0x03, 0x65, 0xCC, - 0x8F, 0xCD, 0x03, 0x65, 0xCC, 0x91, 0xCD, 0x03, - // Bytes 3280 - 32bf - 0x65, 0xCC, 0xA8, 0xA9, 0x03, 0x65, 0xCC, 0xAD, - 0xB9, 0x03, 0x65, 0xCC, 0xB0, 0xB9, 0x03, 0x66, - 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC, 0x81, 0xCD, - 0x03, 0x67, 0xCC, 0x82, 0xCD, 0x03, 0x67, 0xCC, - 0x84, 0xCD, 0x03, 0x67, 0xCC, 0x86, 0xCD, 0x03, - 0x67, 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC, 0x8C, - 0xCD, 0x03, 0x67, 0xCC, 0xA7, 0xA9, 0x03, 0x68, - 0xCC, 0x82, 0xCD, 0x03, 0x68, 0xCC, 0x87, 0xCD, - // Bytes 32c0 - 32ff - 0x03, 0x68, 0xCC, 0x88, 0xCD, 0x03, 0x68, 0xCC, - 0x8C, 0xCD, 0x03, 0x68, 0xCC, 0xA3, 0xB9, 0x03, - 0x68, 0xCC, 0xA7, 0xA9, 0x03, 0x68, 0xCC, 0xAE, - 0xB9, 0x03, 0x68, 0xCC, 0xB1, 0xB9, 0x03, 0x69, - 0xCC, 0x80, 0xCD, 0x03, 0x69, 0xCC, 0x81, 0xCD, - 0x03, 0x69, 0xCC, 0x82, 0xCD, 0x03, 0x69, 0xCC, - 0x83, 0xCD, 0x03, 0x69, 0xCC, 0x84, 0xCD, 0x03, - 0x69, 0xCC, 0x86, 0xCD, 0x03, 0x69, 0xCC, 0x89, - // Bytes 3300 - 333f - 0xCD, 0x03, 0x69, 0xCC, 0x8C, 0xCD, 0x03, 0x69, - 0xCC, 0x8F, 0xCD, 0x03, 0x69, 0xCC, 0x91, 0xCD, - 0x03, 0x69, 0xCC, 0xA3, 0xB9, 0x03, 0x69, 0xCC, - 0xA8, 0xA9, 0x03, 0x69, 0xCC, 0xB0, 0xB9, 0x03, - 0x6A, 0xCC, 0x82, 0xCD, 0x03, 0x6A, 0xCC, 0x8C, - 0xCD, 0x03, 0x6B, 0xCC, 0x81, 0xCD, 0x03, 0x6B, - 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, 0xA3, 0xB9, - 0x03, 0x6B, 0xCC, 0xA7, 0xA9, 0x03, 0x6B, 0xCC, - // Bytes 3340 - 337f - 0xB1, 0xB9, 0x03, 0x6C, 0xCC, 0x81, 0xCD, 0x03, - 0x6C, 0xCC, 0x8C, 0xCD, 0x03, 0x6C, 0xCC, 0xA7, - 0xA9, 0x03, 0x6C, 0xCC, 0xAD, 0xB9, 0x03, 0x6C, - 0xCC, 0xB1, 0xB9, 0x03, 0x6D, 0xCC, 0x81, 0xCD, - 0x03, 0x6D, 0xCC, 0x87, 0xCD, 0x03, 0x6D, 0xCC, - 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0x80, 0xCD, 0x03, - 0x6E, 0xCC, 0x81, 0xCD, 0x03, 0x6E, 0xCC, 0x83, - 0xCD, 0x03, 0x6E, 0xCC, 0x87, 0xCD, 0x03, 0x6E, - // Bytes 3380 - 33bf - 0xCC, 0x8C, 0xCD, 0x03, 0x6E, 0xCC, 0xA3, 0xB9, - 0x03, 0x6E, 0xCC, 0xA7, 0xA9, 0x03, 0x6E, 0xCC, - 0xAD, 0xB9, 0x03, 0x6E, 0xCC, 0xB1, 0xB9, 0x03, - 0x6F, 0xCC, 0x80, 0xCD, 0x03, 0x6F, 0xCC, 0x81, - 0xCD, 0x03, 0x6F, 0xCC, 0x86, 0xCD, 0x03, 0x6F, - 0xCC, 0x89, 0xCD, 0x03, 0x6F, 0xCC, 0x8B, 0xCD, - 0x03, 0x6F, 0xCC, 0x8C, 0xCD, 0x03, 0x6F, 0xCC, - 0x8F, 0xCD, 0x03, 0x6F, 0xCC, 0x91, 0xCD, 0x03, - // Bytes 33c0 - 33ff - 0x70, 0xCC, 0x81, 0xCD, 0x03, 0x70, 0xCC, 0x87, - 0xCD, 0x03, 0x72, 0xCC, 0x81, 0xCD, 0x03, 0x72, - 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, 0x8C, 0xCD, - 0x03, 0x72, 0xCC, 0x8F, 0xCD, 0x03, 0x72, 0xCC, - 0x91, 0xCD, 0x03, 0x72, 0xCC, 0xA7, 0xA9, 0x03, - 0x72, 0xCC, 0xB1, 0xB9, 0x03, 0x73, 0xCC, 0x82, - 0xCD, 0x03, 0x73, 0xCC, 0x87, 0xCD, 0x03, 0x73, - 0xCC, 0xA6, 0xB9, 0x03, 0x73, 0xCC, 0xA7, 0xA9, - // Bytes 3400 - 343f - 0x03, 0x74, 0xCC, 0x87, 0xCD, 0x03, 0x74, 0xCC, - 0x88, 0xCD, 0x03, 0x74, 0xCC, 0x8C, 0xCD, 0x03, - 0x74, 0xCC, 0xA3, 0xB9, 0x03, 0x74, 0xCC, 0xA6, - 0xB9, 0x03, 0x74, 0xCC, 0xA7, 0xA9, 0x03, 0x74, - 0xCC, 0xAD, 0xB9, 0x03, 0x74, 0xCC, 0xB1, 0xB9, - 0x03, 0x75, 0xCC, 0x80, 0xCD, 0x03, 0x75, 0xCC, - 0x81, 0xCD, 0x03, 0x75, 0xCC, 0x82, 0xCD, 0x03, - 0x75, 0xCC, 0x86, 0xCD, 0x03, 0x75, 0xCC, 0x89, - // Bytes 3440 - 347f - 0xCD, 0x03, 0x75, 0xCC, 0x8A, 0xCD, 0x03, 0x75, - 0xCC, 0x8B, 0xCD, 0x03, 0x75, 0xCC, 0x8C, 0xCD, - 0x03, 0x75, 0xCC, 0x8F, 0xCD, 0x03, 0x75, 0xCC, - 0x91, 0xCD, 0x03, 0x75, 0xCC, 0xA3, 0xB9, 0x03, - 0x75, 0xCC, 0xA4, 0xB9, 0x03, 0x75, 0xCC, 0xA8, - 0xA9, 0x03, 0x75, 0xCC, 0xAD, 0xB9, 0x03, 0x75, - 0xCC, 0xB0, 0xB9, 0x03, 0x76, 0xCC, 0x83, 0xCD, - 0x03, 0x76, 0xCC, 0xA3, 0xB9, 0x03, 0x77, 0xCC, - // Bytes 3480 - 34bf - 0x80, 0xCD, 0x03, 0x77, 0xCC, 0x81, 0xCD, 0x03, - 0x77, 0xCC, 0x82, 0xCD, 0x03, 0x77, 0xCC, 0x87, - 0xCD, 0x03, 0x77, 0xCC, 0x88, 0xCD, 0x03, 0x77, - 0xCC, 0x8A, 0xCD, 0x03, 0x77, 0xCC, 0xA3, 0xB9, - 0x03, 0x78, 0xCC, 0x87, 0xCD, 0x03, 0x78, 0xCC, - 0x88, 0xCD, 0x03, 0x79, 0xCC, 0x80, 0xCD, 0x03, - 0x79, 0xCC, 0x81, 0xCD, 0x03, 0x79, 0xCC, 0x82, - 0xCD, 0x03, 0x79, 0xCC, 0x83, 0xCD, 0x03, 0x79, - // Bytes 34c0 - 34ff - 0xCC, 0x84, 0xCD, 0x03, 0x79, 0xCC, 0x87, 0xCD, - 0x03, 0x79, 0xCC, 0x88, 0xCD, 0x03, 0x79, 0xCC, - 0x89, 0xCD, 0x03, 0x79, 0xCC, 0x8A, 0xCD, 0x03, - 0x79, 0xCC, 0xA3, 0xB9, 0x03, 0x7A, 0xCC, 0x81, - 0xCD, 0x03, 0x7A, 0xCC, 0x82, 0xCD, 0x03, 0x7A, - 0xCC, 0x87, 0xCD, 0x03, 0x7A, 0xCC, 0x8C, 0xCD, - 0x03, 0x7A, 0xCC, 0xA3, 0xB9, 0x03, 0x7A, 0xCC, - 0xB1, 0xB9, 0x04, 0xC2, 0xA8, 0xCC, 0x80, 0xCE, - // Bytes 3500 - 353f - 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x04, 0xC2, - 0xA8, 0xCD, 0x82, 0xCE, 0x04, 0xC3, 0x86, 0xCC, - 0x81, 0xCD, 0x04, 0xC3, 0x86, 0xCC, 0x84, 0xCD, - 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xCD, 0x04, 0xC3, - 0xA6, 0xCC, 0x81, 0xCD, 0x04, 0xC3, 0xA6, 0xCC, - 0x84, 0xCD, 0x04, 0xC3, 0xB8, 0xCC, 0x81, 0xCD, - 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xCD, 0x04, 0xC6, - 0xB7, 0xCC, 0x8C, 0xCD, 0x04, 0xCA, 0x92, 0xCC, - // Bytes 3540 - 357f - 0x8C, 0xCD, 0x04, 0xCE, 0x91, 0xCC, 0x80, 0xCD, - 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xCD, 0x04, 0xCE, - 0x91, 0xCC, 0x84, 0xCD, 0x04, 0xCE, 0x91, 0xCC, - 0x86, 0xCD, 0x04, 0xCE, 0x91, 0xCD, 0x85, 0xDD, - 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xCD, 0x04, 0xCE, - 0x95, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0x97, 0xCC, - 0x80, 0xCD, 0x04, 0xCE, 0x97, 0xCC, 0x81, 0xCD, - 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xDD, 0x04, 0xCE, - // Bytes 3580 - 35bf - 0x99, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x99, 0xCC, - 0x81, 0xCD, 0x04, 0xCE, 0x99, 0xCC, 0x84, 0xCD, - 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xCD, 0x04, 0xCE, - 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xCE, 0x9F, 0xCC, - 0x80, 0xCD, 0x04, 0xCE, 0x9F, 0xCC, 0x81, 0xCD, - 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xCD, 0x04, 0xCE, - 0xA5, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, - 0x81, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, 0x84, 0xCD, - // Bytes 35c0 - 35ff - 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xCD, 0x04, 0xCE, - 0xA5, 0xCC, 0x88, 0xCD, 0x04, 0xCE, 0xA9, 0xCC, - 0x80, 0xCD, 0x04, 0xCE, 0xA9, 0xCC, 0x81, 0xCD, - 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xDD, 0x04, 0xCE, - 0xB1, 0xCC, 0x84, 0xCD, 0x04, 0xCE, 0xB1, 0xCC, - 0x86, 0xCD, 0x04, 0xCE, 0xB1, 0xCD, 0x85, 0xDD, - 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xCD, 0x04, 0xCE, - 0xB5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0xB7, 0xCD, - // Bytes 3600 - 363f - 0x85, 0xDD, 0x04, 0xCE, 0xB9, 0xCC, 0x80, 0xCD, - 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x04, 0xCE, - 0xB9, 0xCC, 0x84, 0xCD, 0x04, 0xCE, 0xB9, 0xCC, - 0x86, 0xCD, 0x04, 0xCE, 0xB9, 0xCD, 0x82, 0xCD, - 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xCD, 0x04, 0xCE, - 0xBF, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x81, 0xCC, - 0x93, 0xCD, 0x04, 0xCF, 0x81, 0xCC, 0x94, 0xCD, - 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xCD, 0x04, 0xCF, - // Bytes 3640 - 367f - 0x85, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x85, 0xCC, - 0x84, 0xCD, 0x04, 0xCF, 0x85, 0xCC, 0x86, 0xCD, - 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xCD, 0x04, 0xCF, - 0x89, 0xCD, 0x85, 0xDD, 0x04, 0xCF, 0x92, 0xCC, - 0x81, 0xCD, 0x04, 0xCF, 0x92, 0xCC, 0x88, 0xCD, - 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xCD, 0x04, 0xD0, - 0x90, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0x90, 0xCC, - 0x88, 0xCD, 0x04, 0xD0, 0x93, 0xCC, 0x81, 0xCD, - // Bytes 3680 - 36bf - 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xCD, 0x04, 0xD0, - 0x95, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0x95, 0xCC, - 0x88, 0xCD, 0x04, 0xD0, 0x96, 0xCC, 0x86, 0xCD, - 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD0, - 0x97, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x98, 0xCC, - 0x80, 0xCD, 0x04, 0xD0, 0x98, 0xCC, 0x84, 0xCD, - 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xCD, 0x04, 0xD0, - 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x9A, 0xCC, - // Bytes 36c0 - 36ff - 0x81, 0xCD, 0x04, 0xD0, 0x9E, 0xCC, 0x88, 0xCD, - 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xCD, 0x04, 0xD0, - 0xA3, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, - 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, 0x8B, 0xCD, - 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xCD, 0x04, 0xD0, - 0xAB, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xAD, 0xCC, - 0x88, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, 0x86, 0xCD, - 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xCD, 0x04, 0xD0, - // Bytes 3700 - 373f - 0xB3, 0xCC, 0x81, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, - 0x80, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, 0x86, 0xCD, - 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xCD, 0x04, 0xD0, - 0xB6, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xB6, 0xCC, - 0x88, 0xCD, 0x04, 0xD0, 0xB7, 0xCC, 0x88, 0xCD, - 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xCD, 0x04, 0xD0, - 0xB8, 0xCC, 0x84, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, - 0x86, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, 0x88, 0xCD, - // Bytes 3740 - 377f - 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xCD, 0x04, 0xD0, - 0xBE, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0x83, 0xCC, - 0x84, 0xCD, 0x04, 0xD1, 0x83, 0xCC, 0x86, 0xCD, - 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xCD, 0x04, 0xD1, - 0x83, 0xCC, 0x8B, 0xCD, 0x04, 0xD1, 0x87, 0xCC, - 0x88, 0xCD, 0x04, 0xD1, 0x8B, 0xCC, 0x88, 0xCD, - 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xCD, 0x04, 0xD1, - 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0xB4, 0xCC, - // Bytes 3780 - 37bf - 0x8F, 0xCD, 0x04, 0xD1, 0xB5, 0xCC, 0x8F, 0xCD, - 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD3, - 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xD3, 0xA8, 0xCC, - 0x88, 0xCD, 0x04, 0xD3, 0xA9, 0xCC, 0x88, 0xCD, - 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x04, 0xD8, - 0xA7, 0xD9, 0x94, 0xCD, 0x04, 0xD8, 0xA7, 0xD9, - 0x95, 0xB9, 0x04, 0xD9, 0x88, 0xD9, 0x94, 0xCD, - 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xCD, 0x04, 0xDB, - // Bytes 37c0 - 37ff - 0x81, 0xD9, 0x94, 0xCD, 0x04, 0xDB, 0x92, 0xD9, - 0x94, 0xCD, 0x04, 0xDB, 0x95, 0xD9, 0x94, 0xCD, - 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, 0xCE, 0x05, - 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, 0x41, - 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x41, 0xCC, - 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x41, 0xCC, 0x86, - 0xCC, 0x80, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, - 0x81, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, 0x83, - // Bytes 3800 - 383f - 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, 0x89, 0xCE, - 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, - 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x41, - 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x41, 0xCC, - 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x41, 0xCC, 0xA3, - 0xCC, 0x86, 0xCE, 0x05, 0x43, 0xCC, 0xA7, 0xCC, - 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x80, - 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x81, 0xCE, - // Bytes 3840 - 387f - 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, - 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x45, - 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x45, 0xCC, - 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x45, 0xCC, 0xA3, - 0xCC, 0x82, 0xCE, 0x05, 0x45, 0xCC, 0xA7, 0xCC, - 0x86, 0xCE, 0x05, 0x49, 0xCC, 0x88, 0xCC, 0x81, - 0xCE, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, - 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, 0xCE, 0x05, - // Bytes 3880 - 38bf - 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, 0x4F, - 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x4F, 0xCC, - 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x4F, 0xCC, 0x83, - 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, 0x83, 0xCC, - 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x83, 0xCC, 0x88, - 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x80, 0xCE, - 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, - 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, 0x4F, - // Bytes 38c0 - 38ff - 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x4F, 0xCC, - 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, - 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, - 0x83, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, 0x89, - 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, - 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, - 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05, 0x52, - 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x53, 0xCC, - // Bytes 3900 - 393f - 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC, 0x8C, - 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC, 0xA3, 0xCC, - 0x87, 0xCE, 0x05, 0x55, 0xCC, 0x83, 0xCC, 0x81, - 0xCE, 0x05, 0x55, 0xCC, 0x84, 0xCC, 0x88, 0xCE, - 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, 0xCE, 0x05, - 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05, 0x55, - 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x55, 0xCC, - 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x55, 0xCC, 0x9B, - // Bytes 3940 - 397f - 0xCC, 0x80, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, - 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0x83, - 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0x89, 0xCE, - 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, 0x05, - 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCE, 0x05, 0x61, - 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, - 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x61, 0xCC, 0x82, - 0xCC, 0x89, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, - // Bytes 3980 - 39bf - 0x80, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x81, - 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x83, 0xCE, - 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, 0xCE, 0x05, - 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, 0x61, - 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x61, 0xCC, - 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, 0xA3, - 0xCC, 0x82, 0xCE, 0x05, 0x61, 0xCC, 0xA3, 0xCC, - 0x86, 0xCE, 0x05, 0x63, 0xCC, 0xA7, 0xCC, 0x81, - // Bytes 39c0 - 39ff - 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x80, 0xCE, - 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, - 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x65, - 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x65, 0xCC, - 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x65, 0xCC, 0x84, - 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, 0xA3, 0xCC, - 0x82, 0xCE, 0x05, 0x65, 0xCC, 0xA7, 0xCC, 0x86, - 0xCE, 0x05, 0x69, 0xCC, 0x88, 0xCC, 0x81, 0xCE, - // Bytes 3a00 - 3a3f - 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, - 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCE, 0x05, 0x6F, - 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, - 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x6F, 0xCC, 0x82, - 0xCC, 0x89, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, - 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, 0x84, - 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, 0x88, 0xCE, - 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, - // Bytes 3a40 - 3a7f - 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x6F, - 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, - 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, - 0xCC, 0x80, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, - 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0x83, - 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0x89, 0xCE, - 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, 0x05, - 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x6F, - // Bytes 3a80 - 3abf - 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05, 0x72, 0xCC, - 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x73, 0xCC, 0x81, - 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, 0x8C, 0xCC, - 0x87, 0xCE, 0x05, 0x73, 0xCC, 0xA3, 0xCC, 0x87, - 0xCE, 0x05, 0x75, 0xCC, 0x83, 0xCC, 0x81, 0xCE, - 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, 0xCE, 0x05, - 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCE, 0x05, 0x75, - 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05, 0x75, 0xCC, - // Bytes 3ac0 - 3aff - 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x75, 0xCC, 0x88, - 0xCC, 0x8C, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, - 0x80, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x81, - 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x83, 0xCE, - 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, 0xCE, 0x05, - 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, 0x05, 0xE1, - 0xBE, 0xBF, 0xCC, 0x80, 0xCE, 0x05, 0xE1, 0xBE, - 0xBF, 0xCC, 0x81, 0xCE, 0x05, 0xE1, 0xBE, 0xBF, - // Bytes 3b00 - 3b3f - 0xCD, 0x82, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCC, - 0x80, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCC, 0x81, - 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, 0x82, 0xCE, - 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, 0x05, 0x05, - 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, - 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, - 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, 0x92, - 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, 0x94, 0xCC, - // Bytes 3b40 - 3b7f - 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, 0xCC, 0xB8, - 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, 0xB8, 0x05, - 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, 0x05, 0x05, - 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, - 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, - 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x83, - 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x85, 0xCC, - 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, 0xCC, 0xB8, - // Bytes 3b80 - 3bbf - 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, 0xB8, 0x05, - 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, 0x05, 0x05, - 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, 0x05, 0xE2, - 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, - 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB3, - 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB6, 0xCC, - 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, 0xCC, 0xB8, - 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, 0xB8, 0x05, - // Bytes 3bc0 - 3bff - 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, 0x05, 0x05, - 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, - 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, - 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x83, - 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x86, 0xCC, - 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, 0xCC, 0xB8, - 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, 0xB8, 0x05, - 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, 0x05, 0x05, - // Bytes 3c00 - 3c3f - 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, - 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, - 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xAB, - 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB2, 0xCC, - 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, 0xCC, 0xB8, - 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, 0xB8, 0x05, - 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, 0x05, 0x06, - 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - // Bytes 3c40 - 3c7f - 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - // Bytes 3c80 - 3cbf - 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - // Bytes 3cc0 - 3cff - 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, 0xDE, 0x06, - // Bytes 3d00 - 3d3f - 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, 0xDE, 0x06, - // Bytes 3d40 - 3d7f - 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, 0xDE, 0x06, - 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - // Bytes 3d80 - 3dbf - 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x06, - 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - // Bytes 3dc0 - 3dff - 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x06, - // Bytes 3e00 - 3e3f - 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x06, - 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x06, - 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, 0xDE, 0x06, - 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, 0xDE, 0x06, - 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, 0xDE, 0x06, - 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, 0xDE, 0x06, - 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, 0xDE, 0x06, - 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, 0x0D, 0x06, - // Bytes 3e40 - 3e7f - 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, 0x0D, 0x06, - 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, 0x0D, 0x06, - 0xE0, 0xA7, 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, - 0xE0, 0xA7, 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, - 0xE0, 0xAD, 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, - 0xE0, 0xAD, 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, - 0xE0, 0xAD, 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, - 0xE0, 0xAE, 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, - // Bytes 3e80 - 3ebf - 0xE0, 0xAF, 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, - 0xE0, 0xAF, 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, - 0xE0, 0xAF, 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, - 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, 0x89, 0x06, - 0xE0, 0xB2, 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, - 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, - 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, - 0xE0, 0xB5, 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, - // Bytes 3ec0 - 3eff - 0xE0, 0xB5, 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, - 0xE0, 0xB5, 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, - 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, 0x15, 0x06, - 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, - 0xE1, 0x80, 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, - 0xE1, 0xAC, 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - // Bytes 3f00 - 3f3f - 0xE1, 0xAC, 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAC, 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - 0xE1, 0xAD, 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x06, - // Bytes 3f40 - 3f7f - 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 3f80 - 3fbf - 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 3fc0 - 3fff - 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, 0x11, 0x06, - // Bytes 4000 - 403f - 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 4040 - 407f - 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 4080 - 40bf - 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 40c0 - 40ff - 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x11, 0x06, - 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, 0x11, 0x06, - // Bytes 4100 - 413f - 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, 0x11, 0x06, - 0xF0, 0x90, 0x97, 0x92, 0xCC, 0x87, 0xCD, 0x06, - 0xF0, 0x90, 0x97, 0x9A, 0xCC, 0x87, 0xCD, 0x08, - 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x81, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93, - 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, - // Bytes 4140 - 417f - 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x82, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x93, - 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, - 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x80, - // Bytes 4180 - 41bf - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94, - 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, - 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x81, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, - 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, - 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, - // Bytes 41c0 - 41ff - 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x82, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x93, - 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, - 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x80, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94, - // Bytes 4200 - 423f - 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, - 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, - 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x81, - 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, - 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, - 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, - 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, - // Bytes 4240 - 427f - 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x82, - 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x93, - 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, - 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, - 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, - 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x80, - 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94, - 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, - // Bytes 4280 - 42bf - 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, - 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, 0x82, 0xBA, - 0x0D, 0x08, 0xF0, 0x91, 0x82, 0x9B, 0xF0, 0x91, - 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, 0x82, 0xA5, - 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, - 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, 0x08, - 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, 0xA7, - 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, 0x91, - // Bytes 42c0 - 42ff - 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, - 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, 0x91, - 0x8E, 0x82, 0xF0, 0x91, 0x8F, 0x89, 0x01, 0x08, - 0xF0, 0x91, 0x8E, 0x84, 0xF0, 0x91, 0x8E, 0xBB, - 0x01, 0x08, 0xF0, 0x91, 0x8E, 0x8B, 0xF0, 0x91, - 0x8F, 0x82, 0x01, 0x08, 0xF0, 0x91, 0x8E, 0x90, - 0xF0, 0x91, 0x8F, 0x89, 0x01, 0x08, 0xF0, 0x91, - 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, 0x08, - // Bytes 4300 - 433f - 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xBA, - 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, - 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, 0xB8, - 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, 0x91, - 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, - 0xF0, 0x91, 0xA4, 0xB5, 0xF0, 0x91, 0xA4, 0xB0, - 0x01, 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, - 0xE0, 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, - // Bytes 4340 - 437f - 0xE0, 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x16, 0x0C, - 0xF0, 0x96, 0xB5, 0xA3, 0xF0, 0x96, 0xB5, 0xA7, - 0xF0, 0x96, 0xB5, 0xA7, 0x02, 0x42, 0xC2, 0xB4, - 0x01, 0x43, 0x20, 0xCC, 0x81, 0xCD, 0x43, 0x20, - 0xCC, 0x83, 0xCD, 0x43, 0x20, 0xCC, 0x84, 0xCD, - 0x43, 0x20, 0xCC, 0x85, 0xCD, 0x43, 0x20, 0xCC, - 0x86, 0xCD, 0x43, 0x20, 0xCC, 0x87, 0xCD, 0x43, - 0x20, 0xCC, 0x88, 0xCD, 0x43, 0x20, 0xCC, 0x8A, - // Bytes 4380 - 43bf - 0xCD, 0x43, 0x20, 0xCC, 0x8B, 0xCD, 0x43, 0x20, - 0xCC, 0x93, 0xCD, 0x43, 0x20, 0xCC, 0x94, 0xCD, - 0x43, 0x20, 0xCC, 0xA7, 0xA9, 0x43, 0x20, 0xCC, - 0xA8, 0xA9, 0x43, 0x20, 0xCC, 0xB3, 0xB9, 0x43, - 0x20, 0xCD, 0x82, 0xCD, 0x43, 0x20, 0xCD, 0x85, - 0xDD, 0x43, 0x20, 0xD9, 0x8B, 0x5D, 0x43, 0x20, - 0xD9, 0x8C, 0x61, 0x43, 0x20, 0xD9, 0x8D, 0x65, - 0x43, 0x20, 0xD9, 0x8E, 0x69, 0x43, 0x20, 0xD9, - // Bytes 43c0 - 43ff - 0x8F, 0x6D, 0x43, 0x20, 0xD9, 0x90, 0x71, 0x43, - 0x20, 0xD9, 0x91, 0x75, 0x43, 0x20, 0xD9, 0x92, - 0x79, 0x43, 0x41, 0xCC, 0x8A, 0xCD, 0x43, 0x73, - 0xCC, 0x87, 0xCD, 0x44, 0x20, 0xE3, 0x82, 0x99, - 0x11, 0x44, 0x20, 0xE3, 0x82, 0x9A, 0x11, 0x44, - 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x44, 0xCE, 0x91, - 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x95, 0xCC, 0x81, - 0xCD, 0x44, 0xCE, 0x97, 0xCC, 0x81, 0xCD, 0x44, - // Bytes 4400 - 443f - 0xCE, 0x99, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x9F, - 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, 0xCC, 0x81, - 0xCD, 0x44, 0xCE, 0xA5, 0xCC, 0x88, 0xCD, 0x44, - 0xCE, 0xA9, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB1, - 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB5, 0xCC, 0x81, - 0xCD, 0x44, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x44, - 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xBF, - 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x85, 0xCC, 0x81, - // Bytes 4440 - 447f - 0xCD, 0x44, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x44, - 0xD7, 0x90, 0xD6, 0xB7, 0x35, 0x44, 0xD7, 0x90, - 0xD6, 0xB8, 0x39, 0x44, 0xD7, 0x90, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBC, 0x45, 0x44, - 0xD7, 0x91, 0xD6, 0xBF, 0x4D, 0x44, 0xD7, 0x92, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x93, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0x94, 0xD6, 0xBC, 0x45, 0x44, - 0xD7, 0x95, 0xD6, 0xB9, 0x3D, 0x44, 0xD7, 0x95, - // Bytes 4480 - 44bf - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x96, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0x98, 0xD6, 0xBC, 0x45, 0x44, - 0xD7, 0x99, 0xD6, 0xB4, 0x29, 0x44, 0xD7, 0x99, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9A, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, 0x45, 0x44, - 0xD7, 0x9B, 0xD6, 0xBF, 0x4D, 0x44, 0xD7, 0x9C, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9E, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, 0x45, 0x44, - // Bytes 44c0 - 44ff - 0xD7, 0xA1, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA3, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, 0x4D, 0x44, - 0xD7, 0xA6, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA7, - 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA8, 0xD6, 0xBC, - 0x45, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, 0x45, 0x44, - 0xD7, 0xA9, 0xD7, 0x81, 0x51, 0x44, 0xD7, 0xA9, - 0xD7, 0x82, 0x55, 0x44, 0xD7, 0xAA, 0xD6, 0xBC, - // Bytes 4500 - 453f - 0x45, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, 0x35, 0x44, - 0xD8, 0xA7, 0xD9, 0x8B, 0x5D, 0x44, 0xD8, 0xA7, - 0xD9, 0x93, 0xCD, 0x44, 0xD8, 0xA7, 0xD9, 0x94, - 0xCD, 0x44, 0xD8, 0xA7, 0xD9, 0x95, 0xB9, 0x44, - 0xD8, 0xB0, 0xD9, 0xB0, 0x7D, 0x44, 0xD8, 0xB1, - 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x80, 0xD9, 0x8B, - 0x5D, 0x44, 0xD9, 0x80, 0xD9, 0x8E, 0x69, 0x44, - 0xD9, 0x80, 0xD9, 0x8F, 0x6D, 0x44, 0xD9, 0x80, - // Bytes 4540 - 457f - 0xD9, 0x90, 0x71, 0x44, 0xD9, 0x80, 0xD9, 0x91, - 0x75, 0x44, 0xD9, 0x80, 0xD9, 0x92, 0x79, 0x44, - 0xD9, 0x87, 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x88, - 0xD9, 0x94, 0xCD, 0x44, 0xD9, 0x89, 0xD9, 0xB0, - 0x7D, 0x44, 0xD9, 0x8A, 0xD9, 0x94, 0xCD, 0x44, - 0xDB, 0x92, 0xD9, 0x94, 0xCD, 0x44, 0xDB, 0x95, - 0xD9, 0x94, 0xCD, 0x45, 0x20, 0xCC, 0x88, 0xCC, - 0x80, 0xCE, 0x45, 0x20, 0xCC, 0x88, 0xCC, 0x81, - // Bytes 4580 - 45bf - 0xCE, 0x45, 0x20, 0xCC, 0x88, 0xCD, 0x82, 0xCE, - 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x45, - 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x45, 0x20, - 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x45, 0x20, 0xCC, - 0x94, 0xCC, 0x80, 0xCE, 0x45, 0x20, 0xCC, 0x94, - 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, 0x94, 0xCD, - 0x82, 0xCE, 0x45, 0x20, 0xD9, 0x8C, 0xD9, 0x91, - 0x76, 0x45, 0x20, 0xD9, 0x8D, 0xD9, 0x91, 0x76, - // Bytes 45c0 - 45ff - 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, 0x76, 0x45, - 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x76, 0x45, 0x20, - 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x45, 0x20, 0xD9, - 0x91, 0xD9, 0xB0, 0x7E, 0x45, 0xE2, 0xAB, 0x9D, - 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, 0xCC, 0x88, - 0xCC, 0x81, 0xCE, 0x46, 0xCF, 0x85, 0xCC, 0x88, - 0xCC, 0x81, 0xCE, 0x46, 0xD7, 0xA9, 0xD6, 0xBC, - 0xD7, 0x81, 0x52, 0x46, 0xD7, 0xA9, 0xD6, 0xBC, - // Bytes 4600 - 463f - 0xD7, 0x82, 0x56, 0x46, 0xD9, 0x80, 0xD9, 0x8E, - 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, 0xD9, 0x8F, - 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, 0xD9, 0x90, - 0xD9, 0x91, 0x76, 0x46, 0xE0, 0xA4, 0x95, 0xE0, - 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, 0x96, 0xE0, - 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, 0x97, 0xE0, - 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, 0x9C, 0xE0, - 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, 0xA1, 0xE0, - // Bytes 4640 - 467f - 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, 0xA2, 0xE0, - 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, 0xAB, 0xE0, - 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, 0xAF, 0xE0, - 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, 0xA1, 0xE0, - 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, 0xA2, 0xE0, - 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, 0xAF, 0xE0, - 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, 0x96, 0xE0, - 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, 0x97, 0xE0, - // Bytes 4680 - 46bf - 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, 0x9C, 0xE0, - 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, 0xAB, 0xE0, - 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, 0xB2, 0xE0, - 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, 0xB8, 0xE0, - 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, 0xA1, 0xE0, - 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, 0xA2, 0xE0, - 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xBE, 0xB2, 0xE0, - 0xBE, 0x80, 0xA1, 0x46, 0xE0, 0xBE, 0xB3, 0xE0, - // Bytes 46c0 - 46ff - 0xBE, 0x80, 0xA1, 0x46, 0xE1, 0x84, 0x80, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x82, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x83, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x85, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x86, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x87, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x89, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, - // Bytes 4700 - 473f - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, - 0x85, 0xAE, 0x01, 0x46, 0xE1, 0x84, 0x8C, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x8E, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x8F, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x90, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x91, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE1, 0x84, 0x92, 0xE1, - 0x85, 0xA1, 0x01, 0x46, 0xE3, 0x83, 0x86, 0xE3, - // Bytes 4740 - 477f - 0x82, 0x99, 0x11, 0x48, 0xF0, 0x9D, 0x85, 0x97, - 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x48, 0xF0, 0x9D, - 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x48, - 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, - 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, 0x9D, - 0x85, 0xA5, 0xB1, 0x49, 0xE0, 0xBE, 0xB2, 0xE0, - 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, 0x49, 0xE0, - 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, - // Bytes 4780 - 47bf - 0xA2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, - 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xB2, 0x4C, - 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, - 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, 0xF0, 0x9D, - 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, - 0x85, 0xB0, 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, - 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB1, - 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, - // Bytes 47c0 - 47ff - 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, 0xB2, 0x4C, - 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, - 0xF0, 0x9D, 0x85, 0xAE, 0xB2, 0x4C, 0xF0, 0x9D, - 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, - 0x85, 0xAF, 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, - 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, - 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, 0x9D, - 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x83, - // Bytes 4800 - 483f - 0x41, 0xCC, 0x82, 0xCD, 0x83, 0x41, 0xCC, 0x86, - 0xCD, 0x83, 0x41, 0xCC, 0x87, 0xCD, 0x83, 0x41, - 0xCC, 0x88, 0xCD, 0x83, 0x41, 0xCC, 0x8A, 0xCD, - 0x83, 0x41, 0xCC, 0xA3, 0xB9, 0x83, 0x43, 0xCC, - 0xA7, 0xA9, 0x83, 0x45, 0xCC, 0x82, 0xCD, 0x83, - 0x45, 0xCC, 0x84, 0xCD, 0x83, 0x45, 0xCC, 0xA3, - 0xB9, 0x83, 0x45, 0xCC, 0xA7, 0xA9, 0x83, 0x49, - 0xCC, 0x88, 0xCD, 0x83, 0x4C, 0xCC, 0xA3, 0xB9, - // Bytes 4840 - 487f - 0x83, 0x4F, 0xCC, 0x82, 0xCD, 0x83, 0x4F, 0xCC, - 0x83, 0xCD, 0x83, 0x4F, 0xCC, 0x84, 0xCD, 0x83, - 0x4F, 0xCC, 0x87, 0xCD, 0x83, 0x4F, 0xCC, 0x88, - 0xCD, 0x83, 0x4F, 0xCC, 0x9B, 0xB1, 0x83, 0x4F, - 0xCC, 0xA3, 0xB9, 0x83, 0x4F, 0xCC, 0xA8, 0xA9, - 0x83, 0x52, 0xCC, 0xA3, 0xB9, 0x83, 0x53, 0xCC, - 0x81, 0xCD, 0x83, 0x53, 0xCC, 0x8C, 0xCD, 0x83, - 0x53, 0xCC, 0xA3, 0xB9, 0x83, 0x55, 0xCC, 0x83, - // Bytes 4880 - 48bf - 0xCD, 0x83, 0x55, 0xCC, 0x84, 0xCD, 0x83, 0x55, - 0xCC, 0x88, 0xCD, 0x83, 0x55, 0xCC, 0x9B, 0xB1, - 0x83, 0x61, 0xCC, 0x82, 0xCD, 0x83, 0x61, 0xCC, - 0x86, 0xCD, 0x83, 0x61, 0xCC, 0x87, 0xCD, 0x83, - 0x61, 0xCC, 0x88, 0xCD, 0x83, 0x61, 0xCC, 0x8A, - 0xCD, 0x83, 0x61, 0xCC, 0xA3, 0xB9, 0x83, 0x63, - 0xCC, 0xA7, 0xA9, 0x83, 0x65, 0xCC, 0x82, 0xCD, - 0x83, 0x65, 0xCC, 0x84, 0xCD, 0x83, 0x65, 0xCC, - // Bytes 48c0 - 48ff - 0xA3, 0xB9, 0x83, 0x65, 0xCC, 0xA7, 0xA9, 0x83, - 0x69, 0xCC, 0x88, 0xCD, 0x83, 0x6C, 0xCC, 0xA3, - 0xB9, 0x83, 0x6F, 0xCC, 0x82, 0xCD, 0x83, 0x6F, - 0xCC, 0x83, 0xCD, 0x83, 0x6F, 0xCC, 0x84, 0xCD, - 0x83, 0x6F, 0xCC, 0x87, 0xCD, 0x83, 0x6F, 0xCC, - 0x88, 0xCD, 0x83, 0x6F, 0xCC, 0x9B, 0xB1, 0x83, - 0x6F, 0xCC, 0xA3, 0xB9, 0x83, 0x6F, 0xCC, 0xA8, - 0xA9, 0x83, 0x72, 0xCC, 0xA3, 0xB9, 0x83, 0x73, - // Bytes 4900 - 493f - 0xCC, 0x81, 0xCD, 0x83, 0x73, 0xCC, 0x8C, 0xCD, - 0x83, 0x73, 0xCC, 0xA3, 0xB9, 0x83, 0x75, 0xCC, - 0x83, 0xCD, 0x83, 0x75, 0xCC, 0x84, 0xCD, 0x83, - 0x75, 0xCC, 0x88, 0xCD, 0x83, 0x75, 0xCC, 0x9B, - 0xB1, 0x84, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x84, - 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x95, - 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x95, 0xCC, 0x94, - 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x84, - // Bytes 4940 - 497f - 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x99, - 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x99, 0xCC, 0x94, - 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x93, 0xCD, 0x84, - 0xCE, 0x9F, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xA5, - 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xA9, 0xCC, 0x93, - 0xCD, 0x84, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x84, - 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x84, 0xCE, 0xB1, - 0xCC, 0x81, 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x93, - // Bytes 4980 - 49bf - 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x84, - 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x84, 0xCE, 0xB5, - 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB5, 0xCC, 0x94, - 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x84, - 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x84, 0xCE, 0xB7, - 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x94, - 0xCD, 0x84, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x84, - 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x84, 0xCE, 0xB9, - // Bytes 49c0 - 49ff - 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB9, 0xCC, 0x94, - 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x93, 0xCD, 0x84, - 0xCE, 0xBF, 0xCC, 0x94, 0xCD, 0x84, 0xCF, 0x85, - 0xCC, 0x88, 0xCD, 0x84, 0xCF, 0x85, 0xCC, 0x93, - 0xCD, 0x84, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x84, - 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x84, 0xCF, 0x89, - 0xCC, 0x81, 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x93, - 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x84, - // Bytes 4a00 - 4a3f - 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x86, 0xCE, 0x91, - 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, 0xCE, 0x91, - 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, 0xCE, 0x91, - 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, 0xCE, 0x91, - 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, 0xCE, 0x91, - 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, 0xCE, 0x91, - 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, 0xCE, 0x97, - 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, 0xCE, 0x97, - // Bytes 4a40 - 4a7f - 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, 0xCE, 0x97, - 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, 0xCE, 0x97, - 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, 0xCE, 0x97, - 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, 0xCE, 0x97, - 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, 0xCE, 0xA9, - 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, 0xCE, 0xA9, - 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, 0xCE, 0xA9, - 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, 0xCE, 0xA9, - // Bytes 4a80 - 4abf - 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, 0xCE, 0xA9, - 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, 0xCE, 0xA9, - 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, 0xCE, 0xB1, - 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, 0xCE, 0xB1, - 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, 0xCE, 0xB1, - 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, 0xCE, 0xB1, - 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, 0xCE, 0xB1, - 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, 0xCE, 0xB1, - // Bytes 4ac0 - 4aff - 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, 0xCE, 0xB7, - 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, 0xCE, 0xB7, - 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, 0xCE, 0xB7, - 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, 0xCE, 0xB7, - 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, 0xCE, 0xB7, - 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, 0xCE, 0xB7, - 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, 0xCF, 0x89, - 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, 0xCF, 0x89, - // Bytes 4b00 - 4b3f - 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, 0xCF, 0x89, - 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, 0xCF, 0x89, - 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, 0xCF, 0x89, - 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, 0xCF, 0x89, - 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, 0xE0, 0xB3, - 0x86, 0xE0, 0xB3, 0x82, 0x01, 0x86, 0xE0, 0xB7, - 0x99, 0xE0, 0xB7, 0x8F, 0x01, 0x88, 0xF0, 0x96, - 0xB5, 0xA3, 0xF0, 0x96, 0xB5, 0xA7, 0x01, 0x42, - // Bytes 4b40 - 4b7f - 0xCC, 0x80, 0xCD, 0x33, 0x42, 0xCC, 0x81, 0xCD, - 0x33, 0x42, 0xCC, 0x93, 0xCD, 0x33, 0x43, 0xE1, - 0x85, 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, - 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, - 0x43, 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, - 0x85, 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, - 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, - 0x43, 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, - // Bytes 4b80 - 4bbf - 0x85, 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, - 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, - 0x43, 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, - 0x85, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, - 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, - 0x43, 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, - 0x85, 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, - 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, - // Bytes 4bc0 - 4bff - 0x43, 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, - 0x85, 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, - 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, - 0x43, 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, - 0x86, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, - 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, - 0x43, 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, - 0x86, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, - // Bytes 4c00 - 4c3f - 0x01, 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCE, - 0x33, 0x68, 0xF0, 0x91, 0x8F, 0x82, 0xF0, 0x91, - 0x8E, 0xB8, 0x02, 0x00, 0x68, 0xF0, 0x91, 0x8F, - 0x82, 0xF0, 0x91, 0x8F, 0x82, 0x02, 0x00, 0x68, - 0xF0, 0x91, 0x8F, 0x82, 0xF0, 0x91, 0x8F, 0x89, - 0x02, 0x00, 0x68, 0xF0, 0x96, 0x84, 0x9E, 0xF0, - 0x96, 0x84, 0x9F, 0x02, 0x00, 0x68, 0xF0, 0x96, - 0x84, 0x9E, 0xF0, 0x96, 0x84, 0xA0, 0x02, 0x00, - // Bytes 4c40 - 4c7f - 0x68, 0xF0, 0x96, 0x84, 0xA9, 0xF0, 0x96, 0x84, - 0x9F, 0x02, 0x00, 0x68, 0xF0, 0x96, 0xB5, 0xA7, - 0xF0, 0x96, 0xB5, 0xA7, 0x02, 0x00, 0x6C, 0xF0, - 0x96, 0x84, 0x9E, 0xF0, 0x96, 0x84, 0x9E, 0xF0, - 0x96, 0x84, 0x9F, 0x03, 0x00, 0x6C, 0xF0, 0x96, - 0x84, 0x9E, 0xF0, 0x96, 0x84, 0x9E, 0xF0, 0x96, - 0x84, 0xA0, 0x03, 0x00, 0x6C, 0xF0, 0x96, 0x84, - 0x9E, 0xF0, 0x96, 0x84, 0xA9, 0xF0, 0x96, 0x84, - // Bytes 4c80 - 4cbf - 0x9F, 0x03, 0x00, 0xE8, 0xF0, 0x96, 0x84, 0x9E, - 0xF0, 0x96, 0x84, 0x9E, 0x02, 0x00, 0xE8, 0xF0, - 0x96, 0x84, 0x9E, 0xF0, 0x96, 0x84, 0xA9, 0x02, - 0x00, 0x43, 0xE3, 0x82, 0x99, 0x11, 0x04, 0x43, - 0xE3, 0x82, 0x9A, 0x11, 0x04, 0x46, 0xE0, 0xBD, - 0xB1, 0xE0, 0xBD, 0xB2, 0xA2, 0x27, 0x46, 0xE0, - 0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA6, 0x27, 0x46, - 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, 0x27, - // Bytes 4cc0 - 4cff - 0x00, 0x01, -} - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return nfcValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = nfcIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *nfcTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return nfcValues[c0] - } - i := nfcIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = nfcIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = nfcIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *nfcTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return nfcValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := nfcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = nfcIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return nfcValues[c0] - } - i := nfcIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = nfcIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = nfcIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// nfcTrie. Total size: 11042 bytes (10.78 KiB). Checksum: cd75f956cd2316a9. -type nfcTrie struct{} - -func newNfcTrie(i int) *nfcTrie { - return &nfcTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 46: - return uint16(nfcValues[n<<6+uint32(b)]) - default: - n -= 46 - return uint16(nfcSparse.lookup(n, b)) - } -} - -// nfcValues: 48 blocks, 3072 entries, 6144 bytes -// The third block is the zero block. -var nfcValues = [3072]uint16{ - // Block 0x0, offset 0x0 - 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, - // Block 0x1, offset 0x40 - 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, - 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, - 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, - 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, - 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, - 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, - 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, - 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, - 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, - 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x2ece, 0xc1: 0x2ed3, 0xc2: 0x47ff, 0xc3: 0x2ed8, 0xc4: 0x480e, 0xc5: 0x4813, - 0xc6: 0xa000, 0xc7: 0x481d, 0xc8: 0x2f41, 0xc9: 0x2f46, 0xca: 0x4822, 0xcb: 0x2f5a, - 0xcc: 0x2fcd, 0xcd: 0x2fd2, 0xce: 0x2fd7, 0xcf: 0x4836, 0xd1: 0x3063, - 0xd2: 0x3086, 0xd3: 0x308b, 0xd4: 0x4840, 0xd5: 0x4845, 0xd6: 0x4854, - 0xd8: 0xa000, 0xd9: 0x3112, 0xda: 0x3117, 0xdb: 0x311c, 0xdc: 0x4886, 0xdd: 0x3194, - 0xe0: 0x31da, 0xe1: 0x31df, 0xe2: 0x4890, 0xe3: 0x31e4, - 0xe4: 0x489f, 0xe5: 0x48a4, 0xe6: 0xa000, 0xe7: 0x48ae, 0xe8: 0x324d, 0xe9: 0x3252, - 0xea: 0x48b3, 0xeb: 0x3266, 0xec: 0x32de, 0xed: 0x32e3, 0xee: 0x32e8, 0xef: 0x48c7, - 0xf1: 0x3374, 0xf2: 0x3397, 0xf3: 0x339c, 0xf4: 0x48d1, 0xf5: 0x48d6, - 0xf6: 0x48e5, 0xf8: 0xa000, 0xf9: 0x3428, 0xfa: 0x342d, 0xfb: 0x3432, - 0xfc: 0x4917, 0xfd: 0x34af, 0xff: 0x34c8, - // Block 0x4, offset 0x100 - 0x100: 0x2edd, 0x101: 0x31e9, 0x102: 0x4804, 0x103: 0x4895, 0x104: 0x2efb, 0x105: 0x3207, - 0x106: 0x2f0f, 0x107: 0x321b, 0x108: 0x2f14, 0x109: 0x3220, 0x10a: 0x2f19, 0x10b: 0x3225, - 0x10c: 0x2f1e, 0x10d: 0x322a, 0x10e: 0x2f28, 0x10f: 0x3234, - 0x112: 0x4827, 0x113: 0x48b8, 0x114: 0x2f50, 0x115: 0x325c, 0x116: 0x2f55, 0x117: 0x3261, - 0x118: 0x2f73, 0x119: 0x327f, 0x11a: 0x2f64, 0x11b: 0x3270, 0x11c: 0x2f8c, 0x11d: 0x3298, - 0x11e: 0x2f96, 0x11f: 0x32a2, 0x120: 0x2f9b, 0x121: 0x32a7, 0x122: 0x2fa5, 0x123: 0x32b1, - 0x124: 0x2faa, 0x125: 0x32b6, 0x128: 0x2fdc, 0x129: 0x32ed, - 0x12a: 0x2fe1, 0x12b: 0x32f2, 0x12c: 0x2fe6, 0x12d: 0x32f7, 0x12e: 0x3009, 0x12f: 0x3315, - 0x130: 0x2feb, 0x134: 0x3013, 0x135: 0x331f, - 0x136: 0x3027, 0x137: 0x3338, 0x139: 0x3031, 0x13a: 0x3342, 0x13b: 0x303b, - 0x13c: 0x334c, 0x13d: 0x3036, 0x13e: 0x3347, - // Block 0x5, offset 0x140 - 0x143: 0x305e, 0x144: 0x336f, 0x145: 0x3077, - 0x146: 0x3388, 0x147: 0x306d, 0x148: 0x337e, - 0x14c: 0x484a, 0x14d: 0x48db, 0x14e: 0x3090, 0x14f: 0x33a1, 0x150: 0x309a, 0x151: 0x33ab, - 0x154: 0x30b8, 0x155: 0x33c9, 0x156: 0x30d1, 0x157: 0x33e2, - 0x158: 0x30c2, 0x159: 0x33d3, 0x15a: 0x486d, 0x15b: 0x48fe, 0x15c: 0x30db, 0x15d: 0x33ec, - 0x15e: 0x30ea, 0x15f: 0x33fb, 0x160: 0x4872, 0x161: 0x4903, 0x162: 0x3103, 0x163: 0x3419, - 0x164: 0x30f4, 0x165: 0x340a, 0x168: 0x487c, 0x169: 0x490d, - 0x16a: 0x4881, 0x16b: 0x4912, 0x16c: 0x3121, 0x16d: 0x3437, 0x16e: 0x312b, 0x16f: 0x3441, - 0x170: 0x3130, 0x171: 0x3446, 0x172: 0x314e, 0x173: 0x3464, 0x174: 0x3171, 0x175: 0x3487, - 0x176: 0x3199, 0x177: 0x34b4, 0x178: 0x31ad, 0x179: 0x31bc, 0x17a: 0x34dc, 0x17b: 0x31c6, - 0x17c: 0x34e6, 0x17d: 0x31cb, 0x17e: 0x34eb, 0x17f: 0xa000, - // Block 0x6, offset 0x180 - 0x184: 0x8100, 0x185: 0x8100, - 0x186: 0x8100, - 0x18d: 0x2ee7, 0x18e: 0x31f3, 0x18f: 0x2ff5, 0x190: 0x3301, 0x191: 0x309f, - 0x192: 0x33b0, 0x193: 0x3135, 0x194: 0x344b, 0x195: 0x392e, 0x196: 0x3abd, 0x197: 0x3927, - 0x198: 0x3ab6, 0x199: 0x3935, 0x19a: 0x3ac4, 0x19b: 0x3920, 0x19c: 0x3aaf, - 0x19e: 0x380f, 0x19f: 0x399e, 0x1a0: 0x3808, 0x1a1: 0x3997, 0x1a2: 0x3512, 0x1a3: 0x3524, - 0x1a6: 0x2fa0, 0x1a7: 0x32ac, 0x1a8: 0x301d, 0x1a9: 0x332e, - 0x1aa: 0x4863, 0x1ab: 0x48f4, 0x1ac: 0x38ef, 0x1ad: 0x3a7e, 0x1ae: 0x3536, 0x1af: 0x353c, - 0x1b0: 0x3324, 0x1b4: 0x2f87, 0x1b5: 0x3293, - 0x1b8: 0x3059, 0x1b9: 0x336a, 0x1ba: 0x3816, 0x1bb: 0x39a5, - 0x1bc: 0x350c, 0x1bd: 0x351e, 0x1be: 0x3518, 0x1bf: 0x352a, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x2eec, 0x1c1: 0x31f8, 0x1c2: 0x2ef1, 0x1c3: 0x31fd, 0x1c4: 0x2f69, 0x1c5: 0x3275, - 0x1c6: 0x2f6e, 0x1c7: 0x327a, 0x1c8: 0x2ffa, 0x1c9: 0x3306, 0x1ca: 0x2fff, 0x1cb: 0x330b, - 0x1cc: 0x30a4, 0x1cd: 0x33b5, 0x1ce: 0x30a9, 0x1cf: 0x33ba, 0x1d0: 0x30c7, 0x1d1: 0x33d8, - 0x1d2: 0x30cc, 0x1d3: 0x33dd, 0x1d4: 0x313a, 0x1d5: 0x3450, 0x1d6: 0x313f, 0x1d7: 0x3455, - 0x1d8: 0x30e5, 0x1d9: 0x33f6, 0x1da: 0x30fe, 0x1db: 0x3414, - 0x1de: 0x2fb9, 0x1df: 0x32c5, - 0x1e6: 0x4809, 0x1e7: 0x489a, 0x1e8: 0x4831, 0x1e9: 0x48c2, - 0x1ea: 0x38be, 0x1eb: 0x3a4d, 0x1ec: 0x389b, 0x1ed: 0x3a2a, 0x1ee: 0x484f, 0x1ef: 0x48e0, - 0x1f0: 0x38b7, 0x1f1: 0x3a46, 0x1f2: 0x31a3, 0x1f3: 0x34be, - // Block 0x8, offset 0x200 - 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, - 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, - 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, - 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, - 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, - 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, - 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, - 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, - 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, - 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, - 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, - // Block 0x9, offset 0x240 - 0x240: 0x4b3f, 0x241: 0x4b44, 0x242: 0x9933, 0x243: 0x4b49, 0x244: 0x4c02, 0x245: 0x9937, - 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, - 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, - 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, - 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, - 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, - 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, - 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, - 0x274: 0x01ee, - 0x27a: 0x8100, - 0x27e: 0x0037, - // Block 0xa, offset 0x280 - 0x284: 0x8100, 0x285: 0x3500, - 0x286: 0x3548, 0x287: 0x00ce, 0x288: 0x3566, 0x289: 0x3572, 0x28a: 0x3584, - 0x28c: 0x35a2, 0x28e: 0x35b4, 0x28f: 0x35d2, 0x290: 0x3d67, 0x291: 0xa000, - 0x295: 0xa000, 0x297: 0xa000, - 0x299: 0xa000, - 0x29f: 0xa000, 0x2a1: 0xa000, - 0x2a5: 0xa000, 0x2a9: 0xa000, - 0x2aa: 0x3596, 0x2ab: 0x35c6, 0x2ac: 0x4975, 0x2ad: 0x35f6, 0x2ae: 0x499f, 0x2af: 0x3608, - 0x2b0: 0x3dcf, 0x2b1: 0xa000, 0x2b5: 0xa000, - 0x2b7: 0xa000, 0x2b9: 0xa000, - 0x2bf: 0xa000, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x3680, 0x2c1: 0x368c, 0x2c3: 0x367a, - 0x2c6: 0xa000, 0x2c7: 0x3668, - 0x2cc: 0x36bc, 0x2cd: 0x36a4, 0x2ce: 0x36ce, 0x2d0: 0xa000, - 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000, - 0x2d8: 0xa000, 0x2d9: 0x36b0, 0x2da: 0xa000, - 0x2de: 0xa000, 0x2e3: 0xa000, - 0x2e7: 0xa000, - 0x2eb: 0xa000, 0x2ed: 0xa000, - 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000, - 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x3734, 0x2fa: 0xa000, - 0x2fe: 0xa000, - // Block 0xc, offset 0x300 - 0x301: 0x3692, 0x302: 0x3716, - 0x310: 0x366e, 0x311: 0x36f2, - 0x312: 0x3674, 0x313: 0x36f8, 0x316: 0x3686, 0x317: 0x370a, - 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x3788, 0x31b: 0x378e, 0x31c: 0x3698, 0x31d: 0x371c, - 0x31e: 0x369e, 0x31f: 0x3722, 0x322: 0x36aa, 0x323: 0x372e, - 0x324: 0x36b6, 0x325: 0x373a, 0x326: 0x36c2, 0x327: 0x3746, 0x328: 0xa000, 0x329: 0xa000, - 0x32a: 0x3794, 0x32b: 0x379a, 0x32c: 0x36ec, 0x32d: 0x3770, 0x32e: 0x36c8, 0x32f: 0x374c, - 0x330: 0x36d4, 0x331: 0x3758, 0x332: 0x36da, 0x333: 0x375e, 0x334: 0x36e0, 0x335: 0x3764, - 0x338: 0x36e6, 0x339: 0x376a, - // Block 0xd, offset 0x340 - 0x351: 0x812e, - 0x352: 0x8133, 0x353: 0x8133, 0x354: 0x8133, 0x355: 0x8133, 0x356: 0x812e, 0x357: 0x8133, - 0x358: 0x8133, 0x359: 0x8133, 0x35a: 0x812f, 0x35b: 0x812e, 0x35c: 0x8133, 0x35d: 0x8133, - 0x35e: 0x8133, 0x35f: 0x8133, 0x360: 0x8133, 0x361: 0x8133, 0x362: 0x812e, 0x363: 0x812e, - 0x364: 0x812e, 0x365: 0x812e, 0x366: 0x812e, 0x367: 0x812e, 0x368: 0x8133, 0x369: 0x8133, - 0x36a: 0x812e, 0x36b: 0x8133, 0x36c: 0x8133, 0x36d: 0x812f, 0x36e: 0x8132, 0x36f: 0x8133, - 0x370: 0x8106, 0x371: 0x8107, 0x372: 0x8108, 0x373: 0x8109, 0x374: 0x810a, 0x375: 0x810b, - 0x376: 0x810c, 0x377: 0x810d, 0x378: 0x810e, 0x379: 0x810f, 0x37a: 0x810f, 0x37b: 0x8110, - 0x37c: 0x8111, 0x37d: 0x8112, 0x37f: 0x8113, - // Block 0xe, offset 0x380 - 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8117, - 0x38c: 0x8118, 0x38d: 0x8119, 0x38e: 0x811a, 0x38f: 0x811b, 0x390: 0x811c, 0x391: 0x811d, - 0x392: 0x811e, 0x393: 0x9933, 0x394: 0x9933, 0x395: 0x992e, 0x396: 0x812e, 0x397: 0x8133, - 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x8133, 0x39b: 0x8133, 0x39c: 0x812e, 0x39d: 0x8133, - 0x39e: 0x8133, 0x39f: 0x812e, - 0x3b0: 0x811f, - // Block 0xf, offset 0x3c0 - 0x3ca: 0x8133, 0x3cb: 0x8133, - 0x3cc: 0x8133, 0x3cd: 0x8133, 0x3ce: 0x8133, 0x3cf: 0x812e, 0x3d0: 0x812e, 0x3d1: 0x812e, - 0x3d2: 0x812e, 0x3d3: 0x812e, 0x3d4: 0x8133, 0x3d5: 0x8133, 0x3d6: 0x8133, 0x3d7: 0x8133, - 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x8133, 0x3dd: 0x8133, - 0x3de: 0x8133, 0x3df: 0x8133, 0x3e0: 0x8133, 0x3e1: 0x8133, 0x3e3: 0x812e, - 0x3e4: 0x8133, 0x3e5: 0x8133, 0x3e6: 0x812e, 0x3e7: 0x8133, 0x3e8: 0x8133, 0x3e9: 0x812e, - 0x3ea: 0x8133, 0x3eb: 0x8133, 0x3ec: 0x8133, 0x3ed: 0x812e, 0x3ee: 0x812e, 0x3ef: 0x812e, - 0x3f0: 0x8117, 0x3f1: 0x8118, 0x3f2: 0x8119, 0x3f3: 0x8133, 0x3f4: 0x8133, 0x3f5: 0x8133, - 0x3f6: 0x812e, 0x3f7: 0x8133, 0x3f8: 0x8133, 0x3f9: 0x812e, 0x3fa: 0x812e, 0x3fb: 0x8133, - 0x3fc: 0x8133, 0x3fd: 0x8133, 0x3fe: 0x8133, 0x3ff: 0x8133, - // Block 0x10, offset 0x400 - 0x405: 0xa000, - 0x406: 0x3ee7, 0x407: 0xa000, 0x408: 0x3eef, 0x409: 0xa000, 0x40a: 0x3ef7, 0x40b: 0xa000, - 0x40c: 0x3eff, 0x40d: 0xa000, 0x40e: 0x3f07, 0x411: 0xa000, - 0x412: 0x3f0f, - 0x434: 0x8103, 0x435: 0x9900, - 0x43a: 0xa000, 0x43b: 0x3f17, - 0x43c: 0xa000, 0x43d: 0x3f1f, 0x43e: 0xa000, 0x43f: 0xa000, - // Block 0x11, offset 0x440 - 0x440: 0x8133, 0x441: 0x8133, 0x442: 0x812e, 0x443: 0x8133, 0x444: 0x8133, 0x445: 0x8133, - 0x446: 0x8133, 0x447: 0x8133, 0x448: 0x8133, 0x449: 0x8133, 0x44a: 0x812e, 0x44b: 0x8133, - 0x44c: 0x8133, 0x44d: 0x8136, 0x44e: 0x812b, 0x44f: 0x812e, 0x450: 0x812a, 0x451: 0x8133, - 0x452: 0x8133, 0x453: 0x8133, 0x454: 0x8133, 0x455: 0x8133, 0x456: 0x8133, 0x457: 0x8133, - 0x458: 0x8133, 0x459: 0x8133, 0x45a: 0x8133, 0x45b: 0x8133, 0x45c: 0x8133, 0x45d: 0x8133, - 0x45e: 0x8133, 0x45f: 0x8133, 0x460: 0x8133, 0x461: 0x8133, 0x462: 0x8133, 0x463: 0x8133, - 0x464: 0x8133, 0x465: 0x8133, 0x466: 0x8133, 0x467: 0x8133, 0x468: 0x8133, 0x469: 0x8133, - 0x46a: 0x8133, 0x46b: 0x8133, 0x46c: 0x8133, 0x46d: 0x8133, 0x46e: 0x8133, 0x46f: 0x8133, - 0x470: 0x8133, 0x471: 0x8133, 0x472: 0x8133, 0x473: 0x8133, 0x474: 0x8133, 0x475: 0x8133, - 0x476: 0x8134, 0x477: 0x8132, 0x478: 0x8132, 0x479: 0x812e, 0x47a: 0x812d, 0x47b: 0x8133, - 0x47c: 0x8135, 0x47d: 0x812e, 0x47e: 0x8133, 0x47f: 0x812e, - // Block 0x12, offset 0x480 - 0x480: 0x2ef6, 0x481: 0x3202, 0x482: 0x2f00, 0x483: 0x320c, 0x484: 0x2f05, 0x485: 0x3211, - 0x486: 0x2f0a, 0x487: 0x3216, 0x488: 0x382b, 0x489: 0x39ba, 0x48a: 0x2f23, 0x48b: 0x322f, - 0x48c: 0x2f2d, 0x48d: 0x3239, 0x48e: 0x2f3c, 0x48f: 0x3248, 0x490: 0x2f32, 0x491: 0x323e, - 0x492: 0x2f37, 0x493: 0x3243, 0x494: 0x384e, 0x495: 0x39dd, 0x496: 0x3855, 0x497: 0x39e4, - 0x498: 0x2f78, 0x499: 0x3284, 0x49a: 0x2f7d, 0x49b: 0x3289, 0x49c: 0x3863, 0x49d: 0x39f2, - 0x49e: 0x2f82, 0x49f: 0x328e, 0x4a0: 0x2f91, 0x4a1: 0x329d, 0x4a2: 0x2faf, 0x4a3: 0x32bb, - 0x4a4: 0x2fbe, 0x4a5: 0x32ca, 0x4a6: 0x2fb4, 0x4a7: 0x32c0, 0x4a8: 0x2fc3, 0x4a9: 0x32cf, - 0x4aa: 0x2fc8, 0x4ab: 0x32d4, 0x4ac: 0x300e, 0x4ad: 0x331a, 0x4ae: 0x386a, 0x4af: 0x39f9, - 0x4b0: 0x3018, 0x4b1: 0x3329, 0x4b2: 0x3022, 0x4b3: 0x3333, 0x4b4: 0x302c, 0x4b5: 0x333d, - 0x4b6: 0x483b, 0x4b7: 0x48cc, 0x4b8: 0x3871, 0x4b9: 0x3a00, 0x4ba: 0x3045, 0x4bb: 0x3356, - 0x4bc: 0x3040, 0x4bd: 0x3351, 0x4be: 0x304a, 0x4bf: 0x335b, - // Block 0x13, offset 0x4c0 - 0x4c0: 0x304f, 0x4c1: 0x3360, 0x4c2: 0x3054, 0x4c3: 0x3365, 0x4c4: 0x3068, 0x4c5: 0x3379, - 0x4c6: 0x3072, 0x4c7: 0x3383, 0x4c8: 0x3081, 0x4c9: 0x3392, 0x4ca: 0x307c, 0x4cb: 0x338d, - 0x4cc: 0x3894, 0x4cd: 0x3a23, 0x4ce: 0x38a2, 0x4cf: 0x3a31, 0x4d0: 0x38a9, 0x4d1: 0x3a38, - 0x4d2: 0x38b0, 0x4d3: 0x3a3f, 0x4d4: 0x30ae, 0x4d5: 0x33bf, 0x4d6: 0x30b3, 0x4d7: 0x33c4, - 0x4d8: 0x30bd, 0x4d9: 0x33ce, 0x4da: 0x4868, 0x4db: 0x48f9, 0x4dc: 0x38f6, 0x4dd: 0x3a85, - 0x4de: 0x30d6, 0x4df: 0x33e7, 0x4e0: 0x30e0, 0x4e1: 0x33f1, 0x4e2: 0x4877, 0x4e3: 0x4908, - 0x4e4: 0x38fd, 0x4e5: 0x3a8c, 0x4e6: 0x3904, 0x4e7: 0x3a93, 0x4e8: 0x390b, 0x4e9: 0x3a9a, - 0x4ea: 0x30ef, 0x4eb: 0x3400, 0x4ec: 0x30f9, 0x4ed: 0x340f, 0x4ee: 0x310d, 0x4ef: 0x3423, - 0x4f0: 0x3108, 0x4f1: 0x341e, 0x4f2: 0x3149, 0x4f3: 0x345f, 0x4f4: 0x3158, 0x4f5: 0x346e, - 0x4f6: 0x3153, 0x4f7: 0x3469, 0x4f8: 0x3912, 0x4f9: 0x3aa1, 0x4fa: 0x3919, 0x4fb: 0x3aa8, - 0x4fc: 0x315d, 0x4fd: 0x3473, 0x4fe: 0x3162, 0x4ff: 0x3478, - // Block 0x14, offset 0x500 - 0x500: 0x3167, 0x501: 0x347d, 0x502: 0x316c, 0x503: 0x3482, 0x504: 0x317b, 0x505: 0x3491, - 0x506: 0x3176, 0x507: 0x348c, 0x508: 0x3180, 0x509: 0x349b, 0x50a: 0x3185, 0x50b: 0x34a0, - 0x50c: 0x318a, 0x50d: 0x34a5, 0x50e: 0x31a8, 0x50f: 0x34c3, 0x510: 0x31c1, 0x511: 0x34e1, - 0x512: 0x31d0, 0x513: 0x34f0, 0x514: 0x31d5, 0x515: 0x34f5, 0x516: 0x32d9, 0x517: 0x3405, - 0x518: 0x3496, 0x519: 0x34d2, 0x51b: 0x3530, - 0x520: 0x4818, 0x521: 0x48a9, 0x522: 0x2ee2, 0x523: 0x31ee, - 0x524: 0x37d7, 0x525: 0x3966, 0x526: 0x37d0, 0x527: 0x395f, 0x528: 0x37e5, 0x529: 0x3974, - 0x52a: 0x37de, 0x52b: 0x396d, 0x52c: 0x381d, 0x52d: 0x39ac, 0x52e: 0x37f3, 0x52f: 0x3982, - 0x530: 0x37ec, 0x531: 0x397b, 0x532: 0x3801, 0x533: 0x3990, 0x534: 0x37fa, 0x535: 0x3989, - 0x536: 0x3824, 0x537: 0x39b3, 0x538: 0x482c, 0x539: 0x48bd, 0x53a: 0x2f5f, 0x53b: 0x326b, - 0x53c: 0x2f4b, 0x53d: 0x3257, 0x53e: 0x3839, 0x53f: 0x39c8, - // Block 0x15, offset 0x540 - 0x540: 0x3832, 0x541: 0x39c1, 0x542: 0x3847, 0x543: 0x39d6, 0x544: 0x3840, 0x545: 0x39cf, - 0x546: 0x385c, 0x547: 0x39eb, 0x548: 0x2ff0, 0x549: 0x32fc, 0x54a: 0x3004, 0x54b: 0x3310, - 0x54c: 0x485e, 0x54d: 0x48ef, 0x54e: 0x3095, 0x54f: 0x33a6, 0x550: 0x387f, 0x551: 0x3a0e, - 0x552: 0x3878, 0x553: 0x3a07, 0x554: 0x388d, 0x555: 0x3a1c, 0x556: 0x3886, 0x557: 0x3a15, - 0x558: 0x38e8, 0x559: 0x3a77, 0x55a: 0x38cc, 0x55b: 0x3a5b, 0x55c: 0x38c5, 0x55d: 0x3a54, - 0x55e: 0x38da, 0x55f: 0x3a69, 0x560: 0x38d3, 0x561: 0x3a62, 0x562: 0x38e1, 0x563: 0x3a70, - 0x564: 0x3144, 0x565: 0x345a, 0x566: 0x3126, 0x567: 0x343c, 0x568: 0x3943, 0x569: 0x3ad2, - 0x56a: 0x393c, 0x56b: 0x3acb, 0x56c: 0x3951, 0x56d: 0x3ae0, 0x56e: 0x394a, 0x56f: 0x3ad9, - 0x570: 0x3958, 0x571: 0x3ae7, 0x572: 0x318f, 0x573: 0x34aa, 0x574: 0x31b7, 0x575: 0x34d7, - 0x576: 0x31b2, 0x577: 0x34cd, 0x578: 0x319e, 0x579: 0x34b9, - // Block 0x16, offset 0x580 - 0x580: 0x497b, 0x581: 0x4981, 0x582: 0x4a95, 0x583: 0x4aad, 0x584: 0x4a9d, 0x585: 0x4ab5, - 0x586: 0x4aa5, 0x587: 0x4abd, 0x588: 0x4921, 0x589: 0x4927, 0x58a: 0x4a05, 0x58b: 0x4a1d, - 0x58c: 0x4a0d, 0x58d: 0x4a25, 0x58e: 0x4a15, 0x58f: 0x4a2d, 0x590: 0x498d, 0x591: 0x4993, - 0x592: 0x3d17, 0x593: 0x3d27, 0x594: 0x3d1f, 0x595: 0x3d2f, - 0x598: 0x492d, 0x599: 0x4933, 0x59a: 0x3c47, 0x59b: 0x3c57, 0x59c: 0x3c4f, 0x59d: 0x3c5f, - 0x5a0: 0x49a5, 0x5a1: 0x49ab, 0x5a2: 0x4ac5, 0x5a3: 0x4add, - 0x5a4: 0x4acd, 0x5a5: 0x4ae5, 0x5a6: 0x4ad5, 0x5a7: 0x4aed, 0x5a8: 0x4939, 0x5a9: 0x493f, - 0x5aa: 0x4a35, 0x5ab: 0x4a4d, 0x5ac: 0x4a3d, 0x5ad: 0x4a55, 0x5ae: 0x4a45, 0x5af: 0x4a5d, - 0x5b0: 0x49bd, 0x5b1: 0x49c3, 0x5b2: 0x3d77, 0x5b3: 0x3d8f, 0x5b4: 0x3d7f, 0x5b5: 0x3d97, - 0x5b6: 0x3d87, 0x5b7: 0x3d9f, 0x5b8: 0x4945, 0x5b9: 0x494b, 0x5ba: 0x3c77, 0x5bb: 0x3c8f, - 0x5bc: 0x3c7f, 0x5bd: 0x3c97, 0x5be: 0x3c87, 0x5bf: 0x3c9f, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x49c9, 0x5c1: 0x49cf, 0x5c2: 0x3da7, 0x5c3: 0x3db7, 0x5c4: 0x3daf, 0x5c5: 0x3dbf, - 0x5c8: 0x4951, 0x5c9: 0x4957, 0x5ca: 0x3ca7, 0x5cb: 0x3cb7, - 0x5cc: 0x3caf, 0x5cd: 0x3cbf, 0x5d0: 0x49db, 0x5d1: 0x49e1, - 0x5d2: 0x3ddf, 0x5d3: 0x3df7, 0x5d4: 0x3de7, 0x5d5: 0x3dff, 0x5d6: 0x3def, 0x5d7: 0x3e07, - 0x5d9: 0x495d, 0x5db: 0x3cc7, 0x5dd: 0x3ccf, - 0x5df: 0x3cd7, 0x5e0: 0x49f3, 0x5e1: 0x49f9, 0x5e2: 0x4af5, 0x5e3: 0x4b0d, - 0x5e4: 0x4afd, 0x5e5: 0x4b15, 0x5e6: 0x4b05, 0x5e7: 0x4b1d, 0x5e8: 0x4963, 0x5e9: 0x4969, - 0x5ea: 0x4a65, 0x5eb: 0x4a7d, 0x5ec: 0x4a6d, 0x5ed: 0x4a85, 0x5ee: 0x4a75, 0x5ef: 0x4a8d, - 0x5f0: 0x496f, 0x5f1: 0x441d, 0x5f2: 0x35f0, 0x5f3: 0x4423, 0x5f4: 0x4999, 0x5f5: 0x4429, - 0x5f6: 0x3602, 0x5f7: 0x442f, 0x5f8: 0x3620, 0x5f9: 0x4435, 0x5fa: 0x3638, 0x5fb: 0x443b, - 0x5fc: 0x49e7, 0x5fd: 0x4441, - // Block 0x18, offset 0x600 - 0x600: 0x3cff, 0x601: 0x3d07, 0x602: 0x41d3, 0x603: 0x41f1, 0x604: 0x41dd, 0x605: 0x41fb, - 0x606: 0x41e7, 0x607: 0x4205, 0x608: 0x3c37, 0x609: 0x3c3f, 0x60a: 0x411f, 0x60b: 0x413d, - 0x60c: 0x4129, 0x60d: 0x4147, 0x60e: 0x4133, 0x60f: 0x4151, 0x610: 0x3d47, 0x611: 0x3d4f, - 0x612: 0x420f, 0x613: 0x422d, 0x614: 0x4219, 0x615: 0x4237, 0x616: 0x4223, 0x617: 0x4241, - 0x618: 0x3c67, 0x619: 0x3c6f, 0x61a: 0x415b, 0x61b: 0x4179, 0x61c: 0x4165, 0x61d: 0x4183, - 0x61e: 0x416f, 0x61f: 0x418d, 0x620: 0x3e1f, 0x621: 0x3e27, 0x622: 0x424b, 0x623: 0x4269, - 0x624: 0x4255, 0x625: 0x4273, 0x626: 0x425f, 0x627: 0x427d, 0x628: 0x3cdf, 0x629: 0x3ce7, - 0x62a: 0x4197, 0x62b: 0x41b5, 0x62c: 0x41a1, 0x62d: 0x41bf, 0x62e: 0x41ab, 0x62f: 0x41c9, - 0x630: 0x35e4, 0x631: 0x35de, 0x632: 0x3cef, 0x633: 0x35ea, 0x634: 0x3cf7, - 0x636: 0x4987, 0x637: 0x3d0f, 0x638: 0x3554, 0x639: 0x354e, 0x63a: 0x3542, 0x63b: 0x43ed, - 0x63c: 0x355a, 0x63d: 0x8100, 0x63e: 0x0257, 0x63f: 0xa100, - // Block 0x19, offset 0x640 - 0x640: 0x8100, 0x641: 0x3506, 0x642: 0x3d37, 0x643: 0x35fc, 0x644: 0x3d3f, - 0x646: 0x49b1, 0x647: 0x3d57, 0x648: 0x3560, 0x649: 0x43f3, 0x64a: 0x356c, 0x64b: 0x43f9, - 0x64c: 0x3578, 0x64d: 0x3aee, 0x64e: 0x3af5, 0x64f: 0x3afc, 0x650: 0x3614, 0x651: 0x360e, - 0x652: 0x3d5f, 0x653: 0x45e3, 0x656: 0x361a, 0x657: 0x3d6f, - 0x658: 0x3590, 0x659: 0x358a, 0x65a: 0x357e, 0x65b: 0x43ff, 0x65d: 0x3b03, - 0x65e: 0x3b0a, 0x65f: 0x3b11, 0x660: 0x364a, 0x661: 0x3644, 0x662: 0x3dc7, 0x663: 0x45eb, - 0x664: 0x362c, 0x665: 0x3632, 0x666: 0x3650, 0x667: 0x3dd7, 0x668: 0x35c0, 0x669: 0x35ba, - 0x66a: 0x35ae, 0x66b: 0x440b, 0x66c: 0x35a8, 0x66d: 0x34fa, 0x66e: 0x43e7, 0x66f: 0x0081, - 0x672: 0x3e0f, 0x673: 0x3656, 0x674: 0x3e17, - 0x676: 0x49ff, 0x677: 0x3e2f, 0x678: 0x359c, 0x679: 0x4405, 0x67a: 0x35cc, 0x67b: 0x4417, - 0x67c: 0x35d8, 0x67d: 0x4355, 0x67e: 0xa100, - // Block 0x1a, offset 0x680 - 0x681: 0x3b65, 0x683: 0xa000, 0x684: 0x3b6c, 0x685: 0xa000, - 0x687: 0x3b73, 0x688: 0xa000, 0x689: 0x3b7a, - 0x68d: 0xa000, - 0x6a0: 0x2ec4, 0x6a1: 0xa000, 0x6a2: 0x3b88, - 0x6a4: 0xa000, 0x6a5: 0xa000, - 0x6ad: 0x3b81, 0x6ae: 0x2ebf, 0x6af: 0x2ec9, - 0x6b0: 0x3b8f, 0x6b1: 0x3b96, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3b9d, 0x6b5: 0x3ba4, - 0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3bab, 0x6b9: 0x3bb2, 0x6ba: 0xa000, 0x6bb: 0xa000, - 0x6bc: 0xa000, 0x6bd: 0xa000, - // Block 0x1b, offset 0x6c0 - 0x6c0: 0x3bb9, 0x6c1: 0x3bc0, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3bd5, 0x6c5: 0x3bdc, - 0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3be3, 0x6c9: 0x3bea, - 0x6d1: 0xa000, - 0x6d2: 0xa000, - 0x6e2: 0xa000, - 0x6e8: 0xa000, 0x6e9: 0xa000, - 0x6eb: 0xa000, 0x6ec: 0x3bff, 0x6ed: 0x3c06, 0x6ee: 0x3c0d, 0x6ef: 0x3c14, - 0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000, - // Block 0x1c, offset 0x700 - 0x706: 0xa000, 0x70b: 0xa000, - 0x70c: 0x3f47, 0x70d: 0xa000, 0x70e: 0x3f4f, 0x70f: 0xa000, 0x710: 0x3f57, 0x711: 0xa000, - 0x712: 0x3f5f, 0x713: 0xa000, 0x714: 0x3f67, 0x715: 0xa000, 0x716: 0x3f6f, 0x717: 0xa000, - 0x718: 0x3f77, 0x719: 0xa000, 0x71a: 0x3f7f, 0x71b: 0xa000, 0x71c: 0x3f87, 0x71d: 0xa000, - 0x71e: 0x3f8f, 0x71f: 0xa000, 0x720: 0x3f97, 0x721: 0xa000, 0x722: 0x3f9f, - 0x724: 0xa000, 0x725: 0x3fa7, 0x726: 0xa000, 0x727: 0x3faf, 0x728: 0xa000, 0x729: 0x3fb7, - 0x72f: 0xa000, - 0x730: 0x3fbf, 0x731: 0x3fc7, 0x732: 0xa000, 0x733: 0x3fcf, 0x734: 0x3fd7, 0x735: 0xa000, - 0x736: 0x3fdf, 0x737: 0x3fe7, 0x738: 0xa000, 0x739: 0x3fef, 0x73a: 0x3ff7, 0x73b: 0xa000, - 0x73c: 0x3fff, 0x73d: 0x4007, - // Block 0x1d, offset 0x740 - 0x754: 0x3f3f, - 0x759: 0x9904, 0x75a: 0x9904, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000, - 0x75e: 0x400f, - 0x766: 0xa000, - 0x76b: 0xa000, 0x76c: 0x401f, 0x76d: 0xa000, 0x76e: 0x4027, 0x76f: 0xa000, - 0x770: 0x402f, 0x771: 0xa000, 0x772: 0x4037, 0x773: 0xa000, 0x774: 0x403f, 0x775: 0xa000, - 0x776: 0x4047, 0x777: 0xa000, 0x778: 0x404f, 0x779: 0xa000, 0x77a: 0x4057, 0x77b: 0xa000, - 0x77c: 0x405f, 0x77d: 0xa000, 0x77e: 0x4067, 0x77f: 0xa000, - // Block 0x1e, offset 0x780 - 0x780: 0x406f, 0x781: 0xa000, 0x782: 0x4077, 0x784: 0xa000, 0x785: 0x407f, - 0x786: 0xa000, 0x787: 0x4087, 0x788: 0xa000, 0x789: 0x408f, - 0x78f: 0xa000, 0x790: 0x4097, 0x791: 0x409f, - 0x792: 0xa000, 0x793: 0x40a7, 0x794: 0x40af, 0x795: 0xa000, 0x796: 0x40b7, 0x797: 0x40bf, - 0x798: 0xa000, 0x799: 0x40c7, 0x79a: 0x40cf, 0x79b: 0xa000, 0x79c: 0x40d7, 0x79d: 0x40df, - 0x7af: 0xa000, - 0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x4017, - 0x7b7: 0x40e7, 0x7b8: 0x40ef, 0x7b9: 0x40f7, 0x7ba: 0x40ff, - 0x7bd: 0xa000, 0x7be: 0x4107, - // Block 0x1f, offset 0x7c0 - 0x7c0: 0x1472, 0x7c1: 0x0df6, 0x7c2: 0x14ce, 0x7c3: 0x149a, 0x7c4: 0x0f52, 0x7c5: 0x07e6, - 0x7c6: 0x09da, 0x7c7: 0x1726, 0x7c8: 0x1726, 0x7c9: 0x0b06, 0x7ca: 0x155a, 0x7cb: 0x0a3e, - 0x7cc: 0x0b02, 0x7cd: 0x0cea, 0x7ce: 0x10ca, 0x7cf: 0x125a, 0x7d0: 0x1392, 0x7d1: 0x13ce, - 0x7d2: 0x1402, 0x7d3: 0x1516, 0x7d4: 0x0e6e, 0x7d5: 0x0efa, 0x7d6: 0x0fa6, 0x7d7: 0x103e, - 0x7d8: 0x135a, 0x7d9: 0x1542, 0x7da: 0x166e, 0x7db: 0x080a, 0x7dc: 0x09ae, 0x7dd: 0x0e82, - 0x7de: 0x0fca, 0x7df: 0x138e, 0x7e0: 0x16be, 0x7e1: 0x0bae, 0x7e2: 0x0f72, 0x7e3: 0x137e, - 0x7e4: 0x1412, 0x7e5: 0x0d1e, 0x7e6: 0x12b6, 0x7e7: 0x13da, 0x7e8: 0x0c1a, 0x7e9: 0x0e0a, - 0x7ea: 0x0f12, 0x7eb: 0x1016, 0x7ec: 0x1522, 0x7ed: 0x084a, 0x7ee: 0x08e2, 0x7ef: 0x094e, - 0x7f0: 0x0d86, 0x7f1: 0x0e7a, 0x7f2: 0x0fc6, 0x7f3: 0x10ea, 0x7f4: 0x1272, 0x7f5: 0x1386, - 0x7f6: 0x139e, 0x7f7: 0x14c2, 0x7f8: 0x15ea, 0x7f9: 0x169e, 0x7fa: 0x16ba, 0x7fb: 0x1126, - 0x7fc: 0x1166, 0x7fd: 0x121e, 0x7fe: 0x133e, 0x7ff: 0x1576, - // Block 0x20, offset 0x800 - 0x800: 0x16c6, 0x801: 0x1446, 0x802: 0x0ac2, 0x803: 0x0c36, 0x804: 0x11d6, 0x805: 0x1296, - 0x806: 0x0ffa, 0x807: 0x112e, 0x808: 0x1492, 0x809: 0x15e2, 0x80a: 0x0abe, 0x80b: 0x0b8a, - 0x80c: 0x0e72, 0x80d: 0x0f26, 0x80e: 0x0f5a, 0x80f: 0x120e, 0x810: 0x1236, 0x811: 0x15a2, - 0x812: 0x094a, 0x813: 0x12a2, 0x814: 0x08ee, 0x815: 0x08ea, 0x816: 0x1192, 0x817: 0x1222, - 0x818: 0x1356, 0x819: 0x15aa, 0x81a: 0x1462, 0x81b: 0x0d22, 0x81c: 0x0e6e, 0x81d: 0x1452, - 0x81e: 0x07f2, 0x81f: 0x0b5e, 0x820: 0x0c8e, 0x821: 0x102a, 0x822: 0x10aa, 0x823: 0x096e, - 0x824: 0x1136, 0x825: 0x085a, 0x826: 0x0c72, 0x827: 0x07d2, 0x828: 0x0ee6, 0x829: 0x0d9e, - 0x82a: 0x120a, 0x82b: 0x09c2, 0x82c: 0x0aae, 0x82d: 0x10f6, 0x82e: 0x135e, 0x82f: 0x1436, - 0x830: 0x0eb2, 0x831: 0x14f2, 0x832: 0x0ede, 0x833: 0x0d32, 0x834: 0x1316, 0x835: 0x0d52, - 0x836: 0x10a6, 0x837: 0x0826, 0x838: 0x08a2, 0x839: 0x08e6, 0x83a: 0x0e4e, 0x83b: 0x11f6, - 0x83c: 0x12ee, 0x83d: 0x1442, 0x83e: 0x1556, 0x83f: 0x0956, - // Block 0x21, offset 0x840 - 0x840: 0x0a0a, 0x841: 0x0b12, 0x842: 0x0c2a, 0x843: 0x0dba, 0x844: 0x0f76, 0x845: 0x113a, - 0x846: 0x1592, 0x847: 0x1676, 0x848: 0x16ca, 0x849: 0x16e2, 0x84a: 0x0932, 0x84b: 0x0dee, - 0x84c: 0x0e9e, 0x84d: 0x14e6, 0x84e: 0x0bf6, 0x84f: 0x0cd2, 0x850: 0x0cee, 0x851: 0x0d7e, - 0x852: 0x0f66, 0x853: 0x0fb2, 0x854: 0x1062, 0x855: 0x1186, 0x856: 0x122a, 0x857: 0x128e, - 0x858: 0x14d6, 0x859: 0x1366, 0x85a: 0x14fe, 0x85b: 0x157a, 0x85c: 0x090a, 0x85d: 0x0936, - 0x85e: 0x0a1e, 0x85f: 0x0fa2, 0x860: 0x13ee, 0x861: 0x1436, 0x862: 0x0c16, 0x863: 0x0c86, - 0x864: 0x0d4a, 0x865: 0x0eaa, 0x866: 0x11d2, 0x867: 0x101e, 0x868: 0x0836, 0x869: 0x0a7a, - 0x86a: 0x0b5e, 0x86b: 0x0bc2, 0x86c: 0x0c92, 0x86d: 0x103a, 0x86e: 0x1056, 0x86f: 0x1266, - 0x870: 0x1286, 0x871: 0x155e, 0x872: 0x15de, 0x873: 0x15ee, 0x874: 0x162a, 0x875: 0x084e, - 0x876: 0x117a, 0x877: 0x154a, 0x878: 0x15c6, 0x879: 0x0caa, 0x87a: 0x0812, 0x87b: 0x0872, - 0x87c: 0x0b62, 0x87d: 0x0b82, 0x87e: 0x0daa, 0x87f: 0x0e6e, - // Block 0x22, offset 0x880 - 0x880: 0x0fbe, 0x881: 0x10c6, 0x882: 0x1372, 0x883: 0x1512, 0x884: 0x171e, 0x885: 0x0dde, - 0x886: 0x159e, 0x887: 0x092e, 0x888: 0x0e2a, 0x889: 0x0e36, 0x88a: 0x0f0a, 0x88b: 0x0f42, - 0x88c: 0x1046, 0x88d: 0x10a2, 0x88e: 0x1122, 0x88f: 0x1206, 0x890: 0x1636, 0x891: 0x08aa, - 0x892: 0x0cfe, 0x893: 0x15ae, 0x894: 0x0862, 0x895: 0x0ba6, 0x896: 0x0f2a, 0x897: 0x14da, - 0x898: 0x0c62, 0x899: 0x0cb2, 0x89a: 0x0e3e, 0x89b: 0x102a, 0x89c: 0x15b6, 0x89d: 0x0912, - 0x89e: 0x09fa, 0x89f: 0x0b92, 0x8a0: 0x0dce, 0x8a1: 0x0e1a, 0x8a2: 0x0e5a, 0x8a3: 0x0eee, - 0x8a4: 0x1042, 0x8a5: 0x10b6, 0x8a6: 0x1252, 0x8a7: 0x13f2, 0x8a8: 0x13fe, 0x8a9: 0x1552, - 0x8aa: 0x15d2, 0x8ab: 0x097e, 0x8ac: 0x0f46, 0x8ad: 0x09fe, 0x8ae: 0x0fc2, 0x8af: 0x1066, - 0x8b0: 0x1382, 0x8b1: 0x15ba, 0x8b2: 0x16a6, 0x8b3: 0x16ce, 0x8b4: 0x0e32, 0x8b5: 0x0f22, - 0x8b6: 0x12be, 0x8b7: 0x11b2, 0x8b8: 0x11be, 0x8b9: 0x11e2, 0x8ba: 0x1012, 0x8bb: 0x0f9a, - 0x8bc: 0x145e, 0x8bd: 0x082e, 0x8be: 0x1326, 0x8bf: 0x0916, - // Block 0x23, offset 0x8c0 - 0x8c0: 0x0906, 0x8c1: 0x0c06, 0x8c2: 0x0d26, 0x8c3: 0x11ee, 0x8c4: 0x0b4e, 0x8c5: 0x0efe, - 0x8c6: 0x0dea, 0x8c7: 0x14e2, 0x8c8: 0x13e2, 0x8c9: 0x15a6, 0x8ca: 0x141e, 0x8cb: 0x0c22, - 0x8cc: 0x0882, 0x8cd: 0x0a56, 0x8d0: 0x0aaa, - 0x8d2: 0x0dda, 0x8d5: 0x08f2, 0x8d6: 0x101a, 0x8d7: 0x10de, - 0x8d8: 0x1142, 0x8d9: 0x115e, 0x8da: 0x1162, 0x8db: 0x1176, 0x8dc: 0x15f6, 0x8dd: 0x11e6, - 0x8de: 0x126a, 0x8e0: 0x138a, 0x8e2: 0x144e, - 0x8e5: 0x1502, 0x8e6: 0x152e, - 0x8ea: 0x164a, 0x8eb: 0x164e, 0x8ec: 0x1652, 0x8ed: 0x16b6, 0x8ee: 0x1526, 0x8ef: 0x15c2, - 0x8f0: 0x0852, 0x8f1: 0x0876, 0x8f2: 0x088a, 0x8f3: 0x0946, 0x8f4: 0x0952, 0x8f5: 0x0992, - 0x8f6: 0x0a46, 0x8f7: 0x0a62, 0x8f8: 0x0a6a, 0x8f9: 0x0aa6, 0x8fa: 0x0ab2, 0x8fb: 0x0b8e, - 0x8fc: 0x0b96, 0x8fd: 0x0c9e, 0x8fe: 0x0cc6, 0x8ff: 0x0cce, - // Block 0x24, offset 0x900 - 0x900: 0x0ce6, 0x901: 0x0d92, 0x902: 0x0dc2, 0x903: 0x0de2, 0x904: 0x0e52, 0x905: 0x0f16, - 0x906: 0x0f32, 0x907: 0x0f62, 0x908: 0x0fb6, 0x909: 0x0fd6, 0x90a: 0x104a, 0x90b: 0x112a, - 0x90c: 0x1146, 0x90d: 0x114e, 0x90e: 0x114a, 0x90f: 0x1152, 0x910: 0x1156, 0x911: 0x115a, - 0x912: 0x116e, 0x913: 0x1172, 0x914: 0x1196, 0x915: 0x11aa, 0x916: 0x11c6, 0x917: 0x122a, - 0x918: 0x1232, 0x919: 0x123a, 0x91a: 0x124e, 0x91b: 0x1276, 0x91c: 0x12c6, 0x91d: 0x12fa, - 0x91e: 0x12fa, 0x91f: 0x1362, 0x920: 0x140a, 0x921: 0x1422, 0x922: 0x1456, 0x923: 0x145a, - 0x924: 0x149e, 0x925: 0x14a2, 0x926: 0x14fa, 0x927: 0x1502, 0x928: 0x15d6, 0x929: 0x161a, - 0x92a: 0x1632, 0x92b: 0x0c96, 0x92c: 0x184b, 0x92d: 0x12de, - 0x930: 0x07da, 0x931: 0x08de, 0x932: 0x089e, 0x933: 0x0846, 0x934: 0x0886, 0x935: 0x08b2, - 0x936: 0x0942, 0x937: 0x095e, 0x938: 0x0a46, 0x939: 0x0a32, 0x93a: 0x0a42, 0x93b: 0x0a5e, - 0x93c: 0x0aaa, 0x93d: 0x0aba, 0x93e: 0x0afe, 0x93f: 0x0b0a, - // Block 0x25, offset 0x940 - 0x940: 0x0b26, 0x941: 0x0b36, 0x942: 0x0c1e, 0x943: 0x0c26, 0x944: 0x0c56, 0x945: 0x0c76, - 0x946: 0x0ca6, 0x947: 0x0cbe, 0x948: 0x0cae, 0x949: 0x0cce, 0x94a: 0x0cc2, 0x94b: 0x0ce6, - 0x94c: 0x0d02, 0x94d: 0x0d5a, 0x94e: 0x0d66, 0x94f: 0x0d6e, 0x950: 0x0d96, 0x951: 0x0dda, - 0x952: 0x0e0a, 0x953: 0x0e0e, 0x954: 0x0e22, 0x955: 0x0ea2, 0x956: 0x0eb2, 0x957: 0x0f0a, - 0x958: 0x0f56, 0x959: 0x0f4e, 0x95a: 0x0f62, 0x95b: 0x0f7e, 0x95c: 0x0fb6, 0x95d: 0x110e, - 0x95e: 0x0fda, 0x95f: 0x100e, 0x960: 0x101a, 0x961: 0x105a, 0x962: 0x1076, 0x963: 0x109a, - 0x964: 0x10be, 0x965: 0x10c2, 0x966: 0x10de, 0x967: 0x10e2, 0x968: 0x10f2, 0x969: 0x1106, - 0x96a: 0x1102, 0x96b: 0x1132, 0x96c: 0x11ae, 0x96d: 0x11c6, 0x96e: 0x11de, 0x96f: 0x1216, - 0x970: 0x122a, 0x971: 0x1246, 0x972: 0x1276, 0x973: 0x132a, 0x974: 0x1352, 0x975: 0x13c6, - 0x976: 0x140e, 0x977: 0x141a, 0x978: 0x1422, 0x979: 0x143a, 0x97a: 0x144e, 0x97b: 0x143e, - 0x97c: 0x1456, 0x97d: 0x1452, 0x97e: 0x144a, 0x97f: 0x145a, - // Block 0x26, offset 0x980 - 0x980: 0x1466, 0x981: 0x14a2, 0x982: 0x14de, 0x983: 0x150e, 0x984: 0x1546, 0x985: 0x1566, - 0x986: 0x15b2, 0x987: 0x15d6, 0x988: 0x15f6, 0x989: 0x160a, 0x98a: 0x161a, 0x98b: 0x1626, - 0x98c: 0x1632, 0x98d: 0x1686, 0x98e: 0x1726, 0x98f: 0x17e2, 0x990: 0x17dd, 0x991: 0x180f, - 0x992: 0x0702, 0x993: 0x072a, 0x994: 0x072e, 0x995: 0x1891, 0x996: 0x18be, 0x997: 0x1936, - 0x998: 0x1712, 0x999: 0x1722, - // Block 0x27, offset 0x9c0 - 0x9c0: 0x07f6, 0x9c1: 0x07ee, 0x9c2: 0x07fe, 0x9c3: 0x1774, 0x9c4: 0x0842, 0x9c5: 0x0852, - 0x9c6: 0x0856, 0x9c7: 0x085e, 0x9c8: 0x0866, 0x9c9: 0x086a, 0x9ca: 0x0876, 0x9cb: 0x086e, - 0x9cc: 0x06ae, 0x9cd: 0x1788, 0x9ce: 0x088a, 0x9cf: 0x088e, 0x9d0: 0x0892, 0x9d1: 0x08ae, - 0x9d2: 0x1779, 0x9d3: 0x06b2, 0x9d4: 0x089a, 0x9d5: 0x08ba, 0x9d6: 0x1783, 0x9d7: 0x08ca, - 0x9d8: 0x08d2, 0x9d9: 0x0832, 0x9da: 0x08da, 0x9db: 0x08de, 0x9dc: 0x195e, 0x9dd: 0x08fa, - 0x9de: 0x0902, 0x9df: 0x06ba, 0x9e0: 0x091a, 0x9e1: 0x091e, 0x9e2: 0x0926, 0x9e3: 0x092a, - 0x9e4: 0x06be, 0x9e5: 0x0942, 0x9e6: 0x0946, 0x9e7: 0x0952, 0x9e8: 0x095e, 0x9e9: 0x0962, - 0x9ea: 0x0966, 0x9eb: 0x096e, 0x9ec: 0x098e, 0x9ed: 0x0992, 0x9ee: 0x099a, 0x9ef: 0x09aa, - 0x9f0: 0x09b2, 0x9f1: 0x09b6, 0x9f2: 0x09b6, 0x9f3: 0x09b6, 0x9f4: 0x1797, 0x9f5: 0x0f8e, - 0x9f6: 0x09ca, 0x9f7: 0x09d2, 0x9f8: 0x179c, 0x9f9: 0x09de, 0x9fa: 0x09e6, 0x9fb: 0x09ee, - 0x9fc: 0x0a16, 0x9fd: 0x0a02, 0x9fe: 0x0a0e, 0x9ff: 0x0a12, - // Block 0x28, offset 0xa00 - 0xa00: 0x0a1a, 0xa01: 0x0a22, 0xa02: 0x0a26, 0xa03: 0x0a2e, 0xa04: 0x0a36, 0xa05: 0x0a3a, - 0xa06: 0x0a3a, 0xa07: 0x0a42, 0xa08: 0x0a4a, 0xa09: 0x0a4e, 0xa0a: 0x0a5a, 0xa0b: 0x0a7e, - 0xa0c: 0x0a62, 0xa0d: 0x0a82, 0xa0e: 0x0a66, 0xa0f: 0x0a6e, 0xa10: 0x0906, 0xa11: 0x0aca, - 0xa12: 0x0a92, 0xa13: 0x0a96, 0xa14: 0x0a9a, 0xa15: 0x0a8e, 0xa16: 0x0aa2, 0xa17: 0x0a9e, - 0xa18: 0x0ab6, 0xa19: 0x17a1, 0xa1a: 0x0ad2, 0xa1b: 0x0ad6, 0xa1c: 0x0ade, 0xa1d: 0x0aea, - 0xa1e: 0x0af2, 0xa1f: 0x0b0e, 0xa20: 0x17a6, 0xa21: 0x17ab, 0xa22: 0x0b1a, 0xa23: 0x0b1e, - 0xa24: 0x0b22, 0xa25: 0x0b16, 0xa26: 0x0b2a, 0xa27: 0x06c2, 0xa28: 0x06c6, 0xa29: 0x0b32, - 0xa2a: 0x0b3a, 0xa2b: 0x0b3a, 0xa2c: 0x17b0, 0xa2d: 0x0b56, 0xa2e: 0x0b5a, 0xa2f: 0x0b5e, - 0xa30: 0x0b66, 0xa31: 0x17b5, 0xa32: 0x0b6e, 0xa33: 0x0b72, 0xa34: 0x0c4a, 0xa35: 0x0b7a, - 0xa36: 0x06ca, 0xa37: 0x0b86, 0xa38: 0x0b96, 0xa39: 0x0ba2, 0xa3a: 0x0b9e, 0xa3b: 0x17bf, - 0xa3c: 0x0baa, 0xa3d: 0x17c4, 0xa3e: 0x0bb6, 0xa3f: 0x0bb2, - // Block 0x29, offset 0xa40 - 0xa40: 0x0bba, 0xa41: 0x0bca, 0xa42: 0x0bce, 0xa43: 0x06ce, 0xa44: 0x0bde, 0xa45: 0x0be6, - 0xa46: 0x0bea, 0xa47: 0x0bee, 0xa48: 0x06d2, 0xa49: 0x17c9, 0xa4a: 0x06d6, 0xa4b: 0x0c0a, - 0xa4c: 0x0c0e, 0xa4d: 0x0c12, 0xa4e: 0x0c1a, 0xa4f: 0x1990, 0xa50: 0x0c32, 0xa51: 0x17d3, - 0xa52: 0x17d3, 0xa53: 0x12d2, 0xa54: 0x0c42, 0xa55: 0x0c42, 0xa56: 0x06da, 0xa57: 0x17f6, - 0xa58: 0x18c8, 0xa59: 0x0c52, 0xa5a: 0x0c5a, 0xa5b: 0x06de, 0xa5c: 0x0c6e, 0xa5d: 0x0c7e, - 0xa5e: 0x0c82, 0xa5f: 0x0c8a, 0xa60: 0x0c9a, 0xa61: 0x06e6, 0xa62: 0x06e2, 0xa63: 0x0c9e, - 0xa64: 0x17d8, 0xa65: 0x0ca2, 0xa66: 0x0cb6, 0xa67: 0x0cba, 0xa68: 0x0cbe, 0xa69: 0x0cba, - 0xa6a: 0x0cca, 0xa6b: 0x0cce, 0xa6c: 0x0cde, 0xa6d: 0x0cd6, 0xa6e: 0x0cda, 0xa6f: 0x0ce2, - 0xa70: 0x0ce6, 0xa71: 0x0cea, 0xa72: 0x0cf6, 0xa73: 0x0cfa, 0xa74: 0x0d12, 0xa75: 0x0d1a, - 0xa76: 0x0d2a, 0xa77: 0x0d3e, 0xa78: 0x17e7, 0xa79: 0x0d3a, 0xa7a: 0x0d2e, 0xa7b: 0x0d46, - 0xa7c: 0x0d4e, 0xa7d: 0x0d62, 0xa7e: 0x17ec, 0xa7f: 0x0d6a, - // Block 0x2a, offset 0xa80 - 0xa80: 0x0d5e, 0xa81: 0x0d56, 0xa82: 0x06ea, 0xa83: 0x0d72, 0xa84: 0x0d7a, 0xa85: 0x0d82, - 0xa86: 0x0d76, 0xa87: 0x06ee, 0xa88: 0x0d92, 0xa89: 0x0d9a, 0xa8a: 0x17f1, 0xa8b: 0x0dc6, - 0xa8c: 0x0dfa, 0xa8d: 0x0dd6, 0xa8e: 0x06fa, 0xa8f: 0x0de2, 0xa90: 0x06f6, 0xa91: 0x06f2, - 0xa92: 0x08be, 0xa93: 0x08c2, 0xa94: 0x0dfe, 0xa95: 0x0de6, 0xa96: 0x12a6, 0xa97: 0x075e, - 0xa98: 0x0e0a, 0xa99: 0x0e0e, 0xa9a: 0x0e12, 0xa9b: 0x0e26, 0xa9c: 0x0e1e, 0xa9d: 0x180a, - 0xa9e: 0x06fe, 0xa9f: 0x0e3a, 0xaa0: 0x0e2e, 0xaa1: 0x0e4a, 0xaa2: 0x0e52, 0xaa3: 0x1814, - 0xaa4: 0x0e56, 0xaa5: 0x0e42, 0xaa6: 0x0e5e, 0xaa7: 0x0702, 0xaa8: 0x0e62, 0xaa9: 0x0e66, - 0xaaa: 0x0e6a, 0xaab: 0x0e76, 0xaac: 0x1819, 0xaad: 0x0e7e, 0xaae: 0x0706, 0xaaf: 0x0e8a, - 0xab0: 0x181e, 0xab1: 0x0e8e, 0xab2: 0x070a, 0xab3: 0x0e9a, 0xab4: 0x0ea6, 0xab5: 0x0eb2, - 0xab6: 0x0eb6, 0xab7: 0x1823, 0xab8: 0x17ba, 0xab9: 0x1828, 0xaba: 0x0ed6, 0xabb: 0x182d, - 0xabc: 0x0ee2, 0xabd: 0x0eea, 0xabe: 0x0eda, 0xabf: 0x0ef6, - // Block 0x2b, offset 0xac0 - 0xac0: 0x0f06, 0xac1: 0x0f16, 0xac2: 0x0f0a, 0xac3: 0x0f0e, 0xac4: 0x0f1a, 0xac5: 0x0f1e, - 0xac6: 0x1832, 0xac7: 0x0f02, 0xac8: 0x0f36, 0xac9: 0x0f3a, 0xaca: 0x070e, 0xacb: 0x0f4e, - 0xacc: 0x0f4a, 0xacd: 0x1837, 0xace: 0x0f2e, 0xacf: 0x0f6a, 0xad0: 0x183c, 0xad1: 0x1841, - 0xad2: 0x0f6e, 0xad3: 0x0f82, 0xad4: 0x0f7e, 0xad5: 0x0f7a, 0xad6: 0x0712, 0xad7: 0x0f86, - 0xad8: 0x0f96, 0xad9: 0x0f92, 0xada: 0x0f9e, 0xadb: 0x177e, 0xadc: 0x0fae, 0xadd: 0x1846, - 0xade: 0x0fba, 0xadf: 0x1850, 0xae0: 0x0fce, 0xae1: 0x0fda, 0xae2: 0x0fee, 0xae3: 0x1855, - 0xae4: 0x1002, 0xae5: 0x1006, 0xae6: 0x185a, 0xae7: 0x185f, 0xae8: 0x1022, 0xae9: 0x1032, - 0xaea: 0x0716, 0xaeb: 0x1036, 0xaec: 0x071a, 0xaed: 0x071a, 0xaee: 0x104e, 0xaef: 0x1052, - 0xaf0: 0x105a, 0xaf1: 0x105e, 0xaf2: 0x106a, 0xaf3: 0x071e, 0xaf4: 0x1082, 0xaf5: 0x1864, - 0xaf6: 0x109e, 0xaf7: 0x1869, 0xaf8: 0x10aa, 0xaf9: 0x17ce, 0xafa: 0x10ba, 0xafb: 0x186e, - 0xafc: 0x1873, 0xafd: 0x1878, 0xafe: 0x0722, 0xaff: 0x0726, - // Block 0x2c, offset 0xb00 - 0xb00: 0x10f2, 0xb01: 0x1882, 0xb02: 0x187d, 0xb03: 0x1887, 0xb04: 0x188c, 0xb05: 0x10fa, - 0xb06: 0x10fe, 0xb07: 0x10fe, 0xb08: 0x1106, 0xb09: 0x072e, 0xb0a: 0x110a, 0xb0b: 0x0732, - 0xb0c: 0x0736, 0xb0d: 0x1896, 0xb0e: 0x111e, 0xb0f: 0x1126, 0xb10: 0x1132, 0xb11: 0x073a, - 0xb12: 0x189b, 0xb13: 0x1156, 0xb14: 0x18a0, 0xb15: 0x18a5, 0xb16: 0x1176, 0xb17: 0x118e, - 0xb18: 0x073e, 0xb19: 0x1196, 0xb1a: 0x119a, 0xb1b: 0x119e, 0xb1c: 0x18aa, 0xb1d: 0x18af, - 0xb1e: 0x18af, 0xb1f: 0x11b6, 0xb20: 0x0742, 0xb21: 0x18b4, 0xb22: 0x11ca, 0xb23: 0x11ce, - 0xb24: 0x0746, 0xb25: 0x18b9, 0xb26: 0x11ea, 0xb27: 0x074a, 0xb28: 0x11fa, 0xb29: 0x11f2, - 0xb2a: 0x1202, 0xb2b: 0x18c3, 0xb2c: 0x121a, 0xb2d: 0x074e, 0xb2e: 0x1226, 0xb2f: 0x122e, - 0xb30: 0x123e, 0xb31: 0x0752, 0xb32: 0x18cd, 0xb33: 0x18d2, 0xb34: 0x0756, 0xb35: 0x18d7, - 0xb36: 0x1256, 0xb37: 0x18dc, 0xb38: 0x1262, 0xb39: 0x126e, 0xb3a: 0x1276, 0xb3b: 0x18e1, - 0xb3c: 0x18e6, 0xb3d: 0x128a, 0xb3e: 0x18eb, 0xb3f: 0x1292, - // Block 0x2d, offset 0xb40 - 0xb40: 0x17fb, 0xb41: 0x075a, 0xb42: 0x12aa, 0xb43: 0x12ae, 0xb44: 0x0762, 0xb45: 0x12b2, - 0xb46: 0x0b2e, 0xb47: 0x18f0, 0xb48: 0x18f5, 0xb49: 0x1800, 0xb4a: 0x1805, 0xb4b: 0x12d2, - 0xb4c: 0x12d6, 0xb4d: 0x14ee, 0xb4e: 0x0766, 0xb4f: 0x1302, 0xb50: 0x12fe, 0xb51: 0x1306, - 0xb52: 0x093a, 0xb53: 0x130a, 0xb54: 0x130e, 0xb55: 0x1312, 0xb56: 0x131a, 0xb57: 0x18fa, - 0xb58: 0x1316, 0xb59: 0x131e, 0xb5a: 0x1332, 0xb5b: 0x1336, 0xb5c: 0x1322, 0xb5d: 0x133a, - 0xb5e: 0x134e, 0xb5f: 0x1362, 0xb60: 0x132e, 0xb61: 0x1342, 0xb62: 0x1346, 0xb63: 0x134a, - 0xb64: 0x18ff, 0xb65: 0x1909, 0xb66: 0x1904, 0xb67: 0x076a, 0xb68: 0x136a, 0xb69: 0x136e, - 0xb6a: 0x1376, 0xb6b: 0x191d, 0xb6c: 0x137a, 0xb6d: 0x190e, 0xb6e: 0x076e, 0xb6f: 0x0772, - 0xb70: 0x1913, 0xb71: 0x1918, 0xb72: 0x0776, 0xb73: 0x139a, 0xb74: 0x139e, 0xb75: 0x13a2, - 0xb76: 0x13a6, 0xb77: 0x13b2, 0xb78: 0x13ae, 0xb79: 0x13ba, 0xb7a: 0x13b6, 0xb7b: 0x13c6, - 0xb7c: 0x13be, 0xb7d: 0x13c2, 0xb7e: 0x13ca, 0xb7f: 0x077a, - // Block 0x2e, offset 0xb80 - 0xb80: 0x13d2, 0xb81: 0x13d6, 0xb82: 0x077e, 0xb83: 0x13e6, 0xb84: 0x13ea, 0xb85: 0x1922, - 0xb86: 0x13f6, 0xb87: 0x13fa, 0xb88: 0x0782, 0xb89: 0x1406, 0xb8a: 0x06b6, 0xb8b: 0x1927, - 0xb8c: 0x192c, 0xb8d: 0x0786, 0xb8e: 0x078a, 0xb8f: 0x1432, 0xb90: 0x144a, 0xb91: 0x1466, - 0xb92: 0x1476, 0xb93: 0x1931, 0xb94: 0x148a, 0xb95: 0x148e, 0xb96: 0x14a6, 0xb97: 0x14b2, - 0xb98: 0x193b, 0xb99: 0x178d, 0xb9a: 0x14be, 0xb9b: 0x14ba, 0xb9c: 0x14c6, 0xb9d: 0x1792, - 0xb9e: 0x14d2, 0xb9f: 0x14de, 0xba0: 0x1940, 0xba1: 0x1945, 0xba2: 0x151e, 0xba3: 0x152a, - 0xba4: 0x1532, 0xba5: 0x194a, 0xba6: 0x1536, 0xba7: 0x1562, 0xba8: 0x156e, 0xba9: 0x1572, - 0xbaa: 0x156a, 0xbab: 0x157e, 0xbac: 0x1582, 0xbad: 0x194f, 0xbae: 0x158e, 0xbaf: 0x078e, - 0xbb0: 0x1596, 0xbb1: 0x1954, 0xbb2: 0x0792, 0xbb3: 0x15ce, 0xbb4: 0x0bbe, 0xbb5: 0x15e6, - 0xbb6: 0x1959, 0xbb7: 0x1963, 0xbb8: 0x0796, 0xbb9: 0x079a, 0xbba: 0x160e, 0xbbb: 0x1968, - 0xbbc: 0x079e, 0xbbd: 0x196d, 0xbbe: 0x1626, 0xbbf: 0x1626, - // Block 0x2f, offset 0xbc0 - 0xbc0: 0x162e, 0xbc1: 0x1972, 0xbc2: 0x1646, 0xbc3: 0x07a2, 0xbc4: 0x1656, 0xbc5: 0x1662, - 0xbc6: 0x166a, 0xbc7: 0x1672, 0xbc8: 0x07a6, 0xbc9: 0x1977, 0xbca: 0x1686, 0xbcb: 0x16a2, - 0xbcc: 0x16ae, 0xbcd: 0x07aa, 0xbce: 0x07ae, 0xbcf: 0x16b2, 0xbd0: 0x197c, 0xbd1: 0x07b2, - 0xbd2: 0x1981, 0xbd3: 0x1986, 0xbd4: 0x198b, 0xbd5: 0x16d6, 0xbd6: 0x07b6, 0xbd7: 0x16ea, - 0xbd8: 0x16f2, 0xbd9: 0x16f6, 0xbda: 0x16fe, 0xbdb: 0x1706, 0xbdc: 0x170e, 0xbdd: 0x1995, -} - -// nfcIndex: 22 blocks, 1408 entries, 1408 bytes -// Block 0 is the zero block. -var nfcIndex = [1408]uint8{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04, - 0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32, - 0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35, - 0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, - 0xf0: 0x13, - // Block 0x4, offset 0x100 - 0x120: 0x3b, 0x121: 0x3c, 0x122: 0x3d, 0x123: 0x0d, 0x124: 0x3e, 0x125: 0x3f, 0x126: 0x40, 0x127: 0x41, - 0x128: 0x42, 0x129: 0x43, 0x12a: 0x44, 0x12b: 0x45, 0x12c: 0x40, 0x12d: 0x46, 0x12e: 0x47, 0x12f: 0x48, - 0x130: 0x44, 0x131: 0x49, 0x132: 0x4a, 0x133: 0x4b, 0x134: 0x4c, 0x135: 0x4d, 0x137: 0x4e, - 0x138: 0x4f, 0x139: 0x50, 0x13a: 0x51, 0x13b: 0x52, 0x13c: 0x53, 0x13d: 0x54, 0x13e: 0x55, 0x13f: 0x56, - // Block 0x5, offset 0x140 - 0x140: 0x57, 0x142: 0x58, 0x144: 0x59, 0x145: 0x5a, 0x146: 0x5b, 0x147: 0x5c, - 0x14d: 0x5d, - 0x15c: 0x5e, 0x15f: 0x5f, - 0x162: 0x60, 0x164: 0x61, - 0x168: 0x62, 0x169: 0x63, 0x16a: 0x64, 0x16b: 0x65, 0x16c: 0x0e, 0x16d: 0x66, 0x16e: 0x67, 0x16f: 0x68, - 0x170: 0x69, 0x173: 0x6a, 0x177: 0x0f, - 0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17, - // Block 0x6, offset 0x180 - 0x180: 0x6b, 0x183: 0x6c, 0x184: 0x6d, 0x186: 0x6e, 0x187: 0x6f, - 0x188: 0x70, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x71, 0x18c: 0x72, - 0x1ab: 0x73, - 0x1b3: 0x74, 0x1b5: 0x75, 0x1b7: 0x76, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x77, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x78, 0x1c5: 0x79, - 0x1c9: 0x7a, 0x1cc: 0x7b, 0x1cd: 0x7c, - // Block 0x8, offset 0x200 - 0x219: 0x7d, 0x21a: 0x7e, 0x21b: 0x7f, - 0x220: 0x80, 0x223: 0x81, 0x224: 0x82, 0x225: 0x83, 0x226: 0x84, 0x227: 0x85, - 0x22a: 0x86, 0x22b: 0x87, 0x22f: 0x88, - 0x230: 0x89, 0x231: 0x8a, 0x232: 0x8b, 0x233: 0x8c, 0x234: 0x8d, 0x235: 0x8e, 0x236: 0x8f, 0x237: 0x89, - 0x238: 0x8a, 0x239: 0x8b, 0x23a: 0x8c, 0x23b: 0x8d, 0x23c: 0x8e, 0x23d: 0x8f, 0x23e: 0x89, 0x23f: 0x8a, - // Block 0x9, offset 0x240 - 0x240: 0x8b, 0x241: 0x8c, 0x242: 0x8d, 0x243: 0x8e, 0x244: 0x8f, 0x245: 0x89, 0x246: 0x8a, 0x247: 0x8b, - 0x248: 0x8c, 0x249: 0x8d, 0x24a: 0x8e, 0x24b: 0x8f, 0x24c: 0x89, 0x24d: 0x8a, 0x24e: 0x8b, 0x24f: 0x8c, - 0x250: 0x8d, 0x251: 0x8e, 0x252: 0x8f, 0x253: 0x89, 0x254: 0x8a, 0x255: 0x8b, 0x256: 0x8c, 0x257: 0x8d, - 0x258: 0x8e, 0x259: 0x8f, 0x25a: 0x89, 0x25b: 0x8a, 0x25c: 0x8b, 0x25d: 0x8c, 0x25e: 0x8d, 0x25f: 0x8e, - 0x260: 0x8f, 0x261: 0x89, 0x262: 0x8a, 0x263: 0x8b, 0x264: 0x8c, 0x265: 0x8d, 0x266: 0x8e, 0x267: 0x8f, - 0x268: 0x89, 0x269: 0x8a, 0x26a: 0x8b, 0x26b: 0x8c, 0x26c: 0x8d, 0x26d: 0x8e, 0x26e: 0x8f, 0x26f: 0x89, - 0x270: 0x8a, 0x271: 0x8b, 0x272: 0x8c, 0x273: 0x8d, 0x274: 0x8e, 0x275: 0x8f, 0x276: 0x89, 0x277: 0x8a, - 0x278: 0x8b, 0x279: 0x8c, 0x27a: 0x8d, 0x27b: 0x8e, 0x27c: 0x8f, 0x27d: 0x89, 0x27e: 0x8a, 0x27f: 0x8b, - // Block 0xa, offset 0x280 - 0x280: 0x8c, 0x281: 0x8d, 0x282: 0x8e, 0x283: 0x8f, 0x284: 0x89, 0x285: 0x8a, 0x286: 0x8b, 0x287: 0x8c, - 0x288: 0x8d, 0x289: 0x8e, 0x28a: 0x8f, 0x28b: 0x89, 0x28c: 0x8a, 0x28d: 0x8b, 0x28e: 0x8c, 0x28f: 0x8d, - 0x290: 0x8e, 0x291: 0x8f, 0x292: 0x89, 0x293: 0x8a, 0x294: 0x8b, 0x295: 0x8c, 0x296: 0x8d, 0x297: 0x8e, - 0x298: 0x8f, 0x299: 0x89, 0x29a: 0x8a, 0x29b: 0x8b, 0x29c: 0x8c, 0x29d: 0x8d, 0x29e: 0x8e, 0x29f: 0x8f, - 0x2a0: 0x89, 0x2a1: 0x8a, 0x2a2: 0x8b, 0x2a3: 0x8c, 0x2a4: 0x8d, 0x2a5: 0x8e, 0x2a6: 0x8f, 0x2a7: 0x89, - 0x2a8: 0x8a, 0x2a9: 0x8b, 0x2aa: 0x8c, 0x2ab: 0x8d, 0x2ac: 0x8e, 0x2ad: 0x8f, 0x2ae: 0x89, 0x2af: 0x8a, - 0x2b0: 0x8b, 0x2b1: 0x8c, 0x2b2: 0x8d, 0x2b3: 0x8e, 0x2b4: 0x8f, 0x2b5: 0x89, 0x2b6: 0x8a, 0x2b7: 0x8b, - 0x2b8: 0x8c, 0x2b9: 0x8d, 0x2ba: 0x8e, 0x2bb: 0x8f, 0x2bc: 0x89, 0x2bd: 0x8a, 0x2be: 0x8b, 0x2bf: 0x8c, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x8d, 0x2c1: 0x8e, 0x2c2: 0x8f, 0x2c3: 0x89, 0x2c4: 0x8a, 0x2c5: 0x8b, 0x2c6: 0x8c, 0x2c7: 0x8d, - 0x2c8: 0x8e, 0x2c9: 0x8f, 0x2ca: 0x89, 0x2cb: 0x8a, 0x2cc: 0x8b, 0x2cd: 0x8c, 0x2ce: 0x8d, 0x2cf: 0x8e, - 0x2d0: 0x8f, 0x2d1: 0x89, 0x2d2: 0x8a, 0x2d3: 0x8b, 0x2d4: 0x8c, 0x2d5: 0x8d, 0x2d6: 0x8e, 0x2d7: 0x8f, - 0x2d8: 0x89, 0x2d9: 0x8a, 0x2da: 0x8b, 0x2db: 0x8c, 0x2dc: 0x8d, 0x2dd: 0x8e, 0x2de: 0x90, - // Block 0xc, offset 0x300 - 0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20, - 0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x91, 0x32d: 0x92, 0x32e: 0x93, - 0x331: 0x94, 0x332: 0x95, 0x333: 0x96, 0x334: 0x97, - 0x338: 0x98, 0x339: 0x99, 0x33a: 0x9a, 0x33b: 0x9b, 0x33e: 0x9c, 0x33f: 0x9d, - // Block 0xd, offset 0x340 - 0x347: 0x9e, - 0x34b: 0x9f, 0x34d: 0xa0, - 0x357: 0xa1, - 0x368: 0xa2, 0x36b: 0xa3, - 0x374: 0xa4, 0x375: 0xa5, - 0x37a: 0xa6, 0x37b: 0xa7, 0x37d: 0xa8, 0x37e: 0xa9, - // Block 0xe, offset 0x380 - 0x381: 0xaa, 0x382: 0xab, 0x384: 0xac, 0x385: 0x84, 0x387: 0xad, - 0x388: 0xae, 0x38b: 0xaf, 0x38c: 0xb0, 0x38d: 0xb1, 0x38e: 0xb2, 0x38f: 0xb3, - 0x391: 0xb4, 0x392: 0xb5, 0x393: 0xb6, 0x396: 0xb7, 0x397: 0xb8, - 0x398: 0x75, 0x39a: 0xb9, 0x39c: 0xba, - 0x3a0: 0xbb, 0x3a4: 0xbc, 0x3a5: 0xbd, 0x3a7: 0xbe, - 0x3a8: 0xbf, 0x3a9: 0xc0, 0x3aa: 0xc1, - 0x3b0: 0x75, 0x3b5: 0xc2, 0x3b6: 0xc3, - 0x3bd: 0xc4, - // Block 0xf, offset 0x3c0 - 0x3c4: 0xc5, - 0x3eb: 0xc6, 0x3ec: 0xc7, - 0x3f5: 0xc8, - 0x3ff: 0xc9, - // Block 0x10, offset 0x400 - 0x432: 0xca, - // Block 0x11, offset 0x440 - 0x445: 0xcb, 0x446: 0xcc, 0x447: 0xcd, - 0x449: 0xce, - // Block 0x12, offset 0x480 - 0x480: 0xcf, 0x482: 0xd0, 0x484: 0xc7, - 0x48a: 0xd1, 0x48b: 0xd2, - 0x493: 0xd3, 0x497: 0xd4, - 0x49b: 0xd5, - 0x4a3: 0xd6, 0x4a5: 0xd7, - // Block 0x13, offset 0x4c0 - 0x4c8: 0xd8, - // Block 0x14, offset 0x500 - 0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c, - 0x528: 0x2d, - // Block 0x15, offset 0x540 - 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, - 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, - 0x56f: 0x12, -} - -// nfcSparseOffset: 171 entries, 342 bytes -var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x6e, 0x76, 0x7d, 0x80, 0x88, 0x8c, 0x90, 0x92, 0x94, 0x9d, 0xa1, 0xa8, 0xad, 0xb0, 0xba, 0xbd, 0xc4, 0xcc, 0xcf, 0xd1, 0xd4, 0xd6, 0xdb, 0xec, 0xf8, 0xfa, 0x100, 0x102, 0x104, 0x106, 0x108, 0x10a, 0x10c, 0x10f, 0x112, 0x114, 0x117, 0x11a, 0x11e, 0x124, 0x130, 0x139, 0x13b, 0x13e, 0x140, 0x14b, 0x14f, 0x15d, 0x160, 0x166, 0x16c, 0x177, 0x17b, 0x17d, 0x17f, 0x181, 0x183, 0x185, 0x18b, 0x18f, 0x191, 0x193, 0x19b, 0x19f, 0x1a2, 0x1a4, 0x1a6, 0x1a9, 0x1ac, 0x1ae, 0x1b0, 0x1b2, 0x1b4, 0x1ba, 0x1bd, 0x1bf, 0x1c6, 0x1cc, 0x1d2, 0x1da, 0x1e0, 0x1e6, 0x1ec, 0x1f0, 0x1fe, 0x207, 0x20a, 0x20d, 0x20f, 0x212, 0x214, 0x218, 0x21d, 0x21f, 0x221, 0x226, 0x22c, 0x22e, 0x230, 0x232, 0x237, 0x23d, 0x240, 0x242, 0x244, 0x246, 0x249, 0x24f, 0x253, 0x257, 0x25f, 0x266, 0x269, 0x26c, 0x26e, 0x271, 0x279, 0x283, 0x28a, 0x28e, 0x295, 0x298, 0x29e, 0x2a0, 0x2a3, 0x2a5, 0x2a8, 0x2ad, 0x2af, 0x2b1, 0x2b3, 0x2b5, 0x2b7, 0x2ba, 0x2bc, 0x2be, 0x2cb, 0x2cd, 0x2cf, 0x2d5, 0x2d7, 0x2d9, 0x2e6, 0x2f0, 0x2f2, 0x2f4, 0x2fa, 0x2fc, 0x2fe, 0x300, 0x304, 0x307, 0x30c, 0x30e, 0x311} - -// nfcSparseValues: 787 entries, 3148 bytes -var nfcSparseValues = [787]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0000, lo: 0x04}, - {value: 0xa100, lo: 0xa8, hi: 0xa8}, - {value: 0x8100, lo: 0xaf, hi: 0xaf}, - {value: 0x8100, lo: 0xb4, hi: 0xb4}, - {value: 0x8100, lo: 0xb8, hi: 0xb8}, - // Block 0x1, offset 0x5 - {value: 0x0091, lo: 0x03}, - {value: 0x4859, lo: 0xa0, hi: 0xa1}, - {value: 0x488b, lo: 0xaf, hi: 0xb0}, - {value: 0xa000, lo: 0xb7, hi: 0xb7}, - // Block 0x2, offset 0x9 - {value: 0x0000, lo: 0x01}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - // Block 0x3, offset 0xb - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0x98, hi: 0x9d}, - // Block 0x4, offset 0xd - {value: 0x0006, lo: 0x0a}, - {value: 0xa000, lo: 0x81, hi: 0x81}, - {value: 0xa000, lo: 0x85, hi: 0x85}, - {value: 0xa000, lo: 0x89, hi: 0x89}, - {value: 0x49b7, lo: 0x8a, hi: 0x8a}, - {value: 0x49d5, lo: 0x8b, hi: 0x8b}, - {value: 0x3626, lo: 0x8c, hi: 0x8c}, - {value: 0x363e, lo: 0x8d, hi: 0x8d}, - {value: 0x49ed, lo: 0x8e, hi: 0x8e}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x365c, lo: 0x93, hi: 0x94}, - // Block 0x5, offset 0x18 - {value: 0x0000, lo: 0x0f}, - {value: 0xa000, lo: 0x83, hi: 0x83}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0xa000, lo: 0x8b, hi: 0x8b}, - {value: 0xa000, lo: 0x8d, hi: 0x8d}, - {value: 0x3704, lo: 0x90, hi: 0x90}, - {value: 0x3710, lo: 0x91, hi: 0x91}, - {value: 0x36fe, lo: 0x93, hi: 0x93}, - {value: 0xa000, lo: 0x96, hi: 0x96}, - {value: 0x3776, lo: 0x97, hi: 0x97}, - {value: 0x3740, lo: 0x9c, hi: 0x9c}, - {value: 0x3728, lo: 0x9d, hi: 0x9d}, - {value: 0x3752, lo: 0x9e, hi: 0x9e}, - {value: 0xa000, lo: 0xb4, hi: 0xb5}, - {value: 0x377c, lo: 0xb6, hi: 0xb6}, - {value: 0x3782, lo: 0xb7, hi: 0xb7}, - // Block 0x6, offset 0x28 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x83, hi: 0x87}, - // Block 0x7, offset 0x2a - {value: 0x0001, lo: 0x04}, - {value: 0x8114, lo: 0x81, hi: 0x82}, - {value: 0x8133, lo: 0x84, hi: 0x84}, - {value: 0x812e, lo: 0x85, hi: 0x85}, - {value: 0x810e, lo: 0x87, hi: 0x87}, - // Block 0x8, offset 0x2f - {value: 0x0000, lo: 0x0a}, - {value: 0x8133, lo: 0x90, hi: 0x97}, - {value: 0x811a, lo: 0x98, hi: 0x98}, - {value: 0x811b, lo: 0x99, hi: 0x99}, - {value: 0x811c, lo: 0x9a, hi: 0x9a}, - {value: 0x37a0, lo: 0xa2, hi: 0xa2}, - {value: 0x37a6, lo: 0xa3, hi: 0xa3}, - {value: 0x37b2, lo: 0xa4, hi: 0xa4}, - {value: 0x37ac, lo: 0xa5, hi: 0xa5}, - {value: 0x37b8, lo: 0xa6, hi: 0xa6}, - {value: 0xa000, lo: 0xa7, hi: 0xa7}, - // Block 0x9, offset 0x3a - {value: 0x0000, lo: 0x0e}, - {value: 0x37ca, lo: 0x80, hi: 0x80}, - {value: 0xa000, lo: 0x81, hi: 0x81}, - {value: 0x37be, lo: 0x82, hi: 0x82}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x37c4, lo: 0x93, hi: 0x93}, - {value: 0xa000, lo: 0x95, hi: 0x95}, - {value: 0x8133, lo: 0x96, hi: 0x9c}, - {value: 0x8133, lo: 0x9f, hi: 0xa2}, - {value: 0x812e, lo: 0xa3, hi: 0xa3}, - {value: 0x8133, lo: 0xa4, hi: 0xa4}, - {value: 0x8133, lo: 0xa7, hi: 0xa8}, - {value: 0x812e, lo: 0xaa, hi: 0xaa}, - {value: 0x8133, lo: 0xab, hi: 0xac}, - {value: 0x812e, lo: 0xad, hi: 0xad}, - // Block 0xa, offset 0x49 - {value: 0x0000, lo: 0x0c}, - {value: 0x8120, lo: 0x91, hi: 0x91}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - {value: 0x812e, lo: 0xb1, hi: 0xb1}, - {value: 0x8133, lo: 0xb2, hi: 0xb3}, - {value: 0x812e, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb5, hi: 0xb6}, - {value: 0x812e, lo: 0xb7, hi: 0xb9}, - {value: 0x8133, lo: 0xba, hi: 0xba}, - {value: 0x812e, lo: 0xbb, hi: 0xbc}, - {value: 0x8133, lo: 0xbd, hi: 0xbd}, - {value: 0x812e, lo: 0xbe, hi: 0xbe}, - {value: 0x8133, lo: 0xbf, hi: 0xbf}, - // Block 0xb, offset 0x56 - {value: 0x0005, lo: 0x07}, - {value: 0x8133, lo: 0x80, hi: 0x80}, - {value: 0x8133, lo: 0x81, hi: 0x81}, - {value: 0x812e, lo: 0x82, hi: 0x83}, - {value: 0x812e, lo: 0x84, hi: 0x85}, - {value: 0x812e, lo: 0x86, hi: 0x87}, - {value: 0x812e, lo: 0x88, hi: 0x89}, - {value: 0x8133, lo: 0x8a, hi: 0x8a}, - // Block 0xc, offset 0x5e - {value: 0x0000, lo: 0x04}, - {value: 0x8133, lo: 0xab, hi: 0xb1}, - {value: 0x812e, lo: 0xb2, hi: 0xb2}, - {value: 0x8133, lo: 0xb3, hi: 0xb3}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - // Block 0xd, offset 0x63 - {value: 0x0000, lo: 0x04}, - {value: 0x8133, lo: 0x96, hi: 0x99}, - {value: 0x8133, lo: 0x9b, hi: 0xa3}, - {value: 0x8133, lo: 0xa5, hi: 0xa7}, - {value: 0x8133, lo: 0xa9, hi: 0xad}, - // Block 0xe, offset 0x68 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x99, hi: 0x9b}, - // Block 0xf, offset 0x6a - {value: 0x0000, lo: 0x03}, - {value: 0x8133, lo: 0x97, hi: 0x98}, - {value: 0x812e, lo: 0x99, hi: 0x9b}, - {value: 0x8133, lo: 0x9c, hi: 0x9f}, - // Block 0x10, offset 0x6e - {value: 0x0000, lo: 0x07}, - {value: 0xa000, lo: 0xa8, hi: 0xa8}, - {value: 0x3e37, lo: 0xa9, hi: 0xa9}, - {value: 0xa000, lo: 0xb0, hi: 0xb0}, - {value: 0x3e3f, lo: 0xb1, hi: 0xb1}, - {value: 0xa000, lo: 0xb3, hi: 0xb3}, - {value: 0x3e47, lo: 0xb4, hi: 0xb4}, - {value: 0x9903, lo: 0xbc, hi: 0xbc}, - // Block 0x11, offset 0x76 - {value: 0x0008, lo: 0x06}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x8133, lo: 0x91, hi: 0x91}, - {value: 0x812e, lo: 0x92, hi: 0x92}, - {value: 0x8133, lo: 0x93, hi: 0x93}, - {value: 0x8133, lo: 0x94, hi: 0x94}, - {value: 0x461b, lo: 0x98, hi: 0x9f}, - // Block 0x12, offset 0x7d - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x13, offset 0x80 - {value: 0x0008, lo: 0x07}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x3e4f, lo: 0x8b, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x465b, lo: 0x9c, hi: 0x9d}, - {value: 0x466b, lo: 0x9f, hi: 0x9f}, - {value: 0x8133, lo: 0xbe, hi: 0xbe}, - // Block 0x14, offset 0x88 - {value: 0x0000, lo: 0x03}, - {value: 0x4693, lo: 0xb3, hi: 0xb3}, - {value: 0x469b, lo: 0xb6, hi: 0xb6}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - // Block 0x15, offset 0x8c - {value: 0x0008, lo: 0x03}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x4673, lo: 0x99, hi: 0x9b}, - {value: 0x468b, lo: 0x9e, hi: 0x9e}, - // Block 0x16, offset 0x90 - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - // Block 0x17, offset 0x92 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - // Block 0x18, offset 0x94 - {value: 0x0000, lo: 0x08}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x3e67, lo: 0x88, hi: 0x88}, - {value: 0x3e5f, lo: 0x8b, hi: 0x8b}, - {value: 0x3e6f, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x96, hi: 0x97}, - {value: 0x46a3, lo: 0x9c, hi: 0x9c}, - {value: 0x46ab, lo: 0x9d, hi: 0x9d}, - // Block 0x19, offset 0x9d - {value: 0x0000, lo: 0x03}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x3e77, lo: 0x94, hi: 0x94}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x1a, offset 0xa1 - {value: 0x0000, lo: 0x06}, - {value: 0xa000, lo: 0x86, hi: 0x87}, - {value: 0x3e7f, lo: 0x8a, hi: 0x8a}, - {value: 0x3e8f, lo: 0x8b, hi: 0x8b}, - {value: 0x3e87, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - // Block 0x1b, offset 0xa8 - {value: 0x1801, lo: 0x04}, - {value: 0xa000, lo: 0x86, hi: 0x86}, - {value: 0x3e97, lo: 0x88, hi: 0x88}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x8121, lo: 0x95, hi: 0x96}, - // Block 0x1c, offset 0xad - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - {value: 0xa000, lo: 0xbf, hi: 0xbf}, - // Block 0x1d, offset 0xb0 - {value: 0x0000, lo: 0x09}, - {value: 0x3e9f, lo: 0x80, hi: 0x80}, - {value: 0x9900, lo: 0x82, hi: 0x82}, - {value: 0xa000, lo: 0x86, hi: 0x86}, - {value: 0x3ea7, lo: 0x87, hi: 0x87}, - {value: 0x3eaf, lo: 0x88, hi: 0x88}, - {value: 0x4b25, lo: 0x8a, hi: 0x8a}, - {value: 0x4331, lo: 0x8b, hi: 0x8b}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x95, hi: 0x96}, - // Block 0x1e, offset 0xba - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xbb, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x1f, offset 0xbd - {value: 0x0000, lo: 0x06}, - {value: 0xa000, lo: 0x86, hi: 0x87}, - {value: 0x3eb7, lo: 0x8a, hi: 0x8a}, - {value: 0x3ec7, lo: 0x8b, hi: 0x8b}, - {value: 0x3ebf, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - // Block 0x20, offset 0xc4 - {value: 0x5a29, lo: 0x07}, - {value: 0x9905, lo: 0x8a, hi: 0x8a}, - {value: 0x9900, lo: 0x8f, hi: 0x8f}, - {value: 0xa000, lo: 0x99, hi: 0x99}, - {value: 0x3ecf, lo: 0x9a, hi: 0x9a}, - {value: 0x4b2d, lo: 0x9c, hi: 0x9c}, - {value: 0x433c, lo: 0x9d, hi: 0x9d}, - {value: 0x3ed7, lo: 0x9e, hi: 0x9f}, - // Block 0x21, offset 0xcc - {value: 0x0000, lo: 0x02}, - {value: 0x8123, lo: 0xb8, hi: 0xb9}, - {value: 0x8105, lo: 0xba, hi: 0xba}, - // Block 0x22, offset 0xcf - {value: 0x0000, lo: 0x01}, - {value: 0x8124, lo: 0x88, hi: 0x8b}, - // Block 0x23, offset 0xd1 - {value: 0x0000, lo: 0x02}, - {value: 0x8125, lo: 0xb8, hi: 0xb9}, - {value: 0x8105, lo: 0xba, hi: 0xba}, - // Block 0x24, offset 0xd4 - {value: 0x0000, lo: 0x01}, - {value: 0x8126, lo: 0x88, hi: 0x8b}, - // Block 0x25, offset 0xd6 - {value: 0x0000, lo: 0x04}, - {value: 0x812e, lo: 0x98, hi: 0x99}, - {value: 0x812e, lo: 0xb5, hi: 0xb5}, - {value: 0x812e, lo: 0xb7, hi: 0xb7}, - {value: 0x812c, lo: 0xb9, hi: 0xb9}, - // Block 0x26, offset 0xdb - {value: 0x0000, lo: 0x10}, - {value: 0x2774, lo: 0x83, hi: 0x83}, - {value: 0x277b, lo: 0x8d, hi: 0x8d}, - {value: 0x2782, lo: 0x92, hi: 0x92}, - {value: 0x2789, lo: 0x97, hi: 0x97}, - {value: 0x2790, lo: 0x9c, hi: 0x9c}, - {value: 0x276d, lo: 0xa9, hi: 0xa9}, - {value: 0x8127, lo: 0xb1, hi: 0xb1}, - {value: 0x8128, lo: 0xb2, hi: 0xb2}, - {value: 0x4ca5, lo: 0xb3, hi: 0xb3}, - {value: 0x8129, lo: 0xb4, hi: 0xb4}, - {value: 0x4cae, lo: 0xb5, hi: 0xb5}, - {value: 0x46b3, lo: 0xb6, hi: 0xb6}, - {value: 0x8200, lo: 0xb7, hi: 0xb7}, - {value: 0x46bb, lo: 0xb8, hi: 0xb8}, - {value: 0x8200, lo: 0xb9, hi: 0xb9}, - {value: 0x8128, lo: 0xba, hi: 0xbd}, - // Block 0x27, offset 0xec - {value: 0x0000, lo: 0x0b}, - {value: 0x8128, lo: 0x80, hi: 0x80}, - {value: 0x4cb7, lo: 0x81, hi: 0x81}, - {value: 0x8133, lo: 0x82, hi: 0x83}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0x86, hi: 0x87}, - {value: 0x279e, lo: 0x93, hi: 0x93}, - {value: 0x27a5, lo: 0x9d, hi: 0x9d}, - {value: 0x27ac, lo: 0xa2, hi: 0xa2}, - {value: 0x27b3, lo: 0xa7, hi: 0xa7}, - {value: 0x27ba, lo: 0xac, hi: 0xac}, - {value: 0x2797, lo: 0xb9, hi: 0xb9}, - // Block 0x28, offset 0xf8 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x86, hi: 0x86}, - // Block 0x29, offset 0xfa - {value: 0x0000, lo: 0x05}, - {value: 0xa000, lo: 0xa5, hi: 0xa5}, - {value: 0x3edf, lo: 0xa6, hi: 0xa6}, - {value: 0x9900, lo: 0xae, hi: 0xae}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - {value: 0x8105, lo: 0xb9, hi: 0xba}, - // Block 0x2a, offset 0x100 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x8d, hi: 0x8d}, - // Block 0x2b, offset 0x102 - {value: 0x0000, lo: 0x01}, - {value: 0xa000, lo: 0x80, hi: 0x92}, - // Block 0x2c, offset 0x104 - {value: 0x0000, lo: 0x01}, - {value: 0xb900, lo: 0xa1, hi: 0xb5}, - // Block 0x2d, offset 0x106 - {value: 0x0000, lo: 0x01}, - {value: 0x9900, lo: 0xa8, hi: 0xbf}, - // Block 0x2e, offset 0x108 - {value: 0x0000, lo: 0x01}, - {value: 0x9900, lo: 0x80, hi: 0x82}, - // Block 0x2f, offset 0x10a - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x9d, hi: 0x9f}, - // Block 0x30, offset 0x10c - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x94, hi: 0x95}, - {value: 0x8105, lo: 0xb4, hi: 0xb4}, - // Block 0x31, offset 0x10f - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x92, hi: 0x92}, - {value: 0x8133, lo: 0x9d, hi: 0x9d}, - // Block 0x32, offset 0x112 - {value: 0x0000, lo: 0x01}, - {value: 0x8132, lo: 0xa9, hi: 0xa9}, - // Block 0x33, offset 0x114 - {value: 0x0004, lo: 0x02}, - {value: 0x812f, lo: 0xb9, hi: 0xba}, - {value: 0x812e, lo: 0xbb, hi: 0xbb}, - // Block 0x34, offset 0x117 - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x97, hi: 0x97}, - {value: 0x812e, lo: 0x98, hi: 0x98}, - // Block 0x35, offset 0x11a - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0xa0, hi: 0xa0}, - {value: 0x8133, lo: 0xb5, hi: 0xbc}, - {value: 0x812e, lo: 0xbf, hi: 0xbf}, - // Block 0x36, offset 0x11e - {value: 0x0000, lo: 0x05}, - {value: 0x8133, lo: 0xb0, hi: 0xb4}, - {value: 0x812e, lo: 0xb5, hi: 0xba}, - {value: 0x8133, lo: 0xbb, hi: 0xbc}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - {value: 0x812e, lo: 0xbf, hi: 0xbf}, - // Block 0x37, offset 0x124 - {value: 0x0000, lo: 0x0b}, - {value: 0x812e, lo: 0x80, hi: 0x80}, - {value: 0x8133, lo: 0x81, hi: 0x82}, - {value: 0x812e, lo: 0x83, hi: 0x84}, - {value: 0x8133, lo: 0x85, hi: 0x89}, - {value: 0x812e, lo: 0x8a, hi: 0x8a}, - {value: 0x8133, lo: 0x8b, hi: 0x9c}, - {value: 0x812e, lo: 0x9d, hi: 0x9d}, - {value: 0x8133, lo: 0xa0, hi: 0xa5}, - {value: 0x812e, lo: 0xa6, hi: 0xa6}, - {value: 0x8133, lo: 0xa7, hi: 0xaa}, - {value: 0x8136, lo: 0xab, hi: 0xab}, - // Block 0x38, offset 0x130 - {value: 0x0000, lo: 0x08}, - {value: 0x3f27, lo: 0x80, hi: 0x80}, - {value: 0x3f2f, lo: 0x81, hi: 0x81}, - {value: 0xa000, lo: 0x82, hi: 0x82}, - {value: 0x3f37, lo: 0x83, hi: 0x83}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0xab, hi: 0xab}, - {value: 0x812e, lo: 0xac, hi: 0xac}, - {value: 0x8133, lo: 0xad, hi: 0xb3}, - // Block 0x39, offset 0x139 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xaa, hi: 0xab}, - // Block 0x3a, offset 0x13b - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xa6, hi: 0xa6}, - {value: 0x8105, lo: 0xb2, hi: 0xb3}, - // Block 0x3b, offset 0x13e - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - // Block 0x3c, offset 0x140 - {value: 0x0000, lo: 0x0a}, - {value: 0x8133, lo: 0x90, hi: 0x92}, - {value: 0x8101, lo: 0x94, hi: 0x94}, - {value: 0x812e, lo: 0x95, hi: 0x99}, - {value: 0x8133, lo: 0x9a, hi: 0x9b}, - {value: 0x812e, lo: 0x9c, hi: 0x9f}, - {value: 0x8133, lo: 0xa0, hi: 0xa0}, - {value: 0x8101, lo: 0xa2, hi: 0xa8}, - {value: 0x812e, lo: 0xad, hi: 0xad}, - {value: 0x8133, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb8, hi: 0xb9}, - // Block 0x3d, offset 0x14b - {value: 0x0004, lo: 0x03}, - {value: 0x052a, lo: 0x80, hi: 0x81}, - {value: 0x8100, lo: 0x97, hi: 0x97}, - {value: 0x8100, lo: 0xbe, hi: 0xbe}, - // Block 0x3e, offset 0x14f - {value: 0x0000, lo: 0x0d}, - {value: 0x8133, lo: 0x90, hi: 0x91}, - {value: 0x8101, lo: 0x92, hi: 0x93}, - {value: 0x8133, lo: 0x94, hi: 0x97}, - {value: 0x8101, lo: 0x98, hi: 0x9a}, - {value: 0x8133, lo: 0x9b, hi: 0x9c}, - {value: 0x8133, lo: 0xa1, hi: 0xa1}, - {value: 0x8101, lo: 0xa5, hi: 0xa6}, - {value: 0x8133, lo: 0xa7, hi: 0xa7}, - {value: 0x812e, lo: 0xa8, hi: 0xa8}, - {value: 0x8133, lo: 0xa9, hi: 0xa9}, - {value: 0x8101, lo: 0xaa, hi: 0xab}, - {value: 0x812e, lo: 0xac, hi: 0xaf}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - // Block 0x3f, offset 0x15d - {value: 0x437a, lo: 0x02}, - {value: 0x023c, lo: 0xa6, hi: 0xa6}, - {value: 0x0057, lo: 0xaa, hi: 0xab}, - // Block 0x40, offset 0x160 - {value: 0x0007, lo: 0x05}, - {value: 0xa000, lo: 0x90, hi: 0x90}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0xa000, lo: 0x94, hi: 0x94}, - {value: 0x3b18, lo: 0x9a, hi: 0x9b}, - {value: 0x3b26, lo: 0xae, hi: 0xae}, - // Block 0x41, offset 0x166 - {value: 0x000e, lo: 0x05}, - {value: 0x3b2d, lo: 0x8d, hi: 0x8e}, - {value: 0x3b34, lo: 0x8f, hi: 0x8f}, - {value: 0xa000, lo: 0x90, hi: 0x90}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0xa000, lo: 0x94, hi: 0x94}, - // Block 0x42, offset 0x16c - {value: 0x64a9, lo: 0x0a}, - {value: 0xa000, lo: 0x83, hi: 0x83}, - {value: 0x3b42, lo: 0x84, hi: 0x84}, - {value: 0xa000, lo: 0x88, hi: 0x88}, - {value: 0x3b49, lo: 0x89, hi: 0x89}, - {value: 0xa000, lo: 0x8b, hi: 0x8b}, - {value: 0x3b50, lo: 0x8c, hi: 0x8c}, - {value: 0xa000, lo: 0xa3, hi: 0xa3}, - {value: 0x3b57, lo: 0xa4, hi: 0xa5}, - {value: 0x3b5e, lo: 0xa6, hi: 0xa6}, - {value: 0xa000, lo: 0xbc, hi: 0xbc}, - // Block 0x43, offset 0x177 - {value: 0x0007, lo: 0x03}, - {value: 0x3bc7, lo: 0xa0, hi: 0xa1}, - {value: 0x3bf1, lo: 0xa2, hi: 0xa3}, - {value: 0x3c1b, lo: 0xaa, hi: 0xad}, - // Block 0x44, offset 0x17b - {value: 0x0004, lo: 0x01}, - {value: 0x0586, lo: 0xa9, hi: 0xaa}, - // Block 0x45, offset 0x17d - {value: 0x0000, lo: 0x01}, - {value: 0x45dc, lo: 0x9c, hi: 0x9c}, - // Block 0x46, offset 0x17f - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xaf, hi: 0xb1}, - // Block 0x47, offset 0x181 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x48, offset 0x183 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xa0, hi: 0xbf}, - // Block 0x49, offset 0x185 - {value: 0x0000, lo: 0x05}, - {value: 0x812d, lo: 0xaa, hi: 0xaa}, - {value: 0x8132, lo: 0xab, hi: 0xab}, - {value: 0x8134, lo: 0xac, hi: 0xac}, - {value: 0x812f, lo: 0xad, hi: 0xad}, - {value: 0x8130, lo: 0xae, hi: 0xaf}, - // Block 0x4a, offset 0x18b - {value: 0x0000, lo: 0x03}, - {value: 0x4cc0, lo: 0xb3, hi: 0xb3}, - {value: 0x4cc0, lo: 0xb5, hi: 0xb6}, - {value: 0x4cc0, lo: 0xba, hi: 0xbf}, - // Block 0x4b, offset 0x18f - {value: 0x0000, lo: 0x01}, - {value: 0x4cc0, lo: 0x8f, hi: 0xa3}, - // Block 0x4c, offset 0x191 - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0xae, hi: 0xbe}, - // Block 0x4d, offset 0x193 - {value: 0x0000, lo: 0x07}, - {value: 0x8100, lo: 0x84, hi: 0x84}, - {value: 0x8100, lo: 0x87, hi: 0x87}, - {value: 0x8100, lo: 0x90, hi: 0x90}, - {value: 0x8100, lo: 0x9e, hi: 0x9e}, - {value: 0x8100, lo: 0xa1, hi: 0xa1}, - {value: 0x8100, lo: 0xb2, hi: 0xb2}, - {value: 0x8100, lo: 0xbb, hi: 0xbb}, - // Block 0x4e, offset 0x19b - {value: 0x0000, lo: 0x03}, - {value: 0x8100, lo: 0x80, hi: 0x80}, - {value: 0x8100, lo: 0x8b, hi: 0x8b}, - {value: 0x8100, lo: 0x8e, hi: 0x8e}, - // Block 0x4f, offset 0x19f - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0xaf, hi: 0xaf}, - {value: 0x8133, lo: 0xb4, hi: 0xbd}, - // Block 0x50, offset 0x1a2 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x9e, hi: 0x9f}, - // Block 0x51, offset 0x1a4 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb0, hi: 0xb1}, - // Block 0x52, offset 0x1a6 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x86, hi: 0x86}, - {value: 0x8105, lo: 0xac, hi: 0xac}, - // Block 0x53, offset 0x1a9 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0xa0, hi: 0xb1}, - // Block 0x54, offset 0x1ac - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xab, hi: 0xad}, - // Block 0x55, offset 0x1ae - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x93, hi: 0x93}, - // Block 0x56, offset 0x1b0 - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xb3, hi: 0xb3}, - // Block 0x57, offset 0x1b2 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x80, hi: 0x80}, - // Block 0x58, offset 0x1b4 - {value: 0x0000, lo: 0x05}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - {value: 0x8133, lo: 0xb2, hi: 0xb3}, - {value: 0x812e, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb7, hi: 0xb8}, - {value: 0x8133, lo: 0xbe, hi: 0xbf}, - // Block 0x59, offset 0x1ba - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x81, hi: 0x81}, - {value: 0x8105, lo: 0xb6, hi: 0xb6}, - // Block 0x5a, offset 0x1bd - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xad, hi: 0xad}, - // Block 0x5b, offset 0x1bf - {value: 0x0000, lo: 0x06}, - {value: 0xe500, lo: 0x80, hi: 0x80}, - {value: 0xc600, lo: 0x81, hi: 0x9b}, - {value: 0xe500, lo: 0x9c, hi: 0x9c}, - {value: 0xc600, lo: 0x9d, hi: 0xb7}, - {value: 0xe500, lo: 0xb8, hi: 0xb8}, - {value: 0xc600, lo: 0xb9, hi: 0xbf}, - // Block 0x5c, offset 0x1c6 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x93}, - {value: 0xe500, lo: 0x94, hi: 0x94}, - {value: 0xc600, lo: 0x95, hi: 0xaf}, - {value: 0xe500, lo: 0xb0, hi: 0xb0}, - {value: 0xc600, lo: 0xb1, hi: 0xbf}, - // Block 0x5d, offset 0x1cc - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x8b}, - {value: 0xe500, lo: 0x8c, hi: 0x8c}, - {value: 0xc600, lo: 0x8d, hi: 0xa7}, - {value: 0xe500, lo: 0xa8, hi: 0xa8}, - {value: 0xc600, lo: 0xa9, hi: 0xbf}, - // Block 0x5e, offset 0x1d2 - {value: 0x0000, lo: 0x07}, - {value: 0xc600, lo: 0x80, hi: 0x83}, - {value: 0xe500, lo: 0x84, hi: 0x84}, - {value: 0xc600, lo: 0x85, hi: 0x9f}, - {value: 0xe500, lo: 0xa0, hi: 0xa0}, - {value: 0xc600, lo: 0xa1, hi: 0xbb}, - {value: 0xe500, lo: 0xbc, hi: 0xbc}, - {value: 0xc600, lo: 0xbd, hi: 0xbf}, - // Block 0x5f, offset 0x1da - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x97}, - {value: 0xe500, lo: 0x98, hi: 0x98}, - {value: 0xc600, lo: 0x99, hi: 0xb3}, - {value: 0xe500, lo: 0xb4, hi: 0xb4}, - {value: 0xc600, lo: 0xb5, hi: 0xbf}, - // Block 0x60, offset 0x1e0 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x8f}, - {value: 0xe500, lo: 0x90, hi: 0x90}, - {value: 0xc600, lo: 0x91, hi: 0xab}, - {value: 0xe500, lo: 0xac, hi: 0xac}, - {value: 0xc600, lo: 0xad, hi: 0xbf}, - // Block 0x61, offset 0x1e6 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x87}, - {value: 0xe500, lo: 0x88, hi: 0x88}, - {value: 0xc600, lo: 0x89, hi: 0xa3}, - {value: 0xe500, lo: 0xa4, hi: 0xa4}, - {value: 0xc600, lo: 0xa5, hi: 0xbf}, - // Block 0x62, offset 0x1ec - {value: 0x0000, lo: 0x03}, - {value: 0xc600, lo: 0x80, hi: 0x87}, - {value: 0xe500, lo: 0x88, hi: 0x88}, - {value: 0xc600, lo: 0x89, hi: 0xa3}, - // Block 0x63, offset 0x1f0 - {value: 0x0006, lo: 0x0d}, - {value: 0x448f, lo: 0x9d, hi: 0x9d}, - {value: 0x8116, lo: 0x9e, hi: 0x9e}, - {value: 0x4501, lo: 0x9f, hi: 0x9f}, - {value: 0x44ef, lo: 0xaa, hi: 0xab}, - {value: 0x45f3, lo: 0xac, hi: 0xac}, - {value: 0x45fb, lo: 0xad, hi: 0xad}, - {value: 0x4447, lo: 0xae, hi: 0xb1}, - {value: 0x4465, lo: 0xb2, hi: 0xb4}, - {value: 0x447d, lo: 0xb5, hi: 0xb6}, - {value: 0x4489, lo: 0xb8, hi: 0xb8}, - {value: 0x4495, lo: 0xb9, hi: 0xbb}, - {value: 0x44ad, lo: 0xbc, hi: 0xbc}, - {value: 0x44b3, lo: 0xbe, hi: 0xbe}, - // Block 0x64, offset 0x1fe - {value: 0x0006, lo: 0x08}, - {value: 0x44b9, lo: 0x80, hi: 0x81}, - {value: 0x44c5, lo: 0x83, hi: 0x84}, - {value: 0x44d7, lo: 0x86, hi: 0x89}, - {value: 0x44fb, lo: 0x8a, hi: 0x8a}, - {value: 0x4477, lo: 0x8b, hi: 0x8b}, - {value: 0x445f, lo: 0x8c, hi: 0x8c}, - {value: 0x44a7, lo: 0x8d, hi: 0x8d}, - {value: 0x44d1, lo: 0x8e, hi: 0x8e}, - // Block 0x65, offset 0x207 - {value: 0x0000, lo: 0x02}, - {value: 0x8100, lo: 0xa4, hi: 0xa5}, - {value: 0x8100, lo: 0xb0, hi: 0xb1}, - // Block 0x66, offset 0x20a - {value: 0x0000, lo: 0x02}, - {value: 0x8100, lo: 0x9b, hi: 0x9d}, - {value: 0x8200, lo: 0x9e, hi: 0xa3}, - // Block 0x67, offset 0x20d - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0x90, hi: 0x90}, - // Block 0x68, offset 0x20f - {value: 0x0000, lo: 0x02}, - {value: 0x8100, lo: 0x99, hi: 0x99}, - {value: 0x8200, lo: 0xb2, hi: 0xb4}, - // Block 0x69, offset 0x212 - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0xbc, hi: 0xbd}, - // Block 0x6a, offset 0x214 - {value: 0x0000, lo: 0x03}, - {value: 0x8133, lo: 0xa0, hi: 0xa6}, - {value: 0x812e, lo: 0xa7, hi: 0xad}, - {value: 0x8133, lo: 0xae, hi: 0xaf}, - // Block 0x6b, offset 0x218 - {value: 0x0000, lo: 0x04}, - {value: 0x8100, lo: 0x89, hi: 0x8c}, - {value: 0x8100, lo: 0xb0, hi: 0xb2}, - {value: 0x8100, lo: 0xb4, hi: 0xb4}, - {value: 0x8100, lo: 0xb6, hi: 0xbf}, - // Block 0x6c, offset 0x21d - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0x81, hi: 0x8c}, - // Block 0x6d, offset 0x21f - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0xb5, hi: 0xba}, - // Block 0x6e, offset 0x221 - {value: 0x0000, lo: 0x04}, - {value: 0x4cc0, lo: 0x9e, hi: 0x9f}, - {value: 0x4cc0, lo: 0xa3, hi: 0xa3}, - {value: 0x4cc0, lo: 0xa5, hi: 0xa6}, - {value: 0x4cc0, lo: 0xaa, hi: 0xaf}, - // Block 0x6f, offset 0x226 - {value: 0x0000, lo: 0x05}, - {value: 0x4cc0, lo: 0x82, hi: 0x87}, - {value: 0x4cc0, lo: 0x8a, hi: 0x8f}, - {value: 0x4cc0, lo: 0x92, hi: 0x97}, - {value: 0x4cc0, lo: 0x9a, hi: 0x9c}, - {value: 0x8100, lo: 0xa3, hi: 0xa3}, - // Block 0x70, offset 0x22c - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - // Block 0x71, offset 0x22e - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xa0, hi: 0xa0}, - // Block 0x72, offset 0x230 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb6, hi: 0xba}, - // Block 0x73, offset 0x232 - {value: 0x0000, lo: 0x04}, - {value: 0x410f, lo: 0x89, hi: 0x89}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0xa000, lo: 0x9a, hi: 0x9a}, - {value: 0x4117, lo: 0xa4, hi: 0xa4}, - // Block 0x74, offset 0x237 - {value: 0x002d, lo: 0x05}, - {value: 0x812e, lo: 0x8d, hi: 0x8d}, - {value: 0x8133, lo: 0x8f, hi: 0x8f}, - {value: 0x8133, lo: 0xb8, hi: 0xb8}, - {value: 0x8101, lo: 0xb9, hi: 0xba}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x75, offset 0x23d - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0xa5, hi: 0xa5}, - {value: 0x812e, lo: 0xa6, hi: 0xa6}, - // Block 0x76, offset 0x240 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xa4, hi: 0xa7}, - // Block 0x77, offset 0x242 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xa9, hi: 0xad}, - // Block 0x78, offset 0x244 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xab, hi: 0xac}, - // Block 0x79, offset 0x246 - {value: 0x0000, lo: 0x02}, - {value: 0x812e, lo: 0xba, hi: 0xbb}, - {value: 0x812e, lo: 0xbd, hi: 0xbf}, - // Block 0x7a, offset 0x249 - {value: 0x0000, lo: 0x05}, - {value: 0x812e, lo: 0x86, hi: 0x87}, - {value: 0x8133, lo: 0x88, hi: 0x8a}, - {value: 0x812e, lo: 0x8b, hi: 0x8b}, - {value: 0x8133, lo: 0x8c, hi: 0x8c}, - {value: 0x812e, lo: 0x8d, hi: 0x90}, - // Block 0x7b, offset 0x24f - {value: 0x0005, lo: 0x03}, - {value: 0x8133, lo: 0x82, hi: 0x82}, - {value: 0x812e, lo: 0x83, hi: 0x84}, - {value: 0x812e, lo: 0x85, hi: 0x85}, - // Block 0x7c, offset 0x253 - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0x86, hi: 0x86}, - {value: 0x8105, lo: 0xb0, hi: 0xb0}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x7d, offset 0x257 - {value: 0x17fe, lo: 0x07}, - {value: 0xa000, lo: 0x99, hi: 0x99}, - {value: 0x4287, lo: 0x9a, hi: 0x9a}, - {value: 0xa000, lo: 0x9b, hi: 0x9b}, - {value: 0x4291, lo: 0x9c, hi: 0x9c}, - {value: 0xa000, lo: 0xa5, hi: 0xa5}, - {value: 0x429b, lo: 0xab, hi: 0xab}, - {value: 0x8105, lo: 0xb9, hi: 0xba}, - // Block 0x7e, offset 0x25f - {value: 0x0000, lo: 0x06}, - {value: 0x8133, lo: 0x80, hi: 0x82}, - {value: 0x9900, lo: 0xa7, hi: 0xa7}, - {value: 0x42a5, lo: 0xae, hi: 0xae}, - {value: 0x42af, lo: 0xaf, hi: 0xaf}, - {value: 0xa000, lo: 0xb1, hi: 0xb2}, - {value: 0x8105, lo: 0xb3, hi: 0xb4}, - // Block 0x7f, offset 0x266 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x80, hi: 0x80}, - {value: 0x8103, lo: 0x8a, hi: 0x8a}, - // Block 0x80, offset 0x269 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb5, hi: 0xb5}, - {value: 0x8103, lo: 0xb6, hi: 0xb6}, - // Block 0x81, offset 0x26c - {value: 0x0002, lo: 0x01}, - {value: 0x8103, lo: 0xa9, hi: 0xaa}, - // Block 0x82, offset 0x26e - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbb, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x83, offset 0x271 - {value: 0x0000, lo: 0x07}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x42b9, lo: 0x8b, hi: 0x8b}, - {value: 0x42c3, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x8133, lo: 0xa6, hi: 0xac}, - {value: 0x8133, lo: 0xb0, hi: 0xb4}, - // Block 0x84, offset 0x279 - {value: 0x5d33, lo: 0x09}, - {value: 0xa000, lo: 0x82, hi: 0x82}, - {value: 0x42cd, lo: 0x83, hi: 0x84}, - {value: 0x42d7, lo: 0x85, hi: 0x85}, - {value: 0xa000, lo: 0x8b, hi: 0x8b}, - {value: 0x42e1, lo: 0x8e, hi: 0x8e}, - {value: 0xa000, lo: 0x90, hi: 0x90}, - {value: 0x42eb, lo: 0x91, hi: 0x91}, - {value: 0x9900, lo: 0xb8, hi: 0xb8}, - {value: 0x9900, lo: 0xbb, hi: 0xbb}, - // Block 0x85, offset 0x283 - {value: 0x0000, lo: 0x06}, - {value: 0xb900, lo: 0x82, hi: 0x82}, - {value: 0x4c14, lo: 0x85, hi: 0x85}, - {value: 0x4c09, lo: 0x87, hi: 0x87}, - {value: 0x4c1f, lo: 0x88, hi: 0x88}, - {value: 0x9900, lo: 0x89, hi: 0x89}, - {value: 0x8105, lo: 0x8e, hi: 0x90}, - // Block 0x86, offset 0x28a - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0x82, hi: 0x82}, - {value: 0x8103, lo: 0x86, hi: 0x86}, - {value: 0x8133, lo: 0x9e, hi: 0x9e}, - // Block 0x87, offset 0x28e - {value: 0x560b, lo: 0x06}, - {value: 0x9900, lo: 0xb0, hi: 0xb0}, - {value: 0xa000, lo: 0xb9, hi: 0xb9}, - {value: 0x9900, lo: 0xba, hi: 0xba}, - {value: 0x42ff, lo: 0xbb, hi: 0xbb}, - {value: 0x42f5, lo: 0xbc, hi: 0xbd}, - {value: 0x4309, lo: 0xbe, hi: 0xbe}, - // Block 0x88, offset 0x295 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x82, hi: 0x82}, - {value: 0x8103, lo: 0x83, hi: 0x83}, - // Block 0x89, offset 0x298 - {value: 0x0000, lo: 0x05}, - {value: 0x9900, lo: 0xaf, hi: 0xaf}, - {value: 0xa000, lo: 0xb8, hi: 0xb9}, - {value: 0x4313, lo: 0xba, hi: 0xba}, - {value: 0x431d, lo: 0xbb, hi: 0xbb}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x8a, offset 0x29e - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0x80, hi: 0x80}, - // Block 0x8b, offset 0x2a0 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb6, hi: 0xb6}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - // Block 0x8c, offset 0x2a3 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xab, hi: 0xab}, - // Block 0x8d, offset 0x2a5 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb9, hi: 0xb9}, - {value: 0x8103, lo: 0xba, hi: 0xba}, - // Block 0x8e, offset 0x2a8 - {value: 0x0000, lo: 0x04}, - {value: 0x9900, lo: 0xb0, hi: 0xb0}, - {value: 0xa000, lo: 0xb5, hi: 0xb5}, - {value: 0x4327, lo: 0xb8, hi: 0xb8}, - {value: 0x8105, lo: 0xbd, hi: 0xbe}, - // Block 0x8f, offset 0x2ad - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0x83, hi: 0x83}, - // Block 0x90, offset 0x2af - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xa0, hi: 0xa0}, - // Block 0x91, offset 0x2b1 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xb4, hi: 0xb4}, - // Block 0x92, offset 0x2b3 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x87, hi: 0x87}, - // Block 0x93, offset 0x2b5 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x99, hi: 0x99}, - // Block 0x94, offset 0x2b7 - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0x82, hi: 0x82}, - {value: 0x8105, lo: 0x84, hi: 0x85}, - // Block 0x95, offset 0x2ba - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x97, hi: 0x97}, - // Block 0x96, offset 0x2bc - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x81, hi: 0x82}, - // Block 0x97, offset 0x2be - {value: 0x0000, lo: 0x0c}, - {value: 0xb900, lo: 0x9e, hi: 0x9e}, - {value: 0x9900, lo: 0x9f, hi: 0xa0}, - {value: 0x4c83, lo: 0xa1, hi: 0xa1}, - {value: 0x4c8e, lo: 0xa2, hi: 0xa2}, - {value: 0x4c2a, lo: 0xa3, hi: 0xa3}, - {value: 0x4c40, lo: 0xa4, hi: 0xa4}, - {value: 0x4c35, lo: 0xa5, hi: 0xa5}, - {value: 0x4c56, lo: 0xa6, hi: 0xa6}, - {value: 0x4c74, lo: 0xa7, hi: 0xa7}, - {value: 0x4c65, lo: 0xa8, hi: 0xa8}, - {value: 0xb900, lo: 0xa9, hi: 0xa9}, - {value: 0x8105, lo: 0xaf, hi: 0xaf}, - // Block 0x98, offset 0x2cb - {value: 0x0000, lo: 0x01}, - {value: 0x8101, lo: 0xb0, hi: 0xb4}, - // Block 0x99, offset 0x2cd - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb0, hi: 0xb6}, - // Block 0x9a, offset 0x2cf - {value: 0x0000, lo: 0x05}, - {value: 0xa000, lo: 0xa3, hi: 0xa3}, - {value: 0xb900, lo: 0xa7, hi: 0xa7}, - {value: 0x4c4b, lo: 0xa8, hi: 0xa8}, - {value: 0x4b35, lo: 0xa9, hi: 0xa9}, - {value: 0x4347, lo: 0xaa, hi: 0xaa}, - // Block 0x9b, offset 0x2d5 - {value: 0x0000, lo: 0x01}, - {value: 0x8102, lo: 0xb0, hi: 0xb1}, - // Block 0x9c, offset 0x2d7 - {value: 0x0000, lo: 0x01}, - {value: 0x8101, lo: 0x9e, hi: 0x9e}, - // Block 0x9d, offset 0x2d9 - {value: 0x0000, lo: 0x0c}, - {value: 0x4743, lo: 0x9e, hi: 0x9e}, - {value: 0x474d, lo: 0x9f, hi: 0x9f}, - {value: 0x4781, lo: 0xa0, hi: 0xa0}, - {value: 0x478f, lo: 0xa1, hi: 0xa1}, - {value: 0x479d, lo: 0xa2, hi: 0xa2}, - {value: 0x47ab, lo: 0xa3, hi: 0xa3}, - {value: 0x47b9, lo: 0xa4, hi: 0xa4}, - {value: 0x812c, lo: 0xa5, hi: 0xa6}, - {value: 0x8101, lo: 0xa7, hi: 0xa9}, - {value: 0x8131, lo: 0xad, hi: 0xad}, - {value: 0x812c, lo: 0xae, hi: 0xb2}, - {value: 0x812e, lo: 0xbb, hi: 0xbf}, - // Block 0x9e, offset 0x2e6 - {value: 0x0000, lo: 0x09}, - {value: 0x812e, lo: 0x80, hi: 0x82}, - {value: 0x8133, lo: 0x85, hi: 0x89}, - {value: 0x812e, lo: 0x8a, hi: 0x8b}, - {value: 0x8133, lo: 0xaa, hi: 0xad}, - {value: 0x4757, lo: 0xbb, hi: 0xbb}, - {value: 0x4761, lo: 0xbc, hi: 0xbc}, - {value: 0x47c7, lo: 0xbd, hi: 0xbd}, - {value: 0x47e3, lo: 0xbe, hi: 0xbe}, - {value: 0x47d5, lo: 0xbf, hi: 0xbf}, - // Block 0x9f, offset 0x2f0 - {value: 0x0000, lo: 0x01}, - {value: 0x47f1, lo: 0x80, hi: 0x80}, - // Block 0xa0, offset 0x2f2 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x82, hi: 0x84}, - // Block 0xa1, offset 0x2f4 - {value: 0x0000, lo: 0x05}, - {value: 0x8133, lo: 0x80, hi: 0x86}, - {value: 0x8133, lo: 0x88, hi: 0x98}, - {value: 0x8133, lo: 0x9b, hi: 0xa1}, - {value: 0x8133, lo: 0xa3, hi: 0xa4}, - {value: 0x8133, lo: 0xa6, hi: 0xaa}, - // Block 0xa2, offset 0x2fa - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x8f, hi: 0x8f}, - // Block 0xa3, offset 0x2fc - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xae, hi: 0xae}, - // Block 0xa4, offset 0x2fe - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xac, hi: 0xaf}, - // Block 0xa5, offset 0x300 - {value: 0x0000, lo: 0x03}, - {value: 0x8134, lo: 0xac, hi: 0xad}, - {value: 0x812e, lo: 0xae, hi: 0xae}, - {value: 0x8133, lo: 0xaf, hi: 0xaf}, - // Block 0xa6, offset 0x304 - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0xae, hi: 0xae}, - {value: 0x812e, lo: 0xaf, hi: 0xaf}, - // Block 0xa7, offset 0x307 - {value: 0x0000, lo: 0x04}, - {value: 0x8133, lo: 0xa3, hi: 0xa3}, - {value: 0x8133, lo: 0xa6, hi: 0xa6}, - {value: 0x8133, lo: 0xae, hi: 0xaf}, - {value: 0x8133, lo: 0xb5, hi: 0xb5}, - // Block 0xa8, offset 0x30c - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x90, hi: 0x96}, - // Block 0xa9, offset 0x30e - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x84, hi: 0x89}, - {value: 0x8103, lo: 0x8a, hi: 0x8a}, - // Block 0xaa, offset 0x311 - {value: 0x0000, lo: 0x01}, - {value: 0x8100, lo: 0x93, hi: 0x93}, -} - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return nfkcValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfkcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfkcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = nfkcIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return nfkcValues[c0] - } - i := nfkcIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = nfkcIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = nfkcIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return nfkcValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfkcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := nfkcIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = nfkcIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = nfkcIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return nfkcValues[c0] - } - i := nfkcIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = nfkcIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = nfkcIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// nfkcTrie. Total size: 19650 bytes (19.19 KiB). Checksum: 29892d851eed0531. -type nfkcTrie struct{} - -func newNfkcTrie(i int) *nfkcTrie { - return &nfkcTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 95: - return uint16(nfkcValues[n<<6+uint32(b)]) - default: - n -= 95 - return uint16(nfkcSparse.lookup(n, b)) - } -} - -// nfkcValues: 97 blocks, 6208 entries, 12416 bytes -// The third block is the zero block. -var nfkcValues = [6208]uint16{ - // Block 0x0, offset 0x0 - 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, - // Block 0x1, offset 0x40 - 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, - 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, - 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, - 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, - 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, - 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, - 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, - 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, - 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, - 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x2ece, 0xc1: 0x2ed3, 0xc2: 0x47ff, 0xc3: 0x2ed8, 0xc4: 0x480e, 0xc5: 0x4813, - 0xc6: 0xa000, 0xc7: 0x481d, 0xc8: 0x2f41, 0xc9: 0x2f46, 0xca: 0x4822, 0xcb: 0x2f5a, - 0xcc: 0x2fcd, 0xcd: 0x2fd2, 0xce: 0x2fd7, 0xcf: 0x4836, 0xd1: 0x3063, - 0xd2: 0x3086, 0xd3: 0x308b, 0xd4: 0x4840, 0xd5: 0x4845, 0xd6: 0x4854, - 0xd8: 0xa000, 0xd9: 0x3112, 0xda: 0x3117, 0xdb: 0x311c, 0xdc: 0x4886, 0xdd: 0x3194, - 0xe0: 0x31da, 0xe1: 0x31df, 0xe2: 0x4890, 0xe3: 0x31e4, - 0xe4: 0x489f, 0xe5: 0x48a4, 0xe6: 0xa000, 0xe7: 0x48ae, 0xe8: 0x324d, 0xe9: 0x3252, - 0xea: 0x48b3, 0xeb: 0x3266, 0xec: 0x32de, 0xed: 0x32e3, 0xee: 0x32e8, 0xef: 0x48c7, - 0xf1: 0x3374, 0xf2: 0x3397, 0xf3: 0x339c, 0xf4: 0x48d1, 0xf5: 0x48d6, - 0xf6: 0x48e5, 0xf8: 0xa000, 0xf9: 0x3428, 0xfa: 0x342d, 0xfb: 0x3432, - 0xfc: 0x4917, 0xfd: 0x34af, 0xff: 0x34c8, - // Block 0x4, offset 0x100 - 0x100: 0x2edd, 0x101: 0x31e9, 0x102: 0x4804, 0x103: 0x4895, 0x104: 0x2efb, 0x105: 0x3207, - 0x106: 0x2f0f, 0x107: 0x321b, 0x108: 0x2f14, 0x109: 0x3220, 0x10a: 0x2f19, 0x10b: 0x3225, - 0x10c: 0x2f1e, 0x10d: 0x322a, 0x10e: 0x2f28, 0x10f: 0x3234, - 0x112: 0x4827, 0x113: 0x48b8, 0x114: 0x2f50, 0x115: 0x325c, 0x116: 0x2f55, 0x117: 0x3261, - 0x118: 0x2f73, 0x119: 0x327f, 0x11a: 0x2f64, 0x11b: 0x3270, 0x11c: 0x2f8c, 0x11d: 0x3298, - 0x11e: 0x2f96, 0x11f: 0x32a2, 0x120: 0x2f9b, 0x121: 0x32a7, 0x122: 0x2fa5, 0x123: 0x32b1, - 0x124: 0x2faa, 0x125: 0x32b6, 0x128: 0x2fdc, 0x129: 0x32ed, - 0x12a: 0x2fe1, 0x12b: 0x32f2, 0x12c: 0x2fe6, 0x12d: 0x32f7, 0x12e: 0x3009, 0x12f: 0x3315, - 0x130: 0x2feb, 0x132: 0x1a8a, 0x133: 0x1b17, 0x134: 0x3013, 0x135: 0x331f, - 0x136: 0x3027, 0x137: 0x3338, 0x139: 0x3031, 0x13a: 0x3342, 0x13b: 0x303b, - 0x13c: 0x334c, 0x13d: 0x3036, 0x13e: 0x3347, 0x13f: 0x1cdc, - // Block 0x5, offset 0x140 - 0x140: 0x1d64, 0x143: 0x305e, 0x144: 0x336f, 0x145: 0x3077, - 0x146: 0x3388, 0x147: 0x306d, 0x148: 0x337e, 0x149: 0x1d8c, - 0x14c: 0x484a, 0x14d: 0x48db, 0x14e: 0x3090, 0x14f: 0x33a1, 0x150: 0x309a, 0x151: 0x33ab, - 0x154: 0x30b8, 0x155: 0x33c9, 0x156: 0x30d1, 0x157: 0x33e2, - 0x158: 0x30c2, 0x159: 0x33d3, 0x15a: 0x486d, 0x15b: 0x48fe, 0x15c: 0x30db, 0x15d: 0x33ec, - 0x15e: 0x30ea, 0x15f: 0x33fb, 0x160: 0x4872, 0x161: 0x4903, 0x162: 0x3103, 0x163: 0x3419, - 0x164: 0x30f4, 0x165: 0x340a, 0x168: 0x487c, 0x169: 0x490d, - 0x16a: 0x4881, 0x16b: 0x4912, 0x16c: 0x3121, 0x16d: 0x3437, 0x16e: 0x312b, 0x16f: 0x3441, - 0x170: 0x3130, 0x171: 0x3446, 0x172: 0x314e, 0x173: 0x3464, 0x174: 0x3171, 0x175: 0x3487, - 0x176: 0x3199, 0x177: 0x34b4, 0x178: 0x31ad, 0x179: 0x31bc, 0x17a: 0x34dc, 0x17b: 0x31c6, - 0x17c: 0x34e6, 0x17d: 0x31cb, 0x17e: 0x34eb, 0x17f: 0x00a7, - // Block 0x6, offset 0x180 - 0x184: 0x2dd5, 0x185: 0x2ddb, - 0x186: 0x2de1, 0x187: 0x1a9f, 0x188: 0x1aa2, 0x189: 0x1b38, 0x18a: 0x1ab7, 0x18b: 0x1aba, - 0x18c: 0x1b6e, 0x18d: 0x2ee7, 0x18e: 0x31f3, 0x18f: 0x2ff5, 0x190: 0x3301, 0x191: 0x309f, - 0x192: 0x33b0, 0x193: 0x3135, 0x194: 0x344b, 0x195: 0x392e, 0x196: 0x3abd, 0x197: 0x3927, - 0x198: 0x3ab6, 0x199: 0x3935, 0x19a: 0x3ac4, 0x19b: 0x3920, 0x19c: 0x3aaf, - 0x19e: 0x380f, 0x19f: 0x399e, 0x1a0: 0x3808, 0x1a1: 0x3997, 0x1a2: 0x3512, 0x1a3: 0x3524, - 0x1a6: 0x2fa0, 0x1a7: 0x32ac, 0x1a8: 0x301d, 0x1a9: 0x332e, - 0x1aa: 0x4863, 0x1ab: 0x48f4, 0x1ac: 0x38ef, 0x1ad: 0x3a7e, 0x1ae: 0x3536, 0x1af: 0x353c, - 0x1b0: 0x3324, 0x1b1: 0x1a6f, 0x1b2: 0x1a72, 0x1b3: 0x1aff, 0x1b4: 0x2f87, 0x1b5: 0x3293, - 0x1b8: 0x3059, 0x1b9: 0x336a, 0x1ba: 0x3816, 0x1bb: 0x39a5, - 0x1bc: 0x350c, 0x1bd: 0x351e, 0x1be: 0x3518, 0x1bf: 0x352a, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x2eec, 0x1c1: 0x31f8, 0x1c2: 0x2ef1, 0x1c3: 0x31fd, 0x1c4: 0x2f69, 0x1c5: 0x3275, - 0x1c6: 0x2f6e, 0x1c7: 0x327a, 0x1c8: 0x2ffa, 0x1c9: 0x3306, 0x1ca: 0x2fff, 0x1cb: 0x330b, - 0x1cc: 0x30a4, 0x1cd: 0x33b5, 0x1ce: 0x30a9, 0x1cf: 0x33ba, 0x1d0: 0x30c7, 0x1d1: 0x33d8, - 0x1d2: 0x30cc, 0x1d3: 0x33dd, 0x1d4: 0x313a, 0x1d5: 0x3450, 0x1d6: 0x313f, 0x1d7: 0x3455, - 0x1d8: 0x30e5, 0x1d9: 0x33f6, 0x1da: 0x30fe, 0x1db: 0x3414, - 0x1de: 0x2fb9, 0x1df: 0x32c5, - 0x1e6: 0x4809, 0x1e7: 0x489a, 0x1e8: 0x4831, 0x1e9: 0x48c2, - 0x1ea: 0x38be, 0x1eb: 0x3a4d, 0x1ec: 0x389b, 0x1ed: 0x3a2a, 0x1ee: 0x484f, 0x1ef: 0x48e0, - 0x1f0: 0x38b7, 0x1f1: 0x3a46, 0x1f2: 0x31a3, 0x1f3: 0x34be, - // Block 0x8, offset 0x200 - 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, - 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, - 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, - 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, - 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, - 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, - 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, - 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, - 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, - 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, - 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, - // Block 0x9, offset 0x240 - 0x240: 0x4b3f, 0x241: 0x4b44, 0x242: 0x9933, 0x243: 0x4b49, 0x244: 0x4c02, 0x245: 0x9937, - 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, - 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, - 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, - 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, - 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, - 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, - 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, - 0x274: 0x01ee, - 0x27a: 0x43a4, - 0x27e: 0x0037, - // Block 0xa, offset 0x280 - 0x284: 0x4359, 0x285: 0x457a, - 0x286: 0x3548, 0x287: 0x00ce, 0x288: 0x3566, 0x289: 0x3572, 0x28a: 0x3584, - 0x28c: 0x35a2, 0x28e: 0x35b4, 0x28f: 0x35d2, 0x290: 0x3d67, 0x291: 0xa000, - 0x295: 0xa000, 0x297: 0xa000, - 0x299: 0xa000, - 0x29f: 0xa000, 0x2a1: 0xa000, - 0x2a5: 0xa000, 0x2a9: 0xa000, - 0x2aa: 0x3596, 0x2ab: 0x35c6, 0x2ac: 0x4975, 0x2ad: 0x35f6, 0x2ae: 0x499f, 0x2af: 0x3608, - 0x2b0: 0x3dcf, 0x2b1: 0xa000, 0x2b5: 0xa000, - 0x2b7: 0xa000, 0x2b9: 0xa000, - 0x2bf: 0xa000, - // Block 0xb, offset 0x2c0 - 0x2c1: 0xa000, 0x2c5: 0xa000, - 0x2c9: 0xa000, 0x2ca: 0x49b7, 0x2cb: 0x49d5, - 0x2cc: 0x3626, 0x2cd: 0x363e, 0x2ce: 0x49ed, 0x2d0: 0x0242, 0x2d1: 0x0254, - 0x2d2: 0x0230, 0x2d3: 0x440b, 0x2d4: 0x4411, 0x2d5: 0x027e, 0x2d6: 0x026c, - 0x2f0: 0x025a, 0x2f1: 0x026f, 0x2f2: 0x0272, 0x2f4: 0x020c, 0x2f5: 0x024b, - 0x2f9: 0x022a, - // Block 0xc, offset 0x300 - 0x300: 0x3680, 0x301: 0x368c, 0x303: 0x367a, - 0x306: 0xa000, 0x307: 0x3668, - 0x30c: 0x36bc, 0x30d: 0x36a4, 0x30e: 0x36ce, 0x310: 0xa000, - 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000, - 0x318: 0xa000, 0x319: 0x36b0, 0x31a: 0xa000, - 0x31e: 0xa000, 0x323: 0xa000, - 0x327: 0xa000, - 0x32b: 0xa000, 0x32d: 0xa000, - 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000, - 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x3734, 0x33a: 0xa000, - 0x33e: 0xa000, - // Block 0xd, offset 0x340 - 0x341: 0x3692, 0x342: 0x3716, - 0x350: 0x366e, 0x351: 0x36f2, - 0x352: 0x3674, 0x353: 0x36f8, 0x356: 0x3686, 0x357: 0x370a, - 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x3788, 0x35b: 0x378e, 0x35c: 0x3698, 0x35d: 0x371c, - 0x35e: 0x369e, 0x35f: 0x3722, 0x362: 0x36aa, 0x363: 0x372e, - 0x364: 0x36b6, 0x365: 0x373a, 0x366: 0x36c2, 0x367: 0x3746, 0x368: 0xa000, 0x369: 0xa000, - 0x36a: 0x3794, 0x36b: 0x379a, 0x36c: 0x36ec, 0x36d: 0x3770, 0x36e: 0x36c8, 0x36f: 0x374c, - 0x370: 0x36d4, 0x371: 0x3758, 0x372: 0x36da, 0x373: 0x375e, 0x374: 0x36e0, 0x375: 0x3764, - 0x378: 0x36e6, 0x379: 0x376a, - // Block 0xe, offset 0x380 - 0x387: 0x1e91, - 0x391: 0x812e, - 0x392: 0x8133, 0x393: 0x8133, 0x394: 0x8133, 0x395: 0x8133, 0x396: 0x812e, 0x397: 0x8133, - 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x812f, 0x39b: 0x812e, 0x39c: 0x8133, 0x39d: 0x8133, - 0x39e: 0x8133, 0x39f: 0x8133, 0x3a0: 0x8133, 0x3a1: 0x8133, 0x3a2: 0x812e, 0x3a3: 0x812e, - 0x3a4: 0x812e, 0x3a5: 0x812e, 0x3a6: 0x812e, 0x3a7: 0x812e, 0x3a8: 0x8133, 0x3a9: 0x8133, - 0x3aa: 0x812e, 0x3ab: 0x8133, 0x3ac: 0x8133, 0x3ad: 0x812f, 0x3ae: 0x8132, 0x3af: 0x8133, - 0x3b0: 0x8106, 0x3b1: 0x8107, 0x3b2: 0x8108, 0x3b3: 0x8109, 0x3b4: 0x810a, 0x3b5: 0x810b, - 0x3b6: 0x810c, 0x3b7: 0x810d, 0x3b8: 0x810e, 0x3b9: 0x810f, 0x3ba: 0x810f, 0x3bb: 0x8110, - 0x3bc: 0x8111, 0x3bd: 0x8112, 0x3bf: 0x8113, - // Block 0xf, offset 0x3c0 - 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8117, - 0x3cc: 0x8118, 0x3cd: 0x8119, 0x3ce: 0x811a, 0x3cf: 0x811b, 0x3d0: 0x811c, 0x3d1: 0x811d, - 0x3d2: 0x811e, 0x3d3: 0x9933, 0x3d4: 0x9933, 0x3d5: 0x992e, 0x3d6: 0x812e, 0x3d7: 0x8133, - 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x812e, 0x3dd: 0x8133, - 0x3de: 0x8133, 0x3df: 0x812e, - 0x3f0: 0x811f, 0x3f5: 0x1eb4, - 0x3f6: 0x2143, 0x3f7: 0x217f, 0x3f8: 0x217a, - // Block 0x10, offset 0x400 - 0x40a: 0x8133, 0x40b: 0x8133, - 0x40c: 0x8133, 0x40d: 0x8133, 0x40e: 0x8133, 0x40f: 0x812e, 0x410: 0x812e, 0x411: 0x812e, - 0x412: 0x812e, 0x413: 0x812e, 0x414: 0x8133, 0x415: 0x8133, 0x416: 0x8133, 0x417: 0x8133, - 0x418: 0x8133, 0x419: 0x8133, 0x41a: 0x8133, 0x41b: 0x8133, 0x41c: 0x8133, 0x41d: 0x8133, - 0x41e: 0x8133, 0x41f: 0x8133, 0x420: 0x8133, 0x421: 0x8133, 0x423: 0x812e, - 0x424: 0x8133, 0x425: 0x8133, 0x426: 0x812e, 0x427: 0x8133, 0x428: 0x8133, 0x429: 0x812e, - 0x42a: 0x8133, 0x42b: 0x8133, 0x42c: 0x8133, 0x42d: 0x812e, 0x42e: 0x812e, 0x42f: 0x812e, - 0x430: 0x8117, 0x431: 0x8118, 0x432: 0x8119, 0x433: 0x8133, 0x434: 0x8133, 0x435: 0x8133, - 0x436: 0x812e, 0x437: 0x8133, 0x438: 0x8133, 0x439: 0x812e, 0x43a: 0x812e, 0x43b: 0x8133, - 0x43c: 0x8133, 0x43d: 0x8133, 0x43e: 0x8133, 0x43f: 0x8133, - // Block 0x11, offset 0x440 - 0x445: 0xa000, - 0x446: 0x3ee7, 0x447: 0xa000, 0x448: 0x3eef, 0x449: 0xa000, 0x44a: 0x3ef7, 0x44b: 0xa000, - 0x44c: 0x3eff, 0x44d: 0xa000, 0x44e: 0x3f07, 0x451: 0xa000, - 0x452: 0x3f0f, - 0x474: 0x8103, 0x475: 0x9900, - 0x47a: 0xa000, 0x47b: 0x3f17, - 0x47c: 0xa000, 0x47d: 0x3f1f, 0x47e: 0xa000, 0x47f: 0xa000, - // Block 0x12, offset 0x480 - 0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x0104, 0x485: 0x0107, - 0x486: 0x0506, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x011f, 0x48b: 0x0122, - 0x48c: 0x0125, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e6, - 0x492: 0x009f, 0x493: 0x0110, 0x494: 0x050a, 0x495: 0x050e, 0x496: 0x00a1, 0x497: 0x00a9, - 0x498: 0x00ab, 0x499: 0x0516, 0x49a: 0x015b, 0x49b: 0x00ad, 0x49c: 0x051a, 0x49d: 0x0242, - 0x49e: 0x0245, 0x49f: 0x0248, 0x4a0: 0x027e, 0x4a1: 0x0281, 0x4a2: 0x0093, 0x4a3: 0x00a5, - 0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x0242, 0x4a7: 0x0245, 0x4a8: 0x026f, 0x4a9: 0x027e, - 0x4aa: 0x0281, - 0x4b8: 0x02b4, - // Block 0x13, offset 0x4c0 - 0x4db: 0x010a, 0x4dc: 0x0087, 0x4dd: 0x0113, - 0x4de: 0x00d7, 0x4df: 0x0125, 0x4e0: 0x008d, 0x4e1: 0x012b, 0x4e2: 0x0131, 0x4e3: 0x013d, - 0x4e4: 0x0146, 0x4e5: 0x0149, 0x4e6: 0x014c, 0x4e7: 0x051e, 0x4e8: 0x01c7, 0x4e9: 0x0155, - 0x4ea: 0x0522, 0x4eb: 0x01ca, 0x4ec: 0x0161, 0x4ed: 0x015e, 0x4ee: 0x0164, 0x4ef: 0x0167, - 0x4f0: 0x016a, 0x4f1: 0x016d, 0x4f2: 0x0176, 0x4f3: 0x018e, 0x4f4: 0x0191, 0x4f5: 0x00f2, - 0x4f6: 0x019a, 0x4f7: 0x019d, 0x4f8: 0x0512, 0x4f9: 0x01a0, 0x4fa: 0x01a3, 0x4fb: 0x00b5, - 0x4fc: 0x01af, 0x4fd: 0x01b2, 0x4fe: 0x01b5, 0x4ff: 0x0254, - // Block 0x14, offset 0x500 - 0x500: 0x8133, 0x501: 0x8133, 0x502: 0x812e, 0x503: 0x8133, 0x504: 0x8133, 0x505: 0x8133, - 0x506: 0x8133, 0x507: 0x8133, 0x508: 0x8133, 0x509: 0x8133, 0x50a: 0x812e, 0x50b: 0x8133, - 0x50c: 0x8133, 0x50d: 0x8136, 0x50e: 0x812b, 0x50f: 0x812e, 0x510: 0x812a, 0x511: 0x8133, - 0x512: 0x8133, 0x513: 0x8133, 0x514: 0x8133, 0x515: 0x8133, 0x516: 0x8133, 0x517: 0x8133, - 0x518: 0x8133, 0x519: 0x8133, 0x51a: 0x8133, 0x51b: 0x8133, 0x51c: 0x8133, 0x51d: 0x8133, - 0x51e: 0x8133, 0x51f: 0x8133, 0x520: 0x8133, 0x521: 0x8133, 0x522: 0x8133, 0x523: 0x8133, - 0x524: 0x8133, 0x525: 0x8133, 0x526: 0x8133, 0x527: 0x8133, 0x528: 0x8133, 0x529: 0x8133, - 0x52a: 0x8133, 0x52b: 0x8133, 0x52c: 0x8133, 0x52d: 0x8133, 0x52e: 0x8133, 0x52f: 0x8133, - 0x530: 0x8133, 0x531: 0x8133, 0x532: 0x8133, 0x533: 0x8133, 0x534: 0x8133, 0x535: 0x8133, - 0x536: 0x8134, 0x537: 0x8132, 0x538: 0x8132, 0x539: 0x812e, 0x53a: 0x812d, 0x53b: 0x8133, - 0x53c: 0x8135, 0x53d: 0x812e, 0x53e: 0x8133, 0x53f: 0x812e, - // Block 0x15, offset 0x540 - 0x540: 0x2ef6, 0x541: 0x3202, 0x542: 0x2f00, 0x543: 0x320c, 0x544: 0x2f05, 0x545: 0x3211, - 0x546: 0x2f0a, 0x547: 0x3216, 0x548: 0x382b, 0x549: 0x39ba, 0x54a: 0x2f23, 0x54b: 0x322f, - 0x54c: 0x2f2d, 0x54d: 0x3239, 0x54e: 0x2f3c, 0x54f: 0x3248, 0x550: 0x2f32, 0x551: 0x323e, - 0x552: 0x2f37, 0x553: 0x3243, 0x554: 0x384e, 0x555: 0x39dd, 0x556: 0x3855, 0x557: 0x39e4, - 0x558: 0x2f78, 0x559: 0x3284, 0x55a: 0x2f7d, 0x55b: 0x3289, 0x55c: 0x3863, 0x55d: 0x39f2, - 0x55e: 0x2f82, 0x55f: 0x328e, 0x560: 0x2f91, 0x561: 0x329d, 0x562: 0x2faf, 0x563: 0x32bb, - 0x564: 0x2fbe, 0x565: 0x32ca, 0x566: 0x2fb4, 0x567: 0x32c0, 0x568: 0x2fc3, 0x569: 0x32cf, - 0x56a: 0x2fc8, 0x56b: 0x32d4, 0x56c: 0x300e, 0x56d: 0x331a, 0x56e: 0x386a, 0x56f: 0x39f9, - 0x570: 0x3018, 0x571: 0x3329, 0x572: 0x3022, 0x573: 0x3333, 0x574: 0x302c, 0x575: 0x333d, - 0x576: 0x483b, 0x577: 0x48cc, 0x578: 0x3871, 0x579: 0x3a00, 0x57a: 0x3045, 0x57b: 0x3356, - 0x57c: 0x3040, 0x57d: 0x3351, 0x57e: 0x304a, 0x57f: 0x335b, - // Block 0x16, offset 0x580 - 0x580: 0x304f, 0x581: 0x3360, 0x582: 0x3054, 0x583: 0x3365, 0x584: 0x3068, 0x585: 0x3379, - 0x586: 0x3072, 0x587: 0x3383, 0x588: 0x3081, 0x589: 0x3392, 0x58a: 0x307c, 0x58b: 0x338d, - 0x58c: 0x3894, 0x58d: 0x3a23, 0x58e: 0x38a2, 0x58f: 0x3a31, 0x590: 0x38a9, 0x591: 0x3a38, - 0x592: 0x38b0, 0x593: 0x3a3f, 0x594: 0x30ae, 0x595: 0x33bf, 0x596: 0x30b3, 0x597: 0x33c4, - 0x598: 0x30bd, 0x599: 0x33ce, 0x59a: 0x4868, 0x59b: 0x48f9, 0x59c: 0x38f6, 0x59d: 0x3a85, - 0x59e: 0x30d6, 0x59f: 0x33e7, 0x5a0: 0x30e0, 0x5a1: 0x33f1, 0x5a2: 0x4877, 0x5a3: 0x4908, - 0x5a4: 0x38fd, 0x5a5: 0x3a8c, 0x5a6: 0x3904, 0x5a7: 0x3a93, 0x5a8: 0x390b, 0x5a9: 0x3a9a, - 0x5aa: 0x30ef, 0x5ab: 0x3400, 0x5ac: 0x30f9, 0x5ad: 0x340f, 0x5ae: 0x310d, 0x5af: 0x3423, - 0x5b0: 0x3108, 0x5b1: 0x341e, 0x5b2: 0x3149, 0x5b3: 0x345f, 0x5b4: 0x3158, 0x5b5: 0x346e, - 0x5b6: 0x3153, 0x5b7: 0x3469, 0x5b8: 0x3912, 0x5b9: 0x3aa1, 0x5ba: 0x3919, 0x5bb: 0x3aa8, - 0x5bc: 0x315d, 0x5bd: 0x3473, 0x5be: 0x3162, 0x5bf: 0x3478, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x3167, 0x5c1: 0x347d, 0x5c2: 0x316c, 0x5c3: 0x3482, 0x5c4: 0x317b, 0x5c5: 0x3491, - 0x5c6: 0x3176, 0x5c7: 0x348c, 0x5c8: 0x3180, 0x5c9: 0x349b, 0x5ca: 0x3185, 0x5cb: 0x34a0, - 0x5cc: 0x318a, 0x5cd: 0x34a5, 0x5ce: 0x31a8, 0x5cf: 0x34c3, 0x5d0: 0x31c1, 0x5d1: 0x34e1, - 0x5d2: 0x31d0, 0x5d3: 0x34f0, 0x5d4: 0x31d5, 0x5d5: 0x34f5, 0x5d6: 0x32d9, 0x5d7: 0x3405, - 0x5d8: 0x3496, 0x5d9: 0x34d2, 0x5da: 0x1d10, 0x5db: 0x43d6, - 0x5e0: 0x4818, 0x5e1: 0x48a9, 0x5e2: 0x2ee2, 0x5e3: 0x31ee, - 0x5e4: 0x37d7, 0x5e5: 0x3966, 0x5e6: 0x37d0, 0x5e7: 0x395f, 0x5e8: 0x37e5, 0x5e9: 0x3974, - 0x5ea: 0x37de, 0x5eb: 0x396d, 0x5ec: 0x381d, 0x5ed: 0x39ac, 0x5ee: 0x37f3, 0x5ef: 0x3982, - 0x5f0: 0x37ec, 0x5f1: 0x397b, 0x5f2: 0x3801, 0x5f3: 0x3990, 0x5f4: 0x37fa, 0x5f5: 0x3989, - 0x5f6: 0x3824, 0x5f7: 0x39b3, 0x5f8: 0x482c, 0x5f9: 0x48bd, 0x5fa: 0x2f5f, 0x5fb: 0x326b, - 0x5fc: 0x2f4b, 0x5fd: 0x3257, 0x5fe: 0x3839, 0x5ff: 0x39c8, - // Block 0x18, offset 0x600 - 0x600: 0x3832, 0x601: 0x39c1, 0x602: 0x3847, 0x603: 0x39d6, 0x604: 0x3840, 0x605: 0x39cf, - 0x606: 0x385c, 0x607: 0x39eb, 0x608: 0x2ff0, 0x609: 0x32fc, 0x60a: 0x3004, 0x60b: 0x3310, - 0x60c: 0x485e, 0x60d: 0x48ef, 0x60e: 0x3095, 0x60f: 0x33a6, 0x610: 0x387f, 0x611: 0x3a0e, - 0x612: 0x3878, 0x613: 0x3a07, 0x614: 0x388d, 0x615: 0x3a1c, 0x616: 0x3886, 0x617: 0x3a15, - 0x618: 0x38e8, 0x619: 0x3a77, 0x61a: 0x38cc, 0x61b: 0x3a5b, 0x61c: 0x38c5, 0x61d: 0x3a54, - 0x61e: 0x38da, 0x61f: 0x3a69, 0x620: 0x38d3, 0x621: 0x3a62, 0x622: 0x38e1, 0x623: 0x3a70, - 0x624: 0x3144, 0x625: 0x345a, 0x626: 0x3126, 0x627: 0x343c, 0x628: 0x3943, 0x629: 0x3ad2, - 0x62a: 0x393c, 0x62b: 0x3acb, 0x62c: 0x3951, 0x62d: 0x3ae0, 0x62e: 0x394a, 0x62f: 0x3ad9, - 0x630: 0x3958, 0x631: 0x3ae7, 0x632: 0x318f, 0x633: 0x34aa, 0x634: 0x31b7, 0x635: 0x34d7, - 0x636: 0x31b2, 0x637: 0x34cd, 0x638: 0x319e, 0x639: 0x34b9, - // Block 0x19, offset 0x640 - 0x640: 0x497b, 0x641: 0x4981, 0x642: 0x4a95, 0x643: 0x4aad, 0x644: 0x4a9d, 0x645: 0x4ab5, - 0x646: 0x4aa5, 0x647: 0x4abd, 0x648: 0x4921, 0x649: 0x4927, 0x64a: 0x4a05, 0x64b: 0x4a1d, - 0x64c: 0x4a0d, 0x64d: 0x4a25, 0x64e: 0x4a15, 0x64f: 0x4a2d, 0x650: 0x498d, 0x651: 0x4993, - 0x652: 0x3d17, 0x653: 0x3d27, 0x654: 0x3d1f, 0x655: 0x3d2f, - 0x658: 0x492d, 0x659: 0x4933, 0x65a: 0x3c47, 0x65b: 0x3c57, 0x65c: 0x3c4f, 0x65d: 0x3c5f, - 0x660: 0x49a5, 0x661: 0x49ab, 0x662: 0x4ac5, 0x663: 0x4add, - 0x664: 0x4acd, 0x665: 0x4ae5, 0x666: 0x4ad5, 0x667: 0x4aed, 0x668: 0x4939, 0x669: 0x493f, - 0x66a: 0x4a35, 0x66b: 0x4a4d, 0x66c: 0x4a3d, 0x66d: 0x4a55, 0x66e: 0x4a45, 0x66f: 0x4a5d, - 0x670: 0x49bd, 0x671: 0x49c3, 0x672: 0x3d77, 0x673: 0x3d8f, 0x674: 0x3d7f, 0x675: 0x3d97, - 0x676: 0x3d87, 0x677: 0x3d9f, 0x678: 0x4945, 0x679: 0x494b, 0x67a: 0x3c77, 0x67b: 0x3c8f, - 0x67c: 0x3c7f, 0x67d: 0x3c97, 0x67e: 0x3c87, 0x67f: 0x3c9f, - // Block 0x1a, offset 0x680 - 0x680: 0x49c9, 0x681: 0x49cf, 0x682: 0x3da7, 0x683: 0x3db7, 0x684: 0x3daf, 0x685: 0x3dbf, - 0x688: 0x4951, 0x689: 0x4957, 0x68a: 0x3ca7, 0x68b: 0x3cb7, - 0x68c: 0x3caf, 0x68d: 0x3cbf, 0x690: 0x49db, 0x691: 0x49e1, - 0x692: 0x3ddf, 0x693: 0x3df7, 0x694: 0x3de7, 0x695: 0x3dff, 0x696: 0x3def, 0x697: 0x3e07, - 0x699: 0x495d, 0x69b: 0x3cc7, 0x69d: 0x3ccf, - 0x69f: 0x3cd7, 0x6a0: 0x49f3, 0x6a1: 0x49f9, 0x6a2: 0x4af5, 0x6a3: 0x4b0d, - 0x6a4: 0x4afd, 0x6a5: 0x4b15, 0x6a6: 0x4b05, 0x6a7: 0x4b1d, 0x6a8: 0x4963, 0x6a9: 0x4969, - 0x6aa: 0x4a65, 0x6ab: 0x4a7d, 0x6ac: 0x4a6d, 0x6ad: 0x4a85, 0x6ae: 0x4a75, 0x6af: 0x4a8d, - 0x6b0: 0x496f, 0x6b1: 0x441d, 0x6b2: 0x35f0, 0x6b3: 0x4423, 0x6b4: 0x4999, 0x6b5: 0x4429, - 0x6b6: 0x3602, 0x6b7: 0x442f, 0x6b8: 0x3620, 0x6b9: 0x4435, 0x6ba: 0x3638, 0x6bb: 0x443b, - 0x6bc: 0x49e7, 0x6bd: 0x4441, - // Block 0x1b, offset 0x6c0 - 0x6c0: 0x3cff, 0x6c1: 0x3d07, 0x6c2: 0x41d3, 0x6c3: 0x41f1, 0x6c4: 0x41dd, 0x6c5: 0x41fb, - 0x6c6: 0x41e7, 0x6c7: 0x4205, 0x6c8: 0x3c37, 0x6c9: 0x3c3f, 0x6ca: 0x411f, 0x6cb: 0x413d, - 0x6cc: 0x4129, 0x6cd: 0x4147, 0x6ce: 0x4133, 0x6cf: 0x4151, 0x6d0: 0x3d47, 0x6d1: 0x3d4f, - 0x6d2: 0x420f, 0x6d3: 0x422d, 0x6d4: 0x4219, 0x6d5: 0x4237, 0x6d6: 0x4223, 0x6d7: 0x4241, - 0x6d8: 0x3c67, 0x6d9: 0x3c6f, 0x6da: 0x415b, 0x6db: 0x4179, 0x6dc: 0x4165, 0x6dd: 0x4183, - 0x6de: 0x416f, 0x6df: 0x418d, 0x6e0: 0x3e1f, 0x6e1: 0x3e27, 0x6e2: 0x424b, 0x6e3: 0x4269, - 0x6e4: 0x4255, 0x6e5: 0x4273, 0x6e6: 0x425f, 0x6e7: 0x427d, 0x6e8: 0x3cdf, 0x6e9: 0x3ce7, - 0x6ea: 0x4197, 0x6eb: 0x41b5, 0x6ec: 0x41a1, 0x6ed: 0x41bf, 0x6ee: 0x41ab, 0x6ef: 0x41c9, - 0x6f0: 0x35e4, 0x6f1: 0x35de, 0x6f2: 0x3cef, 0x6f3: 0x35ea, 0x6f4: 0x3cf7, - 0x6f6: 0x4987, 0x6f7: 0x3d0f, 0x6f8: 0x3554, 0x6f9: 0x354e, 0x6fa: 0x3542, 0x6fb: 0x43ed, - 0x6fc: 0x355a, 0x6fd: 0x4386, 0x6fe: 0x0257, 0x6ff: 0x4386, - // Block 0x1c, offset 0x700 - 0x700: 0x439f, 0x701: 0x4581, 0x702: 0x3d37, 0x703: 0x35fc, 0x704: 0x3d3f, - 0x706: 0x49b1, 0x707: 0x3d57, 0x708: 0x3560, 0x709: 0x43f3, 0x70a: 0x356c, 0x70b: 0x43f9, - 0x70c: 0x3578, 0x70d: 0x4588, 0x70e: 0x458f, 0x70f: 0x4596, 0x710: 0x3614, 0x711: 0x360e, - 0x712: 0x3d5f, 0x713: 0x45e3, 0x716: 0x361a, 0x717: 0x3d6f, - 0x718: 0x3590, 0x719: 0x358a, 0x71a: 0x357e, 0x71b: 0x43ff, 0x71d: 0x459d, - 0x71e: 0x45a4, 0x71f: 0x45ab, 0x720: 0x364a, 0x721: 0x3644, 0x722: 0x3dc7, 0x723: 0x45eb, - 0x724: 0x362c, 0x725: 0x3632, 0x726: 0x3650, 0x727: 0x3dd7, 0x728: 0x35c0, 0x729: 0x35ba, - 0x72a: 0x35ae, 0x72b: 0x440b, 0x72c: 0x35a8, 0x72d: 0x4573, 0x72e: 0x457a, 0x72f: 0x0081, - 0x732: 0x3e0f, 0x733: 0x3656, 0x734: 0x3e17, - 0x736: 0x49ff, 0x737: 0x3e2f, 0x738: 0x359c, 0x739: 0x4405, 0x73a: 0x35cc, 0x73b: 0x4417, - 0x73c: 0x35d8, 0x73d: 0x4359, 0x73e: 0x438b, - // Block 0x1d, offset 0x740 - 0x740: 0x1d08, 0x741: 0x1d0c, 0x742: 0x0047, 0x743: 0x1d84, 0x745: 0x1d18, - 0x746: 0x1d1c, 0x747: 0x00ef, 0x749: 0x1d88, 0x74a: 0x008f, 0x74b: 0x0051, - 0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00e0, 0x750: 0x0053, 0x751: 0x0053, - 0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x1abd, - 0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065, - 0x760: 0x1acf, 0x761: 0x1cf8, 0x762: 0x1ad8, - 0x764: 0x0075, 0x766: 0x023c, 0x768: 0x0075, - 0x76a: 0x0057, 0x76b: 0x43d1, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b, - 0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0308, - 0x776: 0x030b, 0x777: 0x030e, 0x778: 0x0311, 0x779: 0x0093, 0x77b: 0x1cc8, - 0x77c: 0x026c, 0x77d: 0x0245, 0x77e: 0x01fd, 0x77f: 0x0224, - // Block 0x1e, offset 0x780 - 0x780: 0x055a, 0x785: 0x0049, - 0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095, - 0x790: 0x235e, 0x791: 0x236a, - 0x792: 0x241e, 0x793: 0x2346, 0x794: 0x23ca, 0x795: 0x2352, 0x796: 0x23d0, 0x797: 0x23e8, - 0x798: 0x23f4, 0x799: 0x2358, 0x79a: 0x23fa, 0x79b: 0x2364, 0x79c: 0x23ee, 0x79d: 0x2400, - 0x79e: 0x2406, 0x79f: 0x1dec, 0x7a0: 0x0053, 0x7a1: 0x1a87, 0x7a2: 0x1cd4, 0x7a3: 0x1a90, - 0x7a4: 0x006d, 0x7a5: 0x1adb, 0x7a6: 0x1d00, 0x7a7: 0x1e78, 0x7a8: 0x1a93, 0x7a9: 0x0071, - 0x7aa: 0x1ae7, 0x7ab: 0x1d04, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b, - 0x7b0: 0x0093, 0x7b1: 0x1b14, 0x7b2: 0x1d48, 0x7b3: 0x1b1d, 0x7b4: 0x00ad, 0x7b5: 0x1b92, - 0x7b6: 0x1d7c, 0x7b7: 0x1e8c, 0x7b8: 0x1b20, 0x7b9: 0x00b1, 0x7ba: 0x1b95, 0x7bb: 0x1d80, - 0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b, - // Block 0x1f, offset 0x7c0 - 0x7c1: 0x3b65, 0x7c3: 0xa000, 0x7c4: 0x3b6c, 0x7c5: 0xa000, - 0x7c7: 0x3b73, 0x7c8: 0xa000, 0x7c9: 0x3b7a, - 0x7cd: 0xa000, - 0x7e0: 0x2ec4, 0x7e1: 0xa000, 0x7e2: 0x3b88, - 0x7e4: 0xa000, 0x7e5: 0xa000, - 0x7ed: 0x3b81, 0x7ee: 0x2ebf, 0x7ef: 0x2ec9, - 0x7f0: 0x3b8f, 0x7f1: 0x3b96, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3b9d, 0x7f5: 0x3ba4, - 0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3bab, 0x7f9: 0x3bb2, 0x7fa: 0xa000, 0x7fb: 0xa000, - 0x7fc: 0xa000, 0x7fd: 0xa000, - // Block 0x20, offset 0x800 - 0x800: 0x3bb9, 0x801: 0x3bc0, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3bd5, 0x805: 0x3bdc, - 0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3be3, 0x809: 0x3bea, - 0x811: 0xa000, - 0x812: 0xa000, - 0x822: 0xa000, - 0x828: 0xa000, 0x829: 0xa000, - 0x82b: 0xa000, 0x82c: 0x3bff, 0x82d: 0x3c06, 0x82e: 0x3c0d, 0x82f: 0x3c14, - 0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000, - // Block 0x21, offset 0x840 - 0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029, - 0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x19af, - 0x86a: 0x19b2, 0x86b: 0x19b5, 0x86c: 0x19b8, 0x86d: 0x19bb, 0x86e: 0x19be, 0x86f: 0x19c1, - 0x870: 0x19c4, 0x871: 0x19c7, 0x872: 0x19ca, 0x873: 0x19d3, 0x874: 0x1b98, 0x875: 0x1b9c, - 0x876: 0x1ba0, 0x877: 0x1ba4, 0x878: 0x1ba8, 0x879: 0x1bac, 0x87a: 0x1bb0, 0x87b: 0x1bb4, - 0x87c: 0x1bb8, 0x87d: 0x1db0, 0x87e: 0x1db5, 0x87f: 0x1dba, - // Block 0x22, offset 0x880 - 0x880: 0x1dbf, 0x881: 0x1dc4, 0x882: 0x1dc9, 0x883: 0x1dce, 0x884: 0x1dd3, 0x885: 0x1dd8, - 0x886: 0x1ddd, 0x887: 0x1de2, 0x888: 0x19ac, 0x889: 0x19d0, 0x88a: 0x19f4, 0x88b: 0x1a18, - 0x88c: 0x1a3c, 0x88d: 0x1a45, 0x88e: 0x1a4b, 0x88f: 0x1a51, 0x890: 0x1a57, 0x891: 0x1c90, - 0x892: 0x1c94, 0x893: 0x1c98, 0x894: 0x1c9c, 0x895: 0x1ca0, 0x896: 0x1ca4, 0x897: 0x1ca8, - 0x898: 0x1cac, 0x899: 0x1cb0, 0x89a: 0x1cb4, 0x89b: 0x1cb8, 0x89c: 0x1c24, 0x89d: 0x1c28, - 0x89e: 0x1c2c, 0x89f: 0x1c30, 0x8a0: 0x1c34, 0x8a1: 0x1c38, 0x8a2: 0x1c3c, 0x8a3: 0x1c40, - 0x8a4: 0x1c44, 0x8a5: 0x1c48, 0x8a6: 0x1c4c, 0x8a7: 0x1c50, 0x8a8: 0x1c54, 0x8a9: 0x1c58, - 0x8aa: 0x1c5c, 0x8ab: 0x1c60, 0x8ac: 0x1c64, 0x8ad: 0x1c68, 0x8ae: 0x1c6c, 0x8af: 0x1c70, - 0x8b0: 0x1c74, 0x8b1: 0x1c78, 0x8b2: 0x1c7c, 0x8b3: 0x1c80, 0x8b4: 0x1c84, 0x8b5: 0x1c88, - 0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d, - 0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055, - // Block 0x23, offset 0x8c0 - 0x8c0: 0x07ba, 0x8c1: 0x07de, 0x8c2: 0x07ea, 0x8c3: 0x07fa, 0x8c4: 0x0802, 0x8c5: 0x080e, - 0x8c6: 0x0816, 0x8c7: 0x081e, 0x8c8: 0x082a, 0x8c9: 0x087e, 0x8ca: 0x0896, 0x8cb: 0x08a6, - 0x8cc: 0x08b6, 0x8cd: 0x08c6, 0x8ce: 0x08d6, 0x8cf: 0x08f6, 0x8d0: 0x08fa, 0x8d1: 0x08fe, - 0x8d2: 0x0932, 0x8d3: 0x095a, 0x8d4: 0x096a, 0x8d5: 0x0972, 0x8d6: 0x0976, 0x8d7: 0x0982, - 0x8d8: 0x099e, 0x8d9: 0x09a2, 0x8da: 0x09ba, 0x8db: 0x09be, 0x8dc: 0x09c6, 0x8dd: 0x09d6, - 0x8de: 0x0a72, 0x8df: 0x0a86, 0x8e0: 0x0ac6, 0x8e1: 0x0ada, 0x8e2: 0x0ae2, 0x8e3: 0x0ae6, - 0x8e4: 0x0af6, 0x8e5: 0x0b12, 0x8e6: 0x0b3e, 0x8e7: 0x0b4a, 0x8e8: 0x0b6a, 0x8e9: 0x0b76, - 0x8ea: 0x0b7a, 0x8eb: 0x0b7e, 0x8ec: 0x0b96, 0x8ed: 0x0b9a, 0x8ee: 0x0bc6, 0x8ef: 0x0bd2, - 0x8f0: 0x0bda, 0x8f1: 0x0be2, 0x8f2: 0x0bf2, 0x8f3: 0x0bfa, 0x8f4: 0x0c02, 0x8f5: 0x0c2e, - 0x8f6: 0x0c32, 0x8f7: 0x0c3a, 0x8f8: 0x0c3e, 0x8f9: 0x0c46, 0x8fa: 0x0c4e, 0x8fb: 0x0c5e, - 0x8fc: 0x0c7a, 0x8fd: 0x0cf2, 0x8fe: 0x0d06, 0x8ff: 0x0d0a, - // Block 0x24, offset 0x900 - 0x900: 0x0d8a, 0x901: 0x0d8e, 0x902: 0x0da2, 0x903: 0x0da6, 0x904: 0x0dae, 0x905: 0x0db6, - 0x906: 0x0dbe, 0x907: 0x0dca, 0x908: 0x0df2, 0x909: 0x0e02, 0x90a: 0x0e16, 0x90b: 0x0e86, - 0x90c: 0x0e92, 0x90d: 0x0ea2, 0x90e: 0x0eae, 0x90f: 0x0eba, 0x910: 0x0ec2, 0x911: 0x0ec6, - 0x912: 0x0eca, 0x913: 0x0ece, 0x914: 0x0ed2, 0x915: 0x0f8a, 0x916: 0x0fd2, 0x917: 0x0fde, - 0x918: 0x0fe2, 0x919: 0x0fe6, 0x91a: 0x0fea, 0x91b: 0x0ff2, 0x91c: 0x0ff6, 0x91d: 0x100a, - 0x91e: 0x1026, 0x91f: 0x102e, 0x920: 0x106e, 0x921: 0x1072, 0x922: 0x107a, 0x923: 0x107e, - 0x924: 0x1086, 0x925: 0x108a, 0x926: 0x10ae, 0x927: 0x10b2, 0x928: 0x10ce, 0x929: 0x10d2, - 0x92a: 0x10d6, 0x92b: 0x10da, 0x92c: 0x10ee, 0x92d: 0x1112, 0x92e: 0x1116, 0x92f: 0x111a, - 0x930: 0x113e, 0x931: 0x117e, 0x932: 0x1182, 0x933: 0x11a2, 0x934: 0x11b2, 0x935: 0x11ba, - 0x936: 0x11da, 0x937: 0x11fe, 0x938: 0x1242, 0x939: 0x124a, 0x93a: 0x125e, 0x93b: 0x126a, - 0x93c: 0x1272, 0x93d: 0x127a, 0x93e: 0x127e, 0x93f: 0x1282, - // Block 0x25, offset 0x940 - 0x940: 0x129a, 0x941: 0x129e, 0x942: 0x12ba, 0x943: 0x12c2, 0x944: 0x12ca, 0x945: 0x12ce, - 0x946: 0x12da, 0x947: 0x12e2, 0x948: 0x12e6, 0x949: 0x12ea, 0x94a: 0x12f2, 0x94b: 0x12f6, - 0x94c: 0x1396, 0x94d: 0x13aa, 0x94e: 0x13de, 0x94f: 0x13e2, 0x950: 0x13ea, 0x951: 0x1416, - 0x952: 0x141e, 0x953: 0x1426, 0x954: 0x142e, 0x955: 0x146a, 0x956: 0x146e, 0x957: 0x1476, - 0x958: 0x147a, 0x959: 0x147e, 0x95a: 0x14aa, 0x95b: 0x14ae, 0x95c: 0x14b6, 0x95d: 0x14ca, - 0x95e: 0x14ce, 0x95f: 0x14ea, 0x960: 0x14f2, 0x961: 0x14f6, 0x962: 0x151a, 0x963: 0x153a, - 0x964: 0x154e, 0x965: 0x1552, 0x966: 0x155a, 0x967: 0x1586, 0x968: 0x158a, 0x969: 0x159a, - 0x96a: 0x15be, 0x96b: 0x15ca, 0x96c: 0x15da, 0x96d: 0x15f2, 0x96e: 0x15fa, 0x96f: 0x15fe, - 0x970: 0x1602, 0x971: 0x1606, 0x972: 0x1612, 0x973: 0x1616, 0x974: 0x161e, 0x975: 0x163a, - 0x976: 0x163e, 0x977: 0x1642, 0x978: 0x165a, 0x979: 0x165e, 0x97a: 0x1666, 0x97b: 0x167a, - 0x97c: 0x167e, 0x97d: 0x1682, 0x97e: 0x168a, 0x97f: 0x168e, - // Block 0x26, offset 0x980 - 0x986: 0xa000, 0x98b: 0xa000, - 0x98c: 0x3f47, 0x98d: 0xa000, 0x98e: 0x3f4f, 0x98f: 0xa000, 0x990: 0x3f57, 0x991: 0xa000, - 0x992: 0x3f5f, 0x993: 0xa000, 0x994: 0x3f67, 0x995: 0xa000, 0x996: 0x3f6f, 0x997: 0xa000, - 0x998: 0x3f77, 0x999: 0xa000, 0x99a: 0x3f7f, 0x99b: 0xa000, 0x99c: 0x3f87, 0x99d: 0xa000, - 0x99e: 0x3f8f, 0x99f: 0xa000, 0x9a0: 0x3f97, 0x9a1: 0xa000, 0x9a2: 0x3f9f, - 0x9a4: 0xa000, 0x9a5: 0x3fa7, 0x9a6: 0xa000, 0x9a7: 0x3faf, 0x9a8: 0xa000, 0x9a9: 0x3fb7, - 0x9af: 0xa000, - 0x9b0: 0x3fbf, 0x9b1: 0x3fc7, 0x9b2: 0xa000, 0x9b3: 0x3fcf, 0x9b4: 0x3fd7, 0x9b5: 0xa000, - 0x9b6: 0x3fdf, 0x9b7: 0x3fe7, 0x9b8: 0xa000, 0x9b9: 0x3fef, 0x9ba: 0x3ff7, 0x9bb: 0xa000, - 0x9bc: 0x3fff, 0x9bd: 0x4007, - // Block 0x27, offset 0x9c0 - 0x9d4: 0x3f3f, - 0x9d9: 0x9904, 0x9da: 0x9904, 0x9db: 0x43db, 0x9dc: 0x43e1, 0x9dd: 0xa000, - 0x9de: 0x400f, 0x9df: 0x27e4, - 0x9e6: 0xa000, - 0x9eb: 0xa000, 0x9ec: 0x401f, 0x9ed: 0xa000, 0x9ee: 0x4027, 0x9ef: 0xa000, - 0x9f0: 0x402f, 0x9f1: 0xa000, 0x9f2: 0x4037, 0x9f3: 0xa000, 0x9f4: 0x403f, 0x9f5: 0xa000, - 0x9f6: 0x4047, 0x9f7: 0xa000, 0x9f8: 0x404f, 0x9f9: 0xa000, 0x9fa: 0x4057, 0x9fb: 0xa000, - 0x9fc: 0x405f, 0x9fd: 0xa000, 0x9fe: 0x4067, 0x9ff: 0xa000, - // Block 0x28, offset 0xa00 - 0xa00: 0x406f, 0xa01: 0xa000, 0xa02: 0x4077, 0xa04: 0xa000, 0xa05: 0x407f, - 0xa06: 0xa000, 0xa07: 0x4087, 0xa08: 0xa000, 0xa09: 0x408f, - 0xa0f: 0xa000, 0xa10: 0x4097, 0xa11: 0x409f, - 0xa12: 0xa000, 0xa13: 0x40a7, 0xa14: 0x40af, 0xa15: 0xa000, 0xa16: 0x40b7, 0xa17: 0x40bf, - 0xa18: 0xa000, 0xa19: 0x40c7, 0xa1a: 0x40cf, 0xa1b: 0xa000, 0xa1c: 0x40d7, 0xa1d: 0x40df, - 0xa2f: 0xa000, - 0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x4017, - 0xa37: 0x40e7, 0xa38: 0x40ef, 0xa39: 0x40f7, 0xa3a: 0x40ff, - 0xa3d: 0xa000, 0xa3e: 0x4107, 0xa3f: 0x27f9, - // Block 0x29, offset 0xa40 - 0xa40: 0x045a, 0xa41: 0x041e, 0xa42: 0x0422, 0xa43: 0x0426, 0xa44: 0x046e, 0xa45: 0x042a, - 0xa46: 0x042e, 0xa47: 0x0432, 0xa48: 0x0436, 0xa49: 0x043a, 0xa4a: 0x043e, 0xa4b: 0x0442, - 0xa4c: 0x0446, 0xa4d: 0x044a, 0xa4e: 0x044e, 0xa4f: 0x4b4e, 0xa50: 0x4b54, 0xa51: 0x4b5a, - 0xa52: 0x4b60, 0xa53: 0x4b66, 0xa54: 0x4b6c, 0xa55: 0x4b72, 0xa56: 0x4b78, 0xa57: 0x4b7e, - 0xa58: 0x4b84, 0xa59: 0x4b8a, 0xa5a: 0x4b90, 0xa5b: 0x4b96, 0xa5c: 0x4b9c, 0xa5d: 0x4ba2, - 0xa5e: 0x4ba8, 0xa5f: 0x4bae, 0xa60: 0x4bb4, 0xa61: 0x4bba, 0xa62: 0x4bc0, 0xa63: 0x4bc6, - 0xa64: 0x04b6, 0xa65: 0x0452, 0xa66: 0x0456, 0xa67: 0x04da, 0xa68: 0x04de, 0xa69: 0x04e2, - 0xa6a: 0x04e6, 0xa6b: 0x04ea, 0xa6c: 0x04ee, 0xa6d: 0x04f2, 0xa6e: 0x045e, 0xa6f: 0x04f6, - 0xa70: 0x04fa, 0xa71: 0x0462, 0xa72: 0x0466, 0xa73: 0x046a, 0xa74: 0x0472, 0xa75: 0x0476, - 0xa76: 0x047a, 0xa77: 0x047e, 0xa78: 0x0482, 0xa79: 0x0486, 0xa7a: 0x048a, 0xa7b: 0x048e, - 0xa7c: 0x0492, 0xa7d: 0x0496, 0xa7e: 0x049a, 0xa7f: 0x049e, - // Block 0x2a, offset 0xa80 - 0xa80: 0x04a2, 0xa81: 0x04a6, 0xa82: 0x04fe, 0xa83: 0x0502, 0xa84: 0x04aa, 0xa85: 0x04ae, - 0xa86: 0x04b2, 0xa87: 0x04ba, 0xa88: 0x04be, 0xa89: 0x04c2, 0xa8a: 0x04c6, 0xa8b: 0x04ca, - 0xa8c: 0x04ce, 0xa8d: 0x04d2, 0xa8e: 0x04d6, - 0xa92: 0x07ba, 0xa93: 0x0816, 0xa94: 0x07c6, 0xa95: 0x0a76, 0xa96: 0x07ca, 0xa97: 0x07e2, - 0xa98: 0x07ce, 0xa99: 0x108e, 0xa9a: 0x0802, 0xa9b: 0x07d6, 0xa9c: 0x07be, 0xa9d: 0x0afa, - 0xa9e: 0x0a8a, 0xa9f: 0x082a, - // Block 0x2b, offset 0xac0 - 0xac0: 0x2184, 0xac1: 0x218a, 0xac2: 0x2190, 0xac3: 0x2196, 0xac4: 0x219c, 0xac5: 0x21a2, - 0xac6: 0x21a8, 0xac7: 0x21ae, 0xac8: 0x21b4, 0xac9: 0x21ba, 0xaca: 0x21c0, 0xacb: 0x21c6, - 0xacc: 0x21cc, 0xacd: 0x21d2, 0xace: 0x285d, 0xacf: 0x2866, 0xad0: 0x286f, 0xad1: 0x2878, - 0xad2: 0x2881, 0xad3: 0x288a, 0xad4: 0x2893, 0xad5: 0x289c, 0xad6: 0x28a5, 0xad7: 0x28b7, - 0xad8: 0x28c0, 0xad9: 0x28c9, 0xada: 0x28d2, 0xadb: 0x28db, 0xadc: 0x28ae, 0xadd: 0x2ce3, - 0xade: 0x2c24, 0xae0: 0x21d8, 0xae1: 0x21f0, 0xae2: 0x21e4, 0xae3: 0x2238, - 0xae4: 0x21f6, 0xae5: 0x2214, 0xae6: 0x21de, 0xae7: 0x220e, 0xae8: 0x21ea, 0xae9: 0x2220, - 0xaea: 0x2250, 0xaeb: 0x226e, 0xaec: 0x2268, 0xaed: 0x225c, 0xaee: 0x22aa, 0xaef: 0x223e, - 0xaf0: 0x224a, 0xaf1: 0x2262, 0xaf2: 0x2256, 0xaf3: 0x2280, 0xaf4: 0x222c, 0xaf5: 0x2274, - 0xaf6: 0x229e, 0xaf7: 0x2286, 0xaf8: 0x221a, 0xaf9: 0x21fc, 0xafa: 0x2232, 0xafb: 0x2244, - 0xafc: 0x227a, 0xafd: 0x2202, 0xafe: 0x22a4, 0xaff: 0x2226, - // Block 0x2c, offset 0xb00 - 0xb00: 0x228c, 0xb01: 0x2208, 0xb02: 0x2292, 0xb03: 0x2298, 0xb04: 0x0a2a, 0xb05: 0x0bfe, - 0xb06: 0x0da2, 0xb07: 0x11c2, - 0xb10: 0x1cf4, 0xb11: 0x19d6, - 0xb12: 0x19d9, 0xb13: 0x19dc, 0xb14: 0x19df, 0xb15: 0x19e2, 0xb16: 0x19e5, 0xb17: 0x19e8, - 0xb18: 0x19eb, 0xb19: 0x19ee, 0xb1a: 0x19f7, 0xb1b: 0x19fa, 0xb1c: 0x19fd, 0xb1d: 0x1a00, - 0xb1e: 0x1a03, 0xb1f: 0x1a06, 0xb20: 0x0406, 0xb21: 0x040e, 0xb22: 0x0412, 0xb23: 0x041a, - 0xb24: 0x041e, 0xb25: 0x0422, 0xb26: 0x042a, 0xb27: 0x0432, 0xb28: 0x0436, 0xb29: 0x043e, - 0xb2a: 0x0442, 0xb2b: 0x0446, 0xb2c: 0x044a, 0xb2d: 0x044e, 0xb2e: 0x46c3, 0xb2f: 0x46cb, - 0xb30: 0x46d3, 0xb31: 0x46db, 0xb32: 0x46e3, 0xb33: 0x46eb, 0xb34: 0x46f3, 0xb35: 0x46fb, - 0xb36: 0x470b, 0xb37: 0x4713, 0xb38: 0x471b, 0xb39: 0x4723, 0xb3a: 0x472b, 0xb3b: 0x4733, - 0xb3c: 0x2e42, 0xb3d: 0x2e0a, 0xb3e: 0x4703, - // Block 0x2d, offset 0xb40 - 0xb40: 0x07ba, 0xb41: 0x0816, 0xb42: 0x07c6, 0xb43: 0x0a76, 0xb44: 0x081a, 0xb45: 0x08aa, - 0xb46: 0x07c2, 0xb47: 0x08a6, 0xb48: 0x0806, 0xb49: 0x0982, 0xb4a: 0x0e02, 0xb4b: 0x0f8a, - 0xb4c: 0x0ed2, 0xb4d: 0x0e16, 0xb4e: 0x155a, 0xb4f: 0x0a86, 0xb50: 0x0dca, 0xb51: 0x0e46, - 0xb52: 0x0e06, 0xb53: 0x1146, 0xb54: 0x09f6, 0xb55: 0x0ffe, 0xb56: 0x1482, 0xb57: 0x115a, - 0xb58: 0x093e, 0xb59: 0x118a, 0xb5a: 0x1096, 0xb5b: 0x0b12, 0xb5c: 0x150a, 0xb5d: 0x087a, - 0xb5e: 0x09a6, 0xb5f: 0x0ef2, 0xb60: 0x1622, 0xb61: 0x083e, 0xb62: 0x08ce, 0xb63: 0x0e96, - 0xb64: 0x07ca, 0xb65: 0x07e2, 0xb66: 0x07ce, 0xb67: 0x0bd6, 0xb68: 0x09ea, 0xb69: 0x097a, - 0xb6a: 0x0b52, 0xb6b: 0x0b46, 0xb6c: 0x10e6, 0xb6d: 0x083a, 0xb6e: 0x1496, 0xb6f: 0x0996, - 0xb70: 0x0aee, 0xb71: 0x1a09, 0xb72: 0x1a0c, 0xb73: 0x1a0f, 0xb74: 0x1a12, 0xb75: 0x1a1b, - 0xb76: 0x1a1e, 0xb77: 0x1a21, 0xb78: 0x1a24, 0xb79: 0x1a27, 0xb7a: 0x1a2a, 0xb7b: 0x1a2d, - 0xb7c: 0x1a30, 0xb7d: 0x1a33, 0xb7e: 0x1a36, 0xb7f: 0x1a3f, - // Block 0x2e, offset 0xb80 - 0xb80: 0x1df6, 0xb81: 0x1e05, 0xb82: 0x1e14, 0xb83: 0x1e23, 0xb84: 0x1e32, 0xb85: 0x1e41, - 0xb86: 0x1e50, 0xb87: 0x1e5f, 0xb88: 0x1e6e, 0xb89: 0x22bc, 0xb8a: 0x22ce, 0xb8b: 0x22e0, - 0xb8c: 0x1a81, 0xb8d: 0x1d34, 0xb8e: 0x1b02, 0xb8f: 0x1cd8, 0xb90: 0x05c6, 0xb91: 0x05ce, - 0xb92: 0x05d6, 0xb93: 0x05de, 0xb94: 0x05e6, 0xb95: 0x05ea, 0xb96: 0x05ee, 0xb97: 0x05f2, - 0xb98: 0x05f6, 0xb99: 0x05fa, 0xb9a: 0x05fe, 0xb9b: 0x0602, 0xb9c: 0x0606, 0xb9d: 0x060a, - 0xb9e: 0x060e, 0xb9f: 0x0612, 0xba0: 0x0616, 0xba1: 0x061e, 0xba2: 0x0622, 0xba3: 0x0626, - 0xba4: 0x062a, 0xba5: 0x062e, 0xba6: 0x0632, 0xba7: 0x0636, 0xba8: 0x063a, 0xba9: 0x063e, - 0xbaa: 0x0642, 0xbab: 0x0646, 0xbac: 0x064a, 0xbad: 0x064e, 0xbae: 0x0652, 0xbaf: 0x0656, - 0xbb0: 0x065a, 0xbb1: 0x065e, 0xbb2: 0x0662, 0xbb3: 0x066a, 0xbb4: 0x0672, 0xbb5: 0x067a, - 0xbb6: 0x067e, 0xbb7: 0x0682, 0xbb8: 0x0686, 0xbb9: 0x068a, 0xbba: 0x068e, 0xbbb: 0x0692, - 0xbbc: 0x0696, 0xbbd: 0x069a, 0xbbe: 0x069e, 0xbbf: 0x282a, - // Block 0x2f, offset 0xbc0 - 0xbc0: 0x2c43, 0xbc1: 0x2adf, 0xbc2: 0x2c53, 0xbc3: 0x29b7, 0xbc4: 0x2e53, 0xbc5: 0x29c1, - 0xbc6: 0x29cb, 0xbc7: 0x2e97, 0xbc8: 0x2aec, 0xbc9: 0x29d5, 0xbca: 0x29df, 0xbcb: 0x29e9, - 0xbcc: 0x2b13, 0xbcd: 0x2b20, 0xbce: 0x2af9, 0xbcf: 0x2b06, 0xbd0: 0x2e18, 0xbd1: 0x2b2d, - 0xbd2: 0x2b3a, 0xbd3: 0x2cf5, 0xbd4: 0x27eb, 0xbd5: 0x2d08, 0xbd6: 0x2d1b, 0xbd7: 0x2c63, - 0xbd8: 0x2b47, 0xbd9: 0x2d2e, 0xbda: 0x2d41, 0xbdb: 0x2b54, 0xbdc: 0x29f3, 0xbdd: 0x29fd, - 0xbde: 0x2e26, 0xbdf: 0x2b61, 0xbe0: 0x2c73, 0xbe1: 0x2e64, 0xbe2: 0x2a07, 0xbe3: 0x2a11, - 0xbe4: 0x2b6e, 0xbe5: 0x2a1b, 0xbe6: 0x2a25, 0xbe7: 0x2800, 0xbe8: 0x2807, 0xbe9: 0x2a2f, - 0xbea: 0x2a39, 0xbeb: 0x2d54, 0xbec: 0x2b7b, 0xbed: 0x2c83, 0xbee: 0x2d67, 0xbef: 0x2b88, - 0xbf0: 0x2a4d, 0xbf1: 0x2a43, 0xbf2: 0x2eab, 0xbf3: 0x2b95, 0xbf4: 0x2d7a, 0xbf5: 0x2a57, - 0xbf6: 0x2c93, 0xbf7: 0x2a61, 0xbf8: 0x2baf, 0xbf9: 0x2a6b, 0xbfa: 0x2bbc, 0xbfb: 0x2e75, - 0xbfc: 0x2ba2, 0xbfd: 0x2ca3, 0xbfe: 0x2bc9, 0xbff: 0x280e, - // Block 0x30, offset 0xc00 - 0xc00: 0x2e86, 0xc01: 0x2a75, 0xc02: 0x2a7f, 0xc03: 0x2bd6, 0xc04: 0x2a89, 0xc05: 0x2a93, - 0xc06: 0x2a9d, 0xc07: 0x2cb3, 0xc08: 0x2be3, 0xc09: 0x2815, 0xc0a: 0x2d8d, 0xc0b: 0x2dff, - 0xc0c: 0x2cc3, 0xc0d: 0x2bf0, 0xc0e: 0x2e34, 0xc0f: 0x2aa7, 0xc10: 0x2ab1, 0xc11: 0x2bfd, - 0xc12: 0x281c, 0xc13: 0x2c0a, 0xc14: 0x2cd3, 0xc15: 0x2823, 0xc16: 0x2da0, 0xc17: 0x2abb, - 0xc18: 0x1de7, 0xc19: 0x1dfb, 0xc1a: 0x1e0a, 0xc1b: 0x1e19, 0xc1c: 0x1e28, 0xc1d: 0x1e37, - 0xc1e: 0x1e46, 0xc1f: 0x1e55, 0xc20: 0x1e64, 0xc21: 0x1e73, 0xc22: 0x22c2, 0xc23: 0x22d4, - 0xc24: 0x22e6, 0xc25: 0x22f2, 0xc26: 0x22fe, 0xc27: 0x230a, 0xc28: 0x2316, 0xc29: 0x2322, - 0xc2a: 0x232e, 0xc2b: 0x233a, 0xc2c: 0x2376, 0xc2d: 0x2382, 0xc2e: 0x238e, 0xc2f: 0x239a, - 0xc30: 0x23a6, 0xc31: 0x1d44, 0xc32: 0x1af6, 0xc33: 0x1a63, 0xc34: 0x1d14, 0xc35: 0x1b77, - 0xc36: 0x1b86, 0xc37: 0x1afc, 0xc38: 0x1d2c, 0xc39: 0x1d30, 0xc3a: 0x1a8d, 0xc3b: 0x2838, - 0xc3c: 0x2846, 0xc3d: 0x2831, 0xc3e: 0x283f, 0xc3f: 0x2c17, - // Block 0x31, offset 0xc40 - 0xc40: 0x1b7a, 0xc41: 0x1b62, 0xc42: 0x1d90, 0xc43: 0x1b4a, 0xc44: 0x1b23, 0xc45: 0x1a96, - 0xc46: 0x1aa5, 0xc47: 0x1a75, 0xc48: 0x1d20, 0xc49: 0x1e82, 0xc4a: 0x1b7d, 0xc4b: 0x1b65, - 0xc4c: 0x1d94, 0xc4d: 0x1da0, 0xc4e: 0x1b56, 0xc4f: 0x1b2c, 0xc50: 0x1a84, 0xc51: 0x1d4c, - 0xc52: 0x1ce0, 0xc53: 0x1ccc, 0xc54: 0x1cfc, 0xc55: 0x1da4, 0xc56: 0x1b59, 0xc57: 0x1af9, - 0xc58: 0x1b2f, 0xc59: 0x1b0e, 0xc5a: 0x1b71, 0xc5b: 0x1da8, 0xc5c: 0x1b5c, 0xc5d: 0x1af0, - 0xc5e: 0x1b32, 0xc5f: 0x1d6c, 0xc60: 0x1d24, 0xc61: 0x1b44, 0xc62: 0x1d54, 0xc63: 0x1d70, - 0xc64: 0x1d28, 0xc65: 0x1b47, 0xc66: 0x1d58, 0xc67: 0x2418, 0xc68: 0x242c, 0xc69: 0x1ac6, - 0xc6a: 0x1d50, 0xc6b: 0x1ce4, 0xc6c: 0x1cd0, 0xc6d: 0x1d78, 0xc6e: 0x284d, 0xc6f: 0x28e4, - 0xc70: 0x1b89, 0xc71: 0x1b74, 0xc72: 0x1dac, 0xc73: 0x1b5f, 0xc74: 0x1b80, 0xc75: 0x1b68, - 0xc76: 0x1d98, 0xc77: 0x1b4d, 0xc78: 0x1b26, 0xc79: 0x1ab1, 0xc7a: 0x1b83, 0xc7b: 0x1b6b, - 0xc7c: 0x1d9c, 0xc7d: 0x1b50, 0xc7e: 0x1b29, 0xc7f: 0x1ab4, - // Block 0x32, offset 0xc80 - 0xc80: 0x1d5c, 0xc81: 0x1ce8, 0xc82: 0x1e7d, 0xc83: 0x1a66, 0xc84: 0x1aea, 0xc85: 0x1aed, - 0xc86: 0x2425, 0xc87: 0x1cc4, 0xc88: 0x1af3, 0xc89: 0x1a78, 0xc8a: 0x1b11, 0xc8b: 0x1a7b, - 0xc8c: 0x1b1a, 0xc8d: 0x1a99, 0xc8e: 0x1a9c, 0xc8f: 0x1b35, 0xc90: 0x1b3b, 0xc91: 0x1b3e, - 0xc92: 0x1d60, 0xc93: 0x1b41, 0xc94: 0x1b53, 0xc95: 0x1d68, 0xc96: 0x1d74, 0xc97: 0x1ac0, - 0xc98: 0x1e87, 0xc99: 0x1cec, 0xc9a: 0x1ac3, 0xc9b: 0x1b8c, 0xc9c: 0x1ad5, 0xc9d: 0x1ae4, - 0xc9e: 0x2412, 0xc9f: 0x240c, 0xca0: 0x1df1, 0xca1: 0x1e00, 0xca2: 0x1e0f, 0xca3: 0x1e1e, - 0xca4: 0x1e2d, 0xca5: 0x1e3c, 0xca6: 0x1e4b, 0xca7: 0x1e5a, 0xca8: 0x1e69, 0xca9: 0x22b6, - 0xcaa: 0x22c8, 0xcab: 0x22da, 0xcac: 0x22ec, 0xcad: 0x22f8, 0xcae: 0x2304, 0xcaf: 0x2310, - 0xcb0: 0x231c, 0xcb1: 0x2328, 0xcb2: 0x2334, 0xcb3: 0x2370, 0xcb4: 0x237c, 0xcb5: 0x2388, - 0xcb6: 0x2394, 0xcb7: 0x23a0, 0xcb8: 0x23ac, 0xcb9: 0x23b2, 0xcba: 0x23b8, 0xcbb: 0x23be, - 0xcbc: 0x23c4, 0xcbd: 0x23d6, 0xcbe: 0x23dc, 0xcbf: 0x1d40, - // Block 0x33, offset 0xcc0 - 0xcc0: 0x1472, 0xcc1: 0x0df6, 0xcc2: 0x14ce, 0xcc3: 0x149a, 0xcc4: 0x0f52, 0xcc5: 0x07e6, - 0xcc6: 0x09da, 0xcc7: 0x1726, 0xcc8: 0x1726, 0xcc9: 0x0b06, 0xcca: 0x155a, 0xccb: 0x0a3e, - 0xccc: 0x0b02, 0xccd: 0x0cea, 0xcce: 0x10ca, 0xccf: 0x125a, 0xcd0: 0x1392, 0xcd1: 0x13ce, - 0xcd2: 0x1402, 0xcd3: 0x1516, 0xcd4: 0x0e6e, 0xcd5: 0x0efa, 0xcd6: 0x0fa6, 0xcd7: 0x103e, - 0xcd8: 0x135a, 0xcd9: 0x1542, 0xcda: 0x166e, 0xcdb: 0x080a, 0xcdc: 0x09ae, 0xcdd: 0x0e82, - 0xcde: 0x0fca, 0xcdf: 0x138e, 0xce0: 0x16be, 0xce1: 0x0bae, 0xce2: 0x0f72, 0xce3: 0x137e, - 0xce4: 0x1412, 0xce5: 0x0d1e, 0xce6: 0x12b6, 0xce7: 0x13da, 0xce8: 0x0c1a, 0xce9: 0x0e0a, - 0xcea: 0x0f12, 0xceb: 0x1016, 0xcec: 0x1522, 0xced: 0x084a, 0xcee: 0x08e2, 0xcef: 0x094e, - 0xcf0: 0x0d86, 0xcf1: 0x0e7a, 0xcf2: 0x0fc6, 0xcf3: 0x10ea, 0xcf4: 0x1272, 0xcf5: 0x1386, - 0xcf6: 0x139e, 0xcf7: 0x14c2, 0xcf8: 0x15ea, 0xcf9: 0x169e, 0xcfa: 0x16ba, 0xcfb: 0x1126, - 0xcfc: 0x1166, 0xcfd: 0x121e, 0xcfe: 0x133e, 0xcff: 0x1576, - // Block 0x34, offset 0xd00 - 0xd00: 0x16c6, 0xd01: 0x1446, 0xd02: 0x0ac2, 0xd03: 0x0c36, 0xd04: 0x11d6, 0xd05: 0x1296, - 0xd06: 0x0ffa, 0xd07: 0x112e, 0xd08: 0x1492, 0xd09: 0x15e2, 0xd0a: 0x0abe, 0xd0b: 0x0b8a, - 0xd0c: 0x0e72, 0xd0d: 0x0f26, 0xd0e: 0x0f5a, 0xd0f: 0x120e, 0xd10: 0x1236, 0xd11: 0x15a2, - 0xd12: 0x094a, 0xd13: 0x12a2, 0xd14: 0x08ee, 0xd15: 0x08ea, 0xd16: 0x1192, 0xd17: 0x1222, - 0xd18: 0x1356, 0xd19: 0x15aa, 0xd1a: 0x1462, 0xd1b: 0x0d22, 0xd1c: 0x0e6e, 0xd1d: 0x1452, - 0xd1e: 0x07f2, 0xd1f: 0x0b5e, 0xd20: 0x0c8e, 0xd21: 0x102a, 0xd22: 0x10aa, 0xd23: 0x096e, - 0xd24: 0x1136, 0xd25: 0x085a, 0xd26: 0x0c72, 0xd27: 0x07d2, 0xd28: 0x0ee6, 0xd29: 0x0d9e, - 0xd2a: 0x120a, 0xd2b: 0x09c2, 0xd2c: 0x0aae, 0xd2d: 0x10f6, 0xd2e: 0x135e, 0xd2f: 0x1436, - 0xd30: 0x0eb2, 0xd31: 0x14f2, 0xd32: 0x0ede, 0xd33: 0x0d32, 0xd34: 0x1316, 0xd35: 0x0d52, - 0xd36: 0x10a6, 0xd37: 0x0826, 0xd38: 0x08a2, 0xd39: 0x08e6, 0xd3a: 0x0e4e, 0xd3b: 0x11f6, - 0xd3c: 0x12ee, 0xd3d: 0x1442, 0xd3e: 0x1556, 0xd3f: 0x0956, - // Block 0x35, offset 0xd40 - 0xd40: 0x0a0a, 0xd41: 0x0b12, 0xd42: 0x0c2a, 0xd43: 0x0dba, 0xd44: 0x0f76, 0xd45: 0x113a, - 0xd46: 0x1592, 0xd47: 0x1676, 0xd48: 0x16ca, 0xd49: 0x16e2, 0xd4a: 0x0932, 0xd4b: 0x0dee, - 0xd4c: 0x0e9e, 0xd4d: 0x14e6, 0xd4e: 0x0bf6, 0xd4f: 0x0cd2, 0xd50: 0x0cee, 0xd51: 0x0d7e, - 0xd52: 0x0f66, 0xd53: 0x0fb2, 0xd54: 0x1062, 0xd55: 0x1186, 0xd56: 0x122a, 0xd57: 0x128e, - 0xd58: 0x14d6, 0xd59: 0x1366, 0xd5a: 0x14fe, 0xd5b: 0x157a, 0xd5c: 0x090a, 0xd5d: 0x0936, - 0xd5e: 0x0a1e, 0xd5f: 0x0fa2, 0xd60: 0x13ee, 0xd61: 0x1436, 0xd62: 0x0c16, 0xd63: 0x0c86, - 0xd64: 0x0d4a, 0xd65: 0x0eaa, 0xd66: 0x11d2, 0xd67: 0x101e, 0xd68: 0x0836, 0xd69: 0x0a7a, - 0xd6a: 0x0b5e, 0xd6b: 0x0bc2, 0xd6c: 0x0c92, 0xd6d: 0x103a, 0xd6e: 0x1056, 0xd6f: 0x1266, - 0xd70: 0x1286, 0xd71: 0x155e, 0xd72: 0x15de, 0xd73: 0x15ee, 0xd74: 0x162a, 0xd75: 0x084e, - 0xd76: 0x117a, 0xd77: 0x154a, 0xd78: 0x15c6, 0xd79: 0x0caa, 0xd7a: 0x0812, 0xd7b: 0x0872, - 0xd7c: 0x0b62, 0xd7d: 0x0b82, 0xd7e: 0x0daa, 0xd7f: 0x0e6e, - // Block 0x36, offset 0xd80 - 0xd80: 0x0fbe, 0xd81: 0x10c6, 0xd82: 0x1372, 0xd83: 0x1512, 0xd84: 0x171e, 0xd85: 0x0dde, - 0xd86: 0x159e, 0xd87: 0x092e, 0xd88: 0x0e2a, 0xd89: 0x0e36, 0xd8a: 0x0f0a, 0xd8b: 0x0f42, - 0xd8c: 0x1046, 0xd8d: 0x10a2, 0xd8e: 0x1122, 0xd8f: 0x1206, 0xd90: 0x1636, 0xd91: 0x08aa, - 0xd92: 0x0cfe, 0xd93: 0x15ae, 0xd94: 0x0862, 0xd95: 0x0ba6, 0xd96: 0x0f2a, 0xd97: 0x14da, - 0xd98: 0x0c62, 0xd99: 0x0cb2, 0xd9a: 0x0e3e, 0xd9b: 0x102a, 0xd9c: 0x15b6, 0xd9d: 0x0912, - 0xd9e: 0x09fa, 0xd9f: 0x0b92, 0xda0: 0x0dce, 0xda1: 0x0e1a, 0xda2: 0x0e5a, 0xda3: 0x0eee, - 0xda4: 0x1042, 0xda5: 0x10b6, 0xda6: 0x1252, 0xda7: 0x13f2, 0xda8: 0x13fe, 0xda9: 0x1552, - 0xdaa: 0x15d2, 0xdab: 0x097e, 0xdac: 0x0f46, 0xdad: 0x09fe, 0xdae: 0x0fc2, 0xdaf: 0x1066, - 0xdb0: 0x1382, 0xdb1: 0x15ba, 0xdb2: 0x16a6, 0xdb3: 0x16ce, 0xdb4: 0x0e32, 0xdb5: 0x0f22, - 0xdb6: 0x12be, 0xdb7: 0x11b2, 0xdb8: 0x11be, 0xdb9: 0x11e2, 0xdba: 0x1012, 0xdbb: 0x0f9a, - 0xdbc: 0x145e, 0xdbd: 0x082e, 0xdbe: 0x1326, 0xdbf: 0x0916, - // Block 0x37, offset 0xdc0 - 0xdc0: 0x0906, 0xdc1: 0x0c06, 0xdc2: 0x0d26, 0xdc3: 0x11ee, 0xdc4: 0x0b4e, 0xdc5: 0x0efe, - 0xdc6: 0x0dea, 0xdc7: 0x14e2, 0xdc8: 0x13e2, 0xdc9: 0x15a6, 0xdca: 0x141e, 0xdcb: 0x0c22, - 0xdcc: 0x0882, 0xdcd: 0x0a56, 0xdd0: 0x0aaa, - 0xdd2: 0x0dda, 0xdd5: 0x08f2, 0xdd6: 0x101a, 0xdd7: 0x10de, - 0xdd8: 0x1142, 0xdd9: 0x115e, 0xdda: 0x1162, 0xddb: 0x1176, 0xddc: 0x15f6, 0xddd: 0x11e6, - 0xdde: 0x126a, 0xde0: 0x138a, 0xde2: 0x144e, - 0xde5: 0x1502, 0xde6: 0x152e, - 0xdea: 0x164a, 0xdeb: 0x164e, 0xdec: 0x1652, 0xded: 0x16b6, 0xdee: 0x1526, 0xdef: 0x15c2, - 0xdf0: 0x0852, 0xdf1: 0x0876, 0xdf2: 0x088a, 0xdf3: 0x0946, 0xdf4: 0x0952, 0xdf5: 0x0992, - 0xdf6: 0x0a46, 0xdf7: 0x0a62, 0xdf8: 0x0a6a, 0xdf9: 0x0aa6, 0xdfa: 0x0ab2, 0xdfb: 0x0b8e, - 0xdfc: 0x0b96, 0xdfd: 0x0c9e, 0xdfe: 0x0cc6, 0xdff: 0x0cce, - // Block 0x38, offset 0xe00 - 0xe00: 0x0ce6, 0xe01: 0x0d92, 0xe02: 0x0dc2, 0xe03: 0x0de2, 0xe04: 0x0e52, 0xe05: 0x0f16, - 0xe06: 0x0f32, 0xe07: 0x0f62, 0xe08: 0x0fb6, 0xe09: 0x0fd6, 0xe0a: 0x104a, 0xe0b: 0x112a, - 0xe0c: 0x1146, 0xe0d: 0x114e, 0xe0e: 0x114a, 0xe0f: 0x1152, 0xe10: 0x1156, 0xe11: 0x115a, - 0xe12: 0x116e, 0xe13: 0x1172, 0xe14: 0x1196, 0xe15: 0x11aa, 0xe16: 0x11c6, 0xe17: 0x122a, - 0xe18: 0x1232, 0xe19: 0x123a, 0xe1a: 0x124e, 0xe1b: 0x1276, 0xe1c: 0x12c6, 0xe1d: 0x12fa, - 0xe1e: 0x12fa, 0xe1f: 0x1362, 0xe20: 0x140a, 0xe21: 0x1422, 0xe22: 0x1456, 0xe23: 0x145a, - 0xe24: 0x149e, 0xe25: 0x14a2, 0xe26: 0x14fa, 0xe27: 0x1502, 0xe28: 0x15d6, 0xe29: 0x161a, - 0xe2a: 0x1632, 0xe2b: 0x0c96, 0xe2c: 0x184b, 0xe2d: 0x12de, - 0xe30: 0x07da, 0xe31: 0x08de, 0xe32: 0x089e, 0xe33: 0x0846, 0xe34: 0x0886, 0xe35: 0x08b2, - 0xe36: 0x0942, 0xe37: 0x095e, 0xe38: 0x0a46, 0xe39: 0x0a32, 0xe3a: 0x0a42, 0xe3b: 0x0a5e, - 0xe3c: 0x0aaa, 0xe3d: 0x0aba, 0xe3e: 0x0afe, 0xe3f: 0x0b0a, - // Block 0x39, offset 0xe40 - 0xe40: 0x0b26, 0xe41: 0x0b36, 0xe42: 0x0c1e, 0xe43: 0x0c26, 0xe44: 0x0c56, 0xe45: 0x0c76, - 0xe46: 0x0ca6, 0xe47: 0x0cbe, 0xe48: 0x0cae, 0xe49: 0x0cce, 0xe4a: 0x0cc2, 0xe4b: 0x0ce6, - 0xe4c: 0x0d02, 0xe4d: 0x0d5a, 0xe4e: 0x0d66, 0xe4f: 0x0d6e, 0xe50: 0x0d96, 0xe51: 0x0dda, - 0xe52: 0x0e0a, 0xe53: 0x0e0e, 0xe54: 0x0e22, 0xe55: 0x0ea2, 0xe56: 0x0eb2, 0xe57: 0x0f0a, - 0xe58: 0x0f56, 0xe59: 0x0f4e, 0xe5a: 0x0f62, 0xe5b: 0x0f7e, 0xe5c: 0x0fb6, 0xe5d: 0x110e, - 0xe5e: 0x0fda, 0xe5f: 0x100e, 0xe60: 0x101a, 0xe61: 0x105a, 0xe62: 0x1076, 0xe63: 0x109a, - 0xe64: 0x10be, 0xe65: 0x10c2, 0xe66: 0x10de, 0xe67: 0x10e2, 0xe68: 0x10f2, 0xe69: 0x1106, - 0xe6a: 0x1102, 0xe6b: 0x1132, 0xe6c: 0x11ae, 0xe6d: 0x11c6, 0xe6e: 0x11de, 0xe6f: 0x1216, - 0xe70: 0x122a, 0xe71: 0x1246, 0xe72: 0x1276, 0xe73: 0x132a, 0xe74: 0x1352, 0xe75: 0x13c6, - 0xe76: 0x140e, 0xe77: 0x141a, 0xe78: 0x1422, 0xe79: 0x143a, 0xe7a: 0x144e, 0xe7b: 0x143e, - 0xe7c: 0x1456, 0xe7d: 0x1452, 0xe7e: 0x144a, 0xe7f: 0x145a, - // Block 0x3a, offset 0xe80 - 0xe80: 0x1466, 0xe81: 0x14a2, 0xe82: 0x14de, 0xe83: 0x150e, 0xe84: 0x1546, 0xe85: 0x1566, - 0xe86: 0x15b2, 0xe87: 0x15d6, 0xe88: 0x15f6, 0xe89: 0x160a, 0xe8a: 0x161a, 0xe8b: 0x1626, - 0xe8c: 0x1632, 0xe8d: 0x1686, 0xe8e: 0x1726, 0xe8f: 0x17e2, 0xe90: 0x17dd, 0xe91: 0x180f, - 0xe92: 0x0702, 0xe93: 0x072a, 0xe94: 0x072e, 0xe95: 0x1891, 0xe96: 0x18be, 0xe97: 0x1936, - 0xe98: 0x1712, 0xe99: 0x1722, - // Block 0x3b, offset 0xec0 - 0xec0: 0x1b05, 0xec1: 0x1b08, 0xec2: 0x1b0b, 0xec3: 0x1d38, 0xec4: 0x1d3c, 0xec5: 0x1b8f, - 0xec6: 0x1b8f, - 0xed3: 0x1ea5, 0xed4: 0x1e96, 0xed5: 0x1e9b, 0xed6: 0x1eaa, 0xed7: 0x1ea0, - 0xedd: 0x448f, - 0xede: 0x8116, 0xedf: 0x4501, 0xee0: 0x0320, 0xee1: 0x0308, 0xee2: 0x0311, 0xee3: 0x0314, - 0xee4: 0x0317, 0xee5: 0x031a, 0xee6: 0x031d, 0xee7: 0x0323, 0xee8: 0x0326, 0xee9: 0x0017, - 0xeea: 0x44ef, 0xeeb: 0x44f5, 0xeec: 0x45f3, 0xeed: 0x45fb, 0xeee: 0x4447, 0xeef: 0x444d, - 0xef0: 0x4453, 0xef1: 0x4459, 0xef2: 0x4465, 0xef3: 0x446b, 0xef4: 0x4471, 0xef5: 0x447d, - 0xef6: 0x4483, 0xef8: 0x4489, 0xef9: 0x4495, 0xefa: 0x449b, 0xefb: 0x44a1, - 0xefc: 0x44ad, 0xefe: 0x44b3, - // Block 0x3c, offset 0xf00 - 0xf00: 0x44b9, 0xf01: 0x44bf, 0xf03: 0x44c5, 0xf04: 0x44cb, - 0xf06: 0x44d7, 0xf07: 0x44dd, 0xf08: 0x44e3, 0xf09: 0x44e9, 0xf0a: 0x44fb, 0xf0b: 0x4477, - 0xf0c: 0x445f, 0xf0d: 0x44a7, 0xf0e: 0x44d1, 0xf0f: 0x1eaf, 0xf10: 0x038c, 0xf11: 0x038c, - 0xf12: 0x0395, 0xf13: 0x0395, 0xf14: 0x0395, 0xf15: 0x0395, 0xf16: 0x0398, 0xf17: 0x0398, - 0xf18: 0x0398, 0xf19: 0x0398, 0xf1a: 0x039e, 0xf1b: 0x039e, 0xf1c: 0x039e, 0xf1d: 0x039e, - 0xf1e: 0x0392, 0xf1f: 0x0392, 0xf20: 0x0392, 0xf21: 0x0392, 0xf22: 0x039b, 0xf23: 0x039b, - 0xf24: 0x039b, 0xf25: 0x039b, 0xf26: 0x038f, 0xf27: 0x038f, 0xf28: 0x038f, 0xf29: 0x038f, - 0xf2a: 0x03c2, 0xf2b: 0x03c2, 0xf2c: 0x03c2, 0xf2d: 0x03c2, 0xf2e: 0x03c5, 0xf2f: 0x03c5, - 0xf30: 0x03c5, 0xf31: 0x03c5, 0xf32: 0x03a4, 0xf33: 0x03a4, 0xf34: 0x03a4, 0xf35: 0x03a4, - 0xf36: 0x03a1, 0xf37: 0x03a1, 0xf38: 0x03a1, 0xf39: 0x03a1, 0xf3a: 0x03a7, 0xf3b: 0x03a7, - 0xf3c: 0x03a7, 0xf3d: 0x03a7, 0xf3e: 0x03aa, 0xf3f: 0x03aa, - // Block 0x3d, offset 0xf40 - 0xf40: 0x03aa, 0xf41: 0x03aa, 0xf42: 0x03b3, 0xf43: 0x03b3, 0xf44: 0x03b0, 0xf45: 0x03b0, - 0xf46: 0x03b6, 0xf47: 0x03b6, 0xf48: 0x03ad, 0xf49: 0x03ad, 0xf4a: 0x03bc, 0xf4b: 0x03bc, - 0xf4c: 0x03b9, 0xf4d: 0x03b9, 0xf4e: 0x03c8, 0xf4f: 0x03c8, 0xf50: 0x03c8, 0xf51: 0x03c8, - 0xf52: 0x03ce, 0xf53: 0x03ce, 0xf54: 0x03ce, 0xf55: 0x03ce, 0xf56: 0x03d4, 0xf57: 0x03d4, - 0xf58: 0x03d4, 0xf59: 0x03d4, 0xf5a: 0x03d1, 0xf5b: 0x03d1, 0xf5c: 0x03d1, 0xf5d: 0x03d1, - 0xf5e: 0x03d7, 0xf5f: 0x03d7, 0xf60: 0x03da, 0xf61: 0x03da, 0xf62: 0x03da, 0xf63: 0x03da, - 0xf64: 0x456d, 0xf65: 0x456d, 0xf66: 0x03e0, 0xf67: 0x03e0, 0xf68: 0x03e0, 0xf69: 0x03e0, - 0xf6a: 0x03dd, 0xf6b: 0x03dd, 0xf6c: 0x03dd, 0xf6d: 0x03dd, 0xf6e: 0x03fb, 0xf6f: 0x03fb, - 0xf70: 0x4567, 0xf71: 0x4567, - // Block 0x3e, offset 0xf80 - 0xf93: 0x03cb, 0xf94: 0x03cb, 0xf95: 0x03cb, 0xf96: 0x03cb, 0xf97: 0x03e9, - 0xf98: 0x03e9, 0xf99: 0x03e6, 0xf9a: 0x03e6, 0xf9b: 0x03ec, 0xf9c: 0x03ec, 0xf9d: 0x217f, - 0xf9e: 0x03f2, 0xf9f: 0x03f2, 0xfa0: 0x03e3, 0xfa1: 0x03e3, 0xfa2: 0x03ef, 0xfa3: 0x03ef, - 0xfa4: 0x03f8, 0xfa5: 0x03f8, 0xfa6: 0x03f8, 0xfa7: 0x03f8, 0xfa8: 0x0380, 0xfa9: 0x0380, - 0xfaa: 0x26da, 0xfab: 0x26da, 0xfac: 0x274a, 0xfad: 0x274a, 0xfae: 0x2719, 0xfaf: 0x2719, - 0xfb0: 0x2735, 0xfb1: 0x2735, 0xfb2: 0x272e, 0xfb3: 0x272e, 0xfb4: 0x273c, 0xfb5: 0x273c, - 0xfb6: 0x2743, 0xfb7: 0x2743, 0xfb8: 0x2743, 0xfb9: 0x2720, 0xfba: 0x2720, 0xfbb: 0x2720, - 0xfbc: 0x03f5, 0xfbd: 0x03f5, 0xfbe: 0x03f5, 0xfbf: 0x03f5, - // Block 0x3f, offset 0xfc0 - 0xfc0: 0x26e1, 0xfc1: 0x26e8, 0xfc2: 0x2704, 0xfc3: 0x2720, 0xfc4: 0x2727, 0xfc5: 0x1eb9, - 0xfc6: 0x1ebe, 0xfc7: 0x1ec3, 0xfc8: 0x1ed2, 0xfc9: 0x1ee1, 0xfca: 0x1ee6, 0xfcb: 0x1eeb, - 0xfcc: 0x1ef0, 0xfcd: 0x1ef5, 0xfce: 0x1f04, 0xfcf: 0x1f13, 0xfd0: 0x1f18, 0xfd1: 0x1f1d, - 0xfd2: 0x1f2c, 0xfd3: 0x1f3b, 0xfd4: 0x1f40, 0xfd5: 0x1f45, 0xfd6: 0x1f4a, 0xfd7: 0x1f59, - 0xfd8: 0x1f5e, 0xfd9: 0x1f6d, 0xfda: 0x1f72, 0xfdb: 0x1f77, 0xfdc: 0x1f86, 0xfdd: 0x1f8b, - 0xfde: 0x1f90, 0xfdf: 0x1f9a, 0xfe0: 0x1fd6, 0xfe1: 0x1fe5, 0xfe2: 0x1ff4, 0xfe3: 0x1ff9, - 0xfe4: 0x1ffe, 0xfe5: 0x2008, 0xfe6: 0x2017, 0xfe7: 0x201c, 0xfe8: 0x202b, 0xfe9: 0x2030, - 0xfea: 0x2035, 0xfeb: 0x2044, 0xfec: 0x2049, 0xfed: 0x2058, 0xfee: 0x205d, 0xfef: 0x2062, - 0xff0: 0x2067, 0xff1: 0x206c, 0xff2: 0x2071, 0xff3: 0x2076, 0xff4: 0x207b, 0xff5: 0x2080, - 0xff6: 0x2085, 0xff7: 0x208a, 0xff8: 0x208f, 0xff9: 0x2094, 0xffa: 0x2099, 0xffb: 0x209e, - 0xffc: 0x20a3, 0xffd: 0x20a8, 0xffe: 0x20ad, 0xfff: 0x20b7, - // Block 0x40, offset 0x1000 - 0x1000: 0x20bc, 0x1001: 0x20c1, 0x1002: 0x20c6, 0x1003: 0x20d0, 0x1004: 0x20d5, 0x1005: 0x20df, - 0x1006: 0x20e4, 0x1007: 0x20e9, 0x1008: 0x20ee, 0x1009: 0x20f3, 0x100a: 0x20f8, 0x100b: 0x20fd, - 0x100c: 0x2102, 0x100d: 0x2107, 0x100e: 0x2116, 0x100f: 0x2125, 0x1010: 0x212a, 0x1011: 0x212f, - 0x1012: 0x2134, 0x1013: 0x2139, 0x1014: 0x213e, 0x1015: 0x2148, 0x1016: 0x214d, 0x1017: 0x2152, - 0x1018: 0x2161, 0x1019: 0x2170, 0x101a: 0x2175, 0x101b: 0x451f, 0x101c: 0x4525, 0x101d: 0x455b, - 0x101e: 0x45b2, 0x101f: 0x45b9, 0x1020: 0x45c0, 0x1021: 0x45c7, 0x1022: 0x45ce, 0x1023: 0x45d5, - 0x1024: 0x26f6, 0x1025: 0x26fd, 0x1026: 0x2704, 0x1027: 0x270b, 0x1028: 0x2720, 0x1029: 0x2727, - 0x102a: 0x1ec8, 0x102b: 0x1ecd, 0x102c: 0x1ed2, 0x102d: 0x1ed7, 0x102e: 0x1ee1, 0x102f: 0x1ee6, - 0x1030: 0x1efa, 0x1031: 0x1eff, 0x1032: 0x1f04, 0x1033: 0x1f09, 0x1034: 0x1f13, 0x1035: 0x1f18, - 0x1036: 0x1f22, 0x1037: 0x1f27, 0x1038: 0x1f2c, 0x1039: 0x1f31, 0x103a: 0x1f3b, 0x103b: 0x1f40, - 0x103c: 0x206c, 0x103d: 0x2071, 0x103e: 0x2080, 0x103f: 0x2085, - // Block 0x41, offset 0x1040 - 0x1040: 0x208a, 0x1041: 0x209e, 0x1042: 0x20a3, 0x1043: 0x20a8, 0x1044: 0x20ad, 0x1045: 0x20c6, - 0x1046: 0x20d0, 0x1047: 0x20d5, 0x1048: 0x20da, 0x1049: 0x20ee, 0x104a: 0x210c, 0x104b: 0x2111, - 0x104c: 0x2116, 0x104d: 0x211b, 0x104e: 0x2125, 0x104f: 0x212a, 0x1050: 0x455b, 0x1051: 0x2157, - 0x1052: 0x215c, 0x1053: 0x2161, 0x1054: 0x2166, 0x1055: 0x2170, 0x1056: 0x2175, 0x1057: 0x26e1, - 0x1058: 0x26e8, 0x1059: 0x26ef, 0x105a: 0x2704, 0x105b: 0x2712, 0x105c: 0x1eb9, 0x105d: 0x1ebe, - 0x105e: 0x1ec3, 0x105f: 0x1ed2, 0x1060: 0x1edc, 0x1061: 0x1eeb, 0x1062: 0x1ef0, 0x1063: 0x1ef5, - 0x1064: 0x1f04, 0x1065: 0x1f0e, 0x1066: 0x1f2c, 0x1067: 0x1f45, 0x1068: 0x1f4a, 0x1069: 0x1f59, - 0x106a: 0x1f5e, 0x106b: 0x1f6d, 0x106c: 0x1f77, 0x106d: 0x1f86, 0x106e: 0x1f8b, 0x106f: 0x1f90, - 0x1070: 0x1f9a, 0x1071: 0x1fd6, 0x1072: 0x1fdb, 0x1073: 0x1fe5, 0x1074: 0x1ff4, 0x1075: 0x1ff9, - 0x1076: 0x1ffe, 0x1077: 0x2008, 0x1078: 0x2017, 0x1079: 0x202b, 0x107a: 0x2030, 0x107b: 0x2035, - 0x107c: 0x2044, 0x107d: 0x2049, 0x107e: 0x2058, 0x107f: 0x205d, - // Block 0x42, offset 0x1080 - 0x1080: 0x2062, 0x1081: 0x2067, 0x1082: 0x2076, 0x1083: 0x207b, 0x1084: 0x208f, 0x1085: 0x2094, - 0x1086: 0x2099, 0x1087: 0x209e, 0x1088: 0x20a3, 0x1089: 0x20b7, 0x108a: 0x20bc, 0x108b: 0x20c1, - 0x108c: 0x20c6, 0x108d: 0x20cb, 0x108e: 0x20df, 0x108f: 0x20e4, 0x1090: 0x20e9, 0x1091: 0x20ee, - 0x1092: 0x20fd, 0x1093: 0x2102, 0x1094: 0x2107, 0x1095: 0x2116, 0x1096: 0x2120, 0x1097: 0x212f, - 0x1098: 0x2134, 0x1099: 0x454f, 0x109a: 0x2148, 0x109b: 0x214d, 0x109c: 0x2152, 0x109d: 0x2161, - 0x109e: 0x216b, 0x109f: 0x2704, 0x10a0: 0x2712, 0x10a1: 0x1ed2, 0x10a2: 0x1edc, 0x10a3: 0x1f04, - 0x10a4: 0x1f0e, 0x10a5: 0x1f2c, 0x10a6: 0x1f36, 0x10a7: 0x1f9a, 0x10a8: 0x1f9f, 0x10a9: 0x1fc2, - 0x10aa: 0x1fc7, 0x10ab: 0x209e, 0x10ac: 0x20a3, 0x10ad: 0x20c6, 0x10ae: 0x2116, 0x10af: 0x2120, - 0x10b0: 0x2161, 0x10b1: 0x216b, 0x10b2: 0x4603, 0x10b3: 0x460b, 0x10b4: 0x4613, 0x10b5: 0x2021, - 0x10b6: 0x2026, 0x10b7: 0x203a, 0x10b8: 0x203f, 0x10b9: 0x204e, 0x10ba: 0x2053, 0x10bb: 0x1fa4, - 0x10bc: 0x1fa9, 0x10bd: 0x1fcc, 0x10be: 0x1fd1, 0x10bf: 0x1f63, - // Block 0x43, offset 0x10c0 - 0x10c0: 0x1f68, 0x10c1: 0x1f4f, 0x10c2: 0x1f54, 0x10c3: 0x1f7c, 0x10c4: 0x1f81, 0x10c5: 0x1fea, - 0x10c6: 0x1fef, 0x10c7: 0x200d, 0x10c8: 0x2012, 0x10c9: 0x1fae, 0x10ca: 0x1fb3, 0x10cb: 0x1fb8, - 0x10cc: 0x1fc2, 0x10cd: 0x1fbd, 0x10ce: 0x1f95, 0x10cf: 0x1fe0, 0x10d0: 0x2003, 0x10d1: 0x2021, - 0x10d2: 0x2026, 0x10d3: 0x203a, 0x10d4: 0x203f, 0x10d5: 0x204e, 0x10d6: 0x2053, 0x10d7: 0x1fa4, - 0x10d8: 0x1fa9, 0x10d9: 0x1fcc, 0x10da: 0x1fd1, 0x10db: 0x1f63, 0x10dc: 0x1f68, 0x10dd: 0x1f4f, - 0x10de: 0x1f54, 0x10df: 0x1f7c, 0x10e0: 0x1f81, 0x10e1: 0x1fea, 0x10e2: 0x1fef, 0x10e3: 0x200d, - 0x10e4: 0x2012, 0x10e5: 0x1fae, 0x10e6: 0x1fb3, 0x10e7: 0x1fb8, 0x10e8: 0x1fc2, 0x10e9: 0x1fbd, - 0x10ea: 0x1f95, 0x10eb: 0x1fe0, 0x10ec: 0x2003, 0x10ed: 0x1fae, 0x10ee: 0x1fb3, 0x10ef: 0x1fb8, - 0x10f0: 0x1fc2, 0x10f1: 0x1f9f, 0x10f2: 0x1fc7, 0x10f3: 0x201c, 0x10f4: 0x1f86, 0x10f5: 0x1f8b, - 0x10f6: 0x1f90, 0x10f7: 0x1fae, 0x10f8: 0x1fb3, 0x10f9: 0x1fb8, 0x10fa: 0x201c, 0x10fb: 0x202b, - 0x10fc: 0x4507, 0x10fd: 0x4507, - // Block 0x44, offset 0x1100 - 0x1110: 0x2441, 0x1111: 0x2456, - 0x1112: 0x2456, 0x1113: 0x245d, 0x1114: 0x2464, 0x1115: 0x2479, 0x1116: 0x2480, 0x1117: 0x2487, - 0x1118: 0x24aa, 0x1119: 0x24aa, 0x111a: 0x24cd, 0x111b: 0x24c6, 0x111c: 0x24e2, 0x111d: 0x24d4, - 0x111e: 0x24db, 0x111f: 0x24fe, 0x1120: 0x24fe, 0x1121: 0x24f7, 0x1122: 0x2505, 0x1123: 0x2505, - 0x1124: 0x252f, 0x1125: 0x252f, 0x1126: 0x254b, 0x1127: 0x2513, 0x1128: 0x2513, 0x1129: 0x250c, - 0x112a: 0x2521, 0x112b: 0x2521, 0x112c: 0x2528, 0x112d: 0x2528, 0x112e: 0x2552, 0x112f: 0x2560, - 0x1130: 0x2560, 0x1131: 0x2567, 0x1132: 0x2567, 0x1133: 0x256e, 0x1134: 0x2575, 0x1135: 0x257c, - 0x1136: 0x2583, 0x1137: 0x2583, 0x1138: 0x258a, 0x1139: 0x2598, 0x113a: 0x25a6, 0x113b: 0x259f, - 0x113c: 0x25ad, 0x113d: 0x25ad, 0x113e: 0x25c2, 0x113f: 0x25c9, - // Block 0x45, offset 0x1140 - 0x1140: 0x25fa, 0x1141: 0x2608, 0x1142: 0x2601, 0x1143: 0x25e5, 0x1144: 0x25e5, 0x1145: 0x260f, - 0x1146: 0x260f, 0x1147: 0x2616, 0x1148: 0x2616, 0x1149: 0x2640, 0x114a: 0x2647, 0x114b: 0x264e, - 0x114c: 0x2624, 0x114d: 0x2632, 0x114e: 0x2655, 0x114f: 0x265c, - 0x1152: 0x262b, 0x1153: 0x26b0, 0x1154: 0x26b7, 0x1155: 0x268d, 0x1156: 0x2694, 0x1157: 0x2678, - 0x1158: 0x2678, 0x1159: 0x267f, 0x115a: 0x26a9, 0x115b: 0x26a2, 0x115c: 0x26cc, 0x115d: 0x26cc, - 0x115e: 0x243a, 0x115f: 0x244f, 0x1160: 0x2448, 0x1161: 0x2472, 0x1162: 0x246b, 0x1163: 0x2495, - 0x1164: 0x248e, 0x1165: 0x24b8, 0x1166: 0x249c, 0x1167: 0x24b1, 0x1168: 0x24e9, 0x1169: 0x2536, - 0x116a: 0x251a, 0x116b: 0x2559, 0x116c: 0x25f3, 0x116d: 0x261d, 0x116e: 0x26c5, 0x116f: 0x26be, - 0x1170: 0x26d3, 0x1171: 0x266a, 0x1172: 0x25d0, 0x1173: 0x269b, 0x1174: 0x25c2, 0x1175: 0x25fa, - 0x1176: 0x2591, 0x1177: 0x25de, 0x1178: 0x2671, 0x1179: 0x2663, 0x117a: 0x25ec, 0x117b: 0x25d7, - 0x117c: 0x25ec, 0x117d: 0x2671, 0x117e: 0x24a3, 0x117f: 0x24bf, - // Block 0x46, offset 0x1180 - 0x1180: 0x2639, 0x1181: 0x25b4, 0x1182: 0x2433, 0x1183: 0x25d7, 0x1184: 0x257c, 0x1185: 0x254b, - 0x1186: 0x24f0, 0x1187: 0x2686, - 0x11b0: 0x2544, 0x11b1: 0x25bb, 0x11b2: 0x28f6, 0x11b3: 0x28ed, 0x11b4: 0x2923, 0x11b5: 0x2911, - 0x11b6: 0x28ff, 0x11b7: 0x291a, 0x11b8: 0x292c, 0x11b9: 0x253d, 0x11ba: 0x2db3, 0x11bb: 0x2c33, - 0x11bc: 0x2908, - // Block 0x47, offset 0x11c0 - 0x11d0: 0x0019, 0x11d1: 0x057e, - 0x11d2: 0x0582, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x05ba, - 0x11d8: 0x05be, 0x11d9: 0x1c8c, - 0x11e0: 0x8133, 0x11e1: 0x8133, 0x11e2: 0x8133, 0x11e3: 0x8133, - 0x11e4: 0x8133, 0x11e5: 0x8133, 0x11e6: 0x8133, 0x11e7: 0x812e, 0x11e8: 0x812e, 0x11e9: 0x812e, - 0x11ea: 0x812e, 0x11eb: 0x812e, 0x11ec: 0x812e, 0x11ed: 0x812e, 0x11ee: 0x8133, 0x11ef: 0x8133, - 0x11f0: 0x19a0, 0x11f1: 0x053a, 0x11f2: 0x0536, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011, - 0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x05b2, 0x11fa: 0x05b6, 0x11fb: 0x05a6, - 0x11fc: 0x05aa, 0x11fd: 0x058e, 0x11fe: 0x0592, 0x11ff: 0x0586, - // Block 0x48, offset 0x1200 - 0x1200: 0x058a, 0x1201: 0x0596, 0x1202: 0x059a, 0x1203: 0x059e, 0x1204: 0x05a2, - 0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x4368, 0x120a: 0x4368, 0x120b: 0x4368, - 0x120c: 0x4368, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x057e, - 0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003, - 0x1218: 0x053a, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x05b2, - 0x121e: 0x05b6, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b, - 0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009, - 0x122a: 0x000b, 0x122b: 0x0041, - 0x1230: 0x43a9, 0x1231: 0x452b, 0x1232: 0x43ae, 0x1234: 0x43b3, - 0x1236: 0x43b8, 0x1237: 0x4531, 0x1238: 0x43bd, 0x1239: 0x4537, 0x123a: 0x43c2, 0x123b: 0x453d, - 0x123c: 0x43c7, 0x123d: 0x4543, 0x123e: 0x43cc, 0x123f: 0x4549, - // Block 0x49, offset 0x1240 - 0x1240: 0x0329, 0x1241: 0x450d, 0x1242: 0x450d, 0x1243: 0x4513, 0x1244: 0x4513, 0x1245: 0x4555, - 0x1246: 0x4555, 0x1247: 0x4519, 0x1248: 0x4519, 0x1249: 0x4561, 0x124a: 0x4561, 0x124b: 0x4561, - 0x124c: 0x4561, 0x124d: 0x032c, 0x124e: 0x032c, 0x124f: 0x032f, 0x1250: 0x032f, 0x1251: 0x032f, - 0x1252: 0x032f, 0x1253: 0x0332, 0x1254: 0x0332, 0x1255: 0x0335, 0x1256: 0x0335, 0x1257: 0x0335, - 0x1258: 0x0335, 0x1259: 0x0338, 0x125a: 0x0338, 0x125b: 0x0338, 0x125c: 0x0338, 0x125d: 0x033b, - 0x125e: 0x033b, 0x125f: 0x033b, 0x1260: 0x033b, 0x1261: 0x033e, 0x1262: 0x033e, 0x1263: 0x033e, - 0x1264: 0x033e, 0x1265: 0x0341, 0x1266: 0x0341, 0x1267: 0x0341, 0x1268: 0x0341, 0x1269: 0x0344, - 0x126a: 0x0344, 0x126b: 0x0347, 0x126c: 0x0347, 0x126d: 0x034a, 0x126e: 0x034a, 0x126f: 0x034d, - 0x1270: 0x034d, 0x1271: 0x0350, 0x1272: 0x0350, 0x1273: 0x0350, 0x1274: 0x0350, 0x1275: 0x0353, - 0x1276: 0x0353, 0x1277: 0x0353, 0x1278: 0x0353, 0x1279: 0x0356, 0x127a: 0x0356, 0x127b: 0x0356, - 0x127c: 0x0356, 0x127d: 0x0359, 0x127e: 0x0359, 0x127f: 0x0359, - // Block 0x4a, offset 0x1280 - 0x1280: 0x0359, 0x1281: 0x035c, 0x1282: 0x035c, 0x1283: 0x035c, 0x1284: 0x035c, 0x1285: 0x035f, - 0x1286: 0x035f, 0x1287: 0x035f, 0x1288: 0x035f, 0x1289: 0x0362, 0x128a: 0x0362, 0x128b: 0x0362, - 0x128c: 0x0362, 0x128d: 0x0365, 0x128e: 0x0365, 0x128f: 0x0365, 0x1290: 0x0365, 0x1291: 0x0368, - 0x1292: 0x0368, 0x1293: 0x0368, 0x1294: 0x0368, 0x1295: 0x036b, 0x1296: 0x036b, 0x1297: 0x036b, - 0x1298: 0x036b, 0x1299: 0x036e, 0x129a: 0x036e, 0x129b: 0x036e, 0x129c: 0x036e, 0x129d: 0x0371, - 0x129e: 0x0371, 0x129f: 0x0371, 0x12a0: 0x0371, 0x12a1: 0x0374, 0x12a2: 0x0374, 0x12a3: 0x0374, - 0x12a4: 0x0374, 0x12a5: 0x0377, 0x12a6: 0x0377, 0x12a7: 0x0377, 0x12a8: 0x0377, 0x12a9: 0x037a, - 0x12aa: 0x037a, 0x12ab: 0x037a, 0x12ac: 0x037a, 0x12ad: 0x037d, 0x12ae: 0x037d, 0x12af: 0x0380, - 0x12b0: 0x0380, 0x12b1: 0x0383, 0x12b2: 0x0383, 0x12b3: 0x0383, 0x12b4: 0x0383, 0x12b5: 0x2de7, - 0x12b6: 0x2de7, 0x12b7: 0x2def, 0x12b8: 0x2def, 0x12b9: 0x2df7, 0x12ba: 0x2df7, 0x12bb: 0x20b2, - 0x12bc: 0x20b2, - // Block 0x4b, offset 0x12c0 - 0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b, - 0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097, - 0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3, - 0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af, - 0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb, - 0x12de: 0x00bd, 0x12df: 0x056e, 0x12e0: 0x0572, 0x12e1: 0x0582, 0x12e2: 0x0596, 0x12e3: 0x059a, - 0x12e4: 0x057e, 0x12e5: 0x06a6, 0x12e6: 0x069e, 0x12e7: 0x05c2, 0x12e8: 0x05ca, 0x12e9: 0x05d2, - 0x12ea: 0x05da, 0x12eb: 0x05e2, 0x12ec: 0x0666, 0x12ed: 0x066e, 0x12ee: 0x0676, 0x12ef: 0x061a, - 0x12f0: 0x06aa, 0x12f1: 0x05c6, 0x12f2: 0x05ce, 0x12f3: 0x05d6, 0x12f4: 0x05de, 0x12f5: 0x05e6, - 0x12f6: 0x05ea, 0x12f7: 0x05ee, 0x12f8: 0x05f2, 0x12f9: 0x05f6, 0x12fa: 0x05fa, 0x12fb: 0x05fe, - 0x12fc: 0x0602, 0x12fd: 0x0606, 0x12fe: 0x060a, 0x12ff: 0x060e, - // Block 0x4c, offset 0x1300 - 0x1300: 0x0612, 0x1301: 0x0616, 0x1302: 0x061e, 0x1303: 0x0622, 0x1304: 0x0626, 0x1305: 0x062a, - 0x1306: 0x062e, 0x1307: 0x0632, 0x1308: 0x0636, 0x1309: 0x063a, 0x130a: 0x063e, 0x130b: 0x0642, - 0x130c: 0x0646, 0x130d: 0x064a, 0x130e: 0x064e, 0x130f: 0x0652, 0x1310: 0x0656, 0x1311: 0x065a, - 0x1312: 0x065e, 0x1313: 0x0662, 0x1314: 0x066a, 0x1315: 0x0672, 0x1316: 0x067a, 0x1317: 0x067e, - 0x1318: 0x0682, 0x1319: 0x0686, 0x131a: 0x068a, 0x131b: 0x068e, 0x131c: 0x0692, 0x131d: 0x06a2, - 0x131e: 0x4c99, 0x131f: 0x4c9f, 0x1320: 0x04b6, 0x1321: 0x0406, 0x1322: 0x040a, 0x1323: 0x4bcc, - 0x1324: 0x040e, 0x1325: 0x4bd2, 0x1326: 0x4bd8, 0x1327: 0x0412, 0x1328: 0x0416, 0x1329: 0x041a, - 0x132a: 0x4bde, 0x132b: 0x4be4, 0x132c: 0x4bea, 0x132d: 0x4bf0, 0x132e: 0x4bf6, 0x132f: 0x4bfc, - 0x1330: 0x045a, 0x1331: 0x041e, 0x1332: 0x0422, 0x1333: 0x0426, 0x1334: 0x046e, 0x1335: 0x042a, - 0x1336: 0x042e, 0x1337: 0x0432, 0x1338: 0x0436, 0x1339: 0x043a, 0x133a: 0x043e, 0x133b: 0x0442, - 0x133c: 0x0446, 0x133d: 0x044a, 0x133e: 0x044e, - // Block 0x4d, offset 0x1340 - 0x1342: 0x4b4e, 0x1343: 0x4b54, 0x1344: 0x4b5a, 0x1345: 0x4b60, - 0x1346: 0x4b66, 0x1347: 0x4b6c, 0x134a: 0x4b72, 0x134b: 0x4b78, - 0x134c: 0x4b7e, 0x134d: 0x4b84, 0x134e: 0x4b8a, 0x134f: 0x4b90, - 0x1352: 0x4b96, 0x1353: 0x4b9c, 0x1354: 0x4ba2, 0x1355: 0x4ba8, 0x1356: 0x4bae, 0x1357: 0x4bb4, - 0x135a: 0x4bba, 0x135b: 0x4bc0, 0x135c: 0x4bc6, - 0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x4363, - 0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x053e, 0x1368: 0x0562, 0x1369: 0x0542, - 0x136a: 0x0546, 0x136b: 0x054a, 0x136c: 0x054e, 0x136d: 0x0566, 0x136e: 0x056a, - // Block 0x4e, offset 0x1380 - 0x1381: 0x01f1, 0x1382: 0x01f4, 0x1383: 0x00d4, 0x1384: 0x01be, 0x1385: 0x010d, - 0x1387: 0x01d3, 0x1388: 0x174e, 0x1389: 0x01d9, 0x138a: 0x01d6, 0x138b: 0x0116, - 0x138c: 0x0119, 0x138d: 0x0526, 0x138e: 0x011c, 0x138f: 0x0128, 0x1390: 0x01e5, 0x1391: 0x013a, - 0x1392: 0x0134, 0x1393: 0x012e, 0x1394: 0x01c1, 0x1395: 0x00e0, 0x1396: 0x01c4, 0x1397: 0x0143, - 0x1398: 0x0194, 0x1399: 0x01e8, 0x139a: 0x01eb, 0x139b: 0x0152, 0x139c: 0x1756, 0x139d: 0x1742, - 0x139e: 0x0158, 0x139f: 0x175b, 0x13a0: 0x01a9, 0x13a1: 0x1760, 0x13a2: 0x00da, 0x13a3: 0x0170, - 0x13a4: 0x0173, 0x13a5: 0x00a3, 0x13a6: 0x017c, 0x13a7: 0x1765, 0x13a8: 0x0182, 0x13a9: 0x0185, - 0x13aa: 0x0188, 0x13ab: 0x01e2, 0x13ac: 0x01dc, 0x13ad: 0x1752, 0x13ae: 0x01df, 0x13af: 0x0197, - 0x13b0: 0x0576, 0x13b2: 0x01ac, 0x13b3: 0x01cd, 0x13b4: 0x01d0, 0x13b5: 0x01bb, - 0x13b6: 0x00f5, 0x13b7: 0x00f8, 0x13b8: 0x00fb, 0x13b9: 0x176a, 0x13ba: 0x176f, - // Block 0x4f, offset 0x13c0 - 0x13c0: 0x0063, 0x13c1: 0x0065, 0x13c2: 0x0067, 0x13c3: 0x0069, 0x13c4: 0x006b, 0x13c5: 0x006d, - 0x13c6: 0x006f, 0x13c7: 0x0071, 0x13c8: 0x0073, 0x13c9: 0x0075, 0x13ca: 0x0083, 0x13cb: 0x0085, - 0x13cc: 0x0087, 0x13cd: 0x0089, 0x13ce: 0x008b, 0x13cf: 0x008d, 0x13d0: 0x008f, 0x13d1: 0x0091, - 0x13d2: 0x0093, 0x13d3: 0x0095, 0x13d4: 0x0097, 0x13d5: 0x0099, 0x13d6: 0x009b, 0x13d7: 0x009d, - 0x13d8: 0x009f, 0x13d9: 0x00a1, 0x13da: 0x00a3, 0x13db: 0x00a5, 0x13dc: 0x00a7, 0x13dd: 0x00a9, - 0x13de: 0x00ab, 0x13df: 0x00ad, 0x13e0: 0x00af, 0x13e1: 0x00b1, 0x13e2: 0x00b3, 0x13e3: 0x00b5, - 0x13e4: 0x00e3, 0x13e5: 0x0101, 0x13e8: 0x01f7, 0x13e9: 0x01fa, - 0x13ea: 0x01fd, 0x13eb: 0x0200, 0x13ec: 0x0203, 0x13ed: 0x0206, 0x13ee: 0x0209, 0x13ef: 0x020c, - 0x13f0: 0x020f, 0x13f1: 0x0212, 0x13f2: 0x0215, 0x13f3: 0x0218, 0x13f4: 0x021b, 0x13f5: 0x021e, - 0x13f6: 0x0221, 0x13f7: 0x0224, 0x13f8: 0x0227, 0x13f9: 0x020c, 0x13fa: 0x022a, 0x13fb: 0x022d, - 0x13fc: 0x0230, 0x13fd: 0x0233, 0x13fe: 0x0236, 0x13ff: 0x0239, - // Block 0x50, offset 0x1400 - 0x1400: 0x0281, 0x1401: 0x0284, 0x1402: 0x0287, 0x1403: 0x0552, 0x1404: 0x024b, 0x1405: 0x0254, - 0x1406: 0x025a, 0x1407: 0x027e, 0x1408: 0x026f, 0x1409: 0x026c, 0x140a: 0x028a, 0x140b: 0x028d, - 0x140e: 0x0021, 0x140f: 0x0023, 0x1410: 0x0025, 0x1411: 0x0027, - 0x1412: 0x0029, 0x1413: 0x002b, 0x1414: 0x002d, 0x1415: 0x002f, 0x1416: 0x0031, 0x1417: 0x0033, - 0x1418: 0x0021, 0x1419: 0x0023, 0x141a: 0x0025, 0x141b: 0x0027, 0x141c: 0x0029, 0x141d: 0x002b, - 0x141e: 0x002d, 0x141f: 0x002f, 0x1420: 0x0031, 0x1421: 0x0033, 0x1422: 0x0021, 0x1423: 0x0023, - 0x1424: 0x0025, 0x1425: 0x0027, 0x1426: 0x0029, 0x1427: 0x002b, 0x1428: 0x002d, 0x1429: 0x002f, - 0x142a: 0x0031, 0x142b: 0x0033, 0x142c: 0x0021, 0x142d: 0x0023, 0x142e: 0x0025, 0x142f: 0x0027, - 0x1430: 0x0029, 0x1431: 0x002b, 0x1432: 0x002d, 0x1433: 0x002f, 0x1434: 0x0031, 0x1435: 0x0033, - 0x1436: 0x0021, 0x1437: 0x0023, 0x1438: 0x0025, 0x1439: 0x0027, 0x143a: 0x0029, 0x143b: 0x002b, - 0x143c: 0x002d, 0x143d: 0x002f, 0x143e: 0x0031, 0x143f: 0x0033, - // Block 0x51, offset 0x1440 - 0x1440: 0x8133, 0x1441: 0x8133, 0x1442: 0x8133, 0x1443: 0x8133, 0x1444: 0x8133, 0x1445: 0x8133, - 0x1446: 0x8133, 0x1448: 0x8133, 0x1449: 0x8133, 0x144a: 0x8133, 0x144b: 0x8133, - 0x144c: 0x8133, 0x144d: 0x8133, 0x144e: 0x8133, 0x144f: 0x8133, 0x1450: 0x8133, 0x1451: 0x8133, - 0x1452: 0x8133, 0x1453: 0x8133, 0x1454: 0x8133, 0x1455: 0x8133, 0x1456: 0x8133, 0x1457: 0x8133, - 0x1458: 0x8133, 0x145b: 0x8133, 0x145c: 0x8133, 0x145d: 0x8133, - 0x145e: 0x8133, 0x145f: 0x8133, 0x1460: 0x8133, 0x1461: 0x8133, 0x1463: 0x8133, - 0x1464: 0x8133, 0x1466: 0x8133, 0x1467: 0x8133, 0x1468: 0x8133, 0x1469: 0x8133, - 0x146a: 0x8133, - 0x1470: 0x0290, 0x1471: 0x0293, 0x1472: 0x0296, 0x1473: 0x0299, 0x1474: 0x029c, 0x1475: 0x029f, - 0x1476: 0x02a2, 0x1477: 0x02a5, 0x1478: 0x02a8, 0x1479: 0x02ab, 0x147a: 0x02ae, 0x147b: 0x02b1, - 0x147c: 0x02b7, 0x147d: 0x02ba, 0x147e: 0x02bd, 0x147f: 0x02c0, - // Block 0x52, offset 0x1480 - 0x1480: 0x02c3, 0x1481: 0x02c6, 0x1482: 0x02c9, 0x1483: 0x02cc, 0x1484: 0x02cf, 0x1485: 0x02d2, - 0x1486: 0x02d5, 0x1487: 0x02db, 0x1488: 0x02e1, 0x1489: 0x02e4, 0x148a: 0x1736, 0x148b: 0x0302, - 0x148c: 0x02ea, 0x148d: 0x02ed, 0x148e: 0x0305, 0x148f: 0x02f9, 0x1490: 0x02ff, 0x1491: 0x0290, - 0x1492: 0x0293, 0x1493: 0x0296, 0x1494: 0x0299, 0x1495: 0x029c, 0x1496: 0x029f, 0x1497: 0x02a2, - 0x1498: 0x02a5, 0x1499: 0x02a8, 0x149a: 0x02ab, 0x149b: 0x02ae, 0x149c: 0x02b7, 0x149d: 0x02ba, - 0x149e: 0x02c0, 0x149f: 0x02c6, 0x14a0: 0x02c9, 0x14a1: 0x02cc, 0x14a2: 0x02cf, 0x14a3: 0x02d2, - 0x14a4: 0x02d5, 0x14a5: 0x02d8, 0x14a6: 0x02db, 0x14a7: 0x02f3, 0x14a8: 0x02ea, 0x14a9: 0x02e7, - 0x14aa: 0x02f0, 0x14ab: 0x02f6, 0x14ac: 0x1732, 0x14ad: 0x02fc, - // Block 0x53, offset 0x14c0 - 0x14c0: 0x032c, 0x14c1: 0x032f, 0x14c2: 0x033b, 0x14c3: 0x0344, 0x14c5: 0x037d, - 0x14c6: 0x034d, 0x14c7: 0x033e, 0x14c8: 0x035c, 0x14c9: 0x0383, 0x14ca: 0x036e, 0x14cb: 0x0371, - 0x14cc: 0x0374, 0x14cd: 0x0377, 0x14ce: 0x0350, 0x14cf: 0x0362, 0x14d0: 0x0368, 0x14d1: 0x0356, - 0x14d2: 0x036b, 0x14d3: 0x034a, 0x14d4: 0x0353, 0x14d5: 0x0335, 0x14d6: 0x0338, 0x14d7: 0x0341, - 0x14d8: 0x0347, 0x14d9: 0x0359, 0x14da: 0x035f, 0x14db: 0x0365, 0x14dc: 0x0386, 0x14dd: 0x03d7, - 0x14de: 0x03bf, 0x14df: 0x0389, 0x14e1: 0x032f, 0x14e2: 0x033b, - 0x14e4: 0x037a, 0x14e7: 0x033e, 0x14e9: 0x0383, - 0x14ea: 0x036e, 0x14eb: 0x0371, 0x14ec: 0x0374, 0x14ed: 0x0377, 0x14ee: 0x0350, 0x14ef: 0x0362, - 0x14f0: 0x0368, 0x14f1: 0x0356, 0x14f2: 0x036b, 0x14f4: 0x0353, 0x14f5: 0x0335, - 0x14f6: 0x0338, 0x14f7: 0x0341, 0x14f9: 0x0359, 0x14fb: 0x0365, - // Block 0x54, offset 0x1500 - 0x1502: 0x033b, - 0x1507: 0x033e, 0x1509: 0x0383, 0x150b: 0x0371, - 0x150d: 0x0377, 0x150e: 0x0350, 0x150f: 0x0362, 0x1511: 0x0356, - 0x1512: 0x036b, 0x1514: 0x0353, 0x1517: 0x0341, - 0x1519: 0x0359, 0x151b: 0x0365, 0x151d: 0x03d7, - 0x151f: 0x0389, 0x1521: 0x032f, 0x1522: 0x033b, - 0x1524: 0x037a, 0x1527: 0x033e, 0x1528: 0x035c, 0x1529: 0x0383, - 0x152a: 0x036e, 0x152c: 0x0374, 0x152d: 0x0377, 0x152e: 0x0350, 0x152f: 0x0362, - 0x1530: 0x0368, 0x1531: 0x0356, 0x1532: 0x036b, 0x1534: 0x0353, 0x1535: 0x0335, - 0x1536: 0x0338, 0x1537: 0x0341, 0x1539: 0x0359, 0x153a: 0x035f, 0x153b: 0x0365, - 0x153c: 0x0386, 0x153e: 0x03bf, - // Block 0x55, offset 0x1540 - 0x1540: 0x032c, 0x1541: 0x032f, 0x1542: 0x033b, 0x1543: 0x0344, 0x1544: 0x037a, 0x1545: 0x037d, - 0x1546: 0x034d, 0x1547: 0x033e, 0x1548: 0x035c, 0x1549: 0x0383, 0x154b: 0x0371, - 0x154c: 0x0374, 0x154d: 0x0377, 0x154e: 0x0350, 0x154f: 0x0362, 0x1550: 0x0368, 0x1551: 0x0356, - 0x1552: 0x036b, 0x1553: 0x034a, 0x1554: 0x0353, 0x1555: 0x0335, 0x1556: 0x0338, 0x1557: 0x0341, - 0x1558: 0x0347, 0x1559: 0x0359, 0x155a: 0x035f, 0x155b: 0x0365, - 0x1561: 0x032f, 0x1562: 0x033b, 0x1563: 0x0344, - 0x1565: 0x037d, 0x1566: 0x034d, 0x1567: 0x033e, 0x1568: 0x035c, 0x1569: 0x0383, - 0x156b: 0x0371, 0x156c: 0x0374, 0x156d: 0x0377, 0x156e: 0x0350, 0x156f: 0x0362, - 0x1570: 0x0368, 0x1571: 0x0356, 0x1572: 0x036b, 0x1573: 0x034a, 0x1574: 0x0353, 0x1575: 0x0335, - 0x1576: 0x0338, 0x1577: 0x0341, 0x1578: 0x0347, 0x1579: 0x0359, 0x157a: 0x035f, 0x157b: 0x0365, - // Block 0x56, offset 0x1580 - 0x1580: 0x19a6, 0x1581: 0x19a3, 0x1582: 0x19a9, 0x1583: 0x19cd, 0x1584: 0x19f1, 0x1585: 0x1a15, - 0x1586: 0x1a39, 0x1587: 0x1a42, 0x1588: 0x1a48, 0x1589: 0x1a4e, 0x158a: 0x1a54, - 0x1590: 0x1bbc, 0x1591: 0x1bc0, - 0x1592: 0x1bc4, 0x1593: 0x1bc8, 0x1594: 0x1bcc, 0x1595: 0x1bd0, 0x1596: 0x1bd4, 0x1597: 0x1bd8, - 0x1598: 0x1bdc, 0x1599: 0x1be0, 0x159a: 0x1be4, 0x159b: 0x1be8, 0x159c: 0x1bec, 0x159d: 0x1bf0, - 0x159e: 0x1bf4, 0x159f: 0x1bf8, 0x15a0: 0x1bfc, 0x15a1: 0x1c00, 0x15a2: 0x1c04, 0x15a3: 0x1c08, - 0x15a4: 0x1c0c, 0x15a5: 0x1c10, 0x15a6: 0x1c14, 0x15a7: 0x1c18, 0x15a8: 0x1c1c, 0x15a9: 0x1c20, - 0x15aa: 0x2855, 0x15ab: 0x0047, 0x15ac: 0x0065, 0x15ad: 0x1a69, 0x15ae: 0x1ae1, - 0x15b0: 0x0043, 0x15b1: 0x0045, 0x15b2: 0x0047, 0x15b3: 0x0049, 0x15b4: 0x004b, 0x15b5: 0x004d, - 0x15b6: 0x004f, 0x15b7: 0x0051, 0x15b8: 0x0053, 0x15b9: 0x0055, 0x15ba: 0x0057, 0x15bb: 0x0059, - 0x15bc: 0x005b, 0x15bd: 0x005d, 0x15be: 0x005f, 0x15bf: 0x0061, - // Block 0x57, offset 0x15c0 - 0x15c0: 0x27dd, 0x15c1: 0x27f2, 0x15c2: 0x05fe, - 0x15d0: 0x0d0a, 0x15d1: 0x0b42, - 0x15d2: 0x09ce, 0x15d3: 0x473b, 0x15d4: 0x0816, 0x15d5: 0x0aea, 0x15d6: 0x142a, 0x15d7: 0x0afa, - 0x15d8: 0x0822, 0x15d9: 0x0dd2, 0x15da: 0x0faa, 0x15db: 0x0daa, 0x15dc: 0x0922, 0x15dd: 0x0c66, - 0x15de: 0x08ba, 0x15df: 0x0db2, 0x15e0: 0x090e, 0x15e1: 0x1212, 0x15e2: 0x107e, 0x15e3: 0x1486, - 0x15e4: 0x0ace, 0x15e5: 0x0a06, 0x15e6: 0x0f5e, 0x15e7: 0x0d16, 0x15e8: 0x0d42, 0x15e9: 0x07ba, - 0x15ea: 0x07c6, 0x15eb: 0x1506, 0x15ec: 0x0bd6, 0x15ed: 0x07e2, 0x15ee: 0x09ea, 0x15ef: 0x0d36, - 0x15f0: 0x14ae, 0x15f1: 0x0d0e, 0x15f2: 0x116a, 0x15f3: 0x11a6, 0x15f4: 0x09f2, 0x15f5: 0x0f3e, - 0x15f6: 0x0e06, 0x15f7: 0x0e02, 0x15f8: 0x1092, 0x15f9: 0x0926, 0x15fa: 0x0a52, 0x15fb: 0x153e, - // Block 0x58, offset 0x1600 - 0x1600: 0x07f6, 0x1601: 0x07ee, 0x1602: 0x07fe, 0x1603: 0x1774, 0x1604: 0x0842, 0x1605: 0x0852, - 0x1606: 0x0856, 0x1607: 0x085e, 0x1608: 0x0866, 0x1609: 0x086a, 0x160a: 0x0876, 0x160b: 0x086e, - 0x160c: 0x06ae, 0x160d: 0x1788, 0x160e: 0x088a, 0x160f: 0x088e, 0x1610: 0x0892, 0x1611: 0x08ae, - 0x1612: 0x1779, 0x1613: 0x06b2, 0x1614: 0x089a, 0x1615: 0x08ba, 0x1616: 0x1783, 0x1617: 0x08ca, - 0x1618: 0x08d2, 0x1619: 0x0832, 0x161a: 0x08da, 0x161b: 0x08de, 0x161c: 0x195e, 0x161d: 0x08fa, - 0x161e: 0x0902, 0x161f: 0x06ba, 0x1620: 0x091a, 0x1621: 0x091e, 0x1622: 0x0926, 0x1623: 0x092a, - 0x1624: 0x06be, 0x1625: 0x0942, 0x1626: 0x0946, 0x1627: 0x0952, 0x1628: 0x095e, 0x1629: 0x0962, - 0x162a: 0x0966, 0x162b: 0x096e, 0x162c: 0x098e, 0x162d: 0x0992, 0x162e: 0x099a, 0x162f: 0x09aa, - 0x1630: 0x09b2, 0x1631: 0x09b6, 0x1632: 0x09b6, 0x1633: 0x09b6, 0x1634: 0x1797, 0x1635: 0x0f8e, - 0x1636: 0x09ca, 0x1637: 0x09d2, 0x1638: 0x179c, 0x1639: 0x09de, 0x163a: 0x09e6, 0x163b: 0x09ee, - 0x163c: 0x0a16, 0x163d: 0x0a02, 0x163e: 0x0a0e, 0x163f: 0x0a12, - // Block 0x59, offset 0x1640 - 0x1640: 0x0a1a, 0x1641: 0x0a22, 0x1642: 0x0a26, 0x1643: 0x0a2e, 0x1644: 0x0a36, 0x1645: 0x0a3a, - 0x1646: 0x0a3a, 0x1647: 0x0a42, 0x1648: 0x0a4a, 0x1649: 0x0a4e, 0x164a: 0x0a5a, 0x164b: 0x0a7e, - 0x164c: 0x0a62, 0x164d: 0x0a82, 0x164e: 0x0a66, 0x164f: 0x0a6e, 0x1650: 0x0906, 0x1651: 0x0aca, - 0x1652: 0x0a92, 0x1653: 0x0a96, 0x1654: 0x0a9a, 0x1655: 0x0a8e, 0x1656: 0x0aa2, 0x1657: 0x0a9e, - 0x1658: 0x0ab6, 0x1659: 0x17a1, 0x165a: 0x0ad2, 0x165b: 0x0ad6, 0x165c: 0x0ade, 0x165d: 0x0aea, - 0x165e: 0x0af2, 0x165f: 0x0b0e, 0x1660: 0x17a6, 0x1661: 0x17ab, 0x1662: 0x0b1a, 0x1663: 0x0b1e, - 0x1664: 0x0b22, 0x1665: 0x0b16, 0x1666: 0x0b2a, 0x1667: 0x06c2, 0x1668: 0x06c6, 0x1669: 0x0b32, - 0x166a: 0x0b3a, 0x166b: 0x0b3a, 0x166c: 0x17b0, 0x166d: 0x0b56, 0x166e: 0x0b5a, 0x166f: 0x0b5e, - 0x1670: 0x0b66, 0x1671: 0x17b5, 0x1672: 0x0b6e, 0x1673: 0x0b72, 0x1674: 0x0c4a, 0x1675: 0x0b7a, - 0x1676: 0x06ca, 0x1677: 0x0b86, 0x1678: 0x0b96, 0x1679: 0x0ba2, 0x167a: 0x0b9e, 0x167b: 0x17bf, - 0x167c: 0x0baa, 0x167d: 0x17c4, 0x167e: 0x0bb6, 0x167f: 0x0bb2, - // Block 0x5a, offset 0x1680 - 0x1680: 0x0bba, 0x1681: 0x0bca, 0x1682: 0x0bce, 0x1683: 0x06ce, 0x1684: 0x0bde, 0x1685: 0x0be6, - 0x1686: 0x0bea, 0x1687: 0x0bee, 0x1688: 0x06d2, 0x1689: 0x17c9, 0x168a: 0x06d6, 0x168b: 0x0c0a, - 0x168c: 0x0c0e, 0x168d: 0x0c12, 0x168e: 0x0c1a, 0x168f: 0x1990, 0x1690: 0x0c32, 0x1691: 0x17d3, - 0x1692: 0x17d3, 0x1693: 0x12d2, 0x1694: 0x0c42, 0x1695: 0x0c42, 0x1696: 0x06da, 0x1697: 0x17f6, - 0x1698: 0x18c8, 0x1699: 0x0c52, 0x169a: 0x0c5a, 0x169b: 0x06de, 0x169c: 0x0c6e, 0x169d: 0x0c7e, - 0x169e: 0x0c82, 0x169f: 0x0c8a, 0x16a0: 0x0c9a, 0x16a1: 0x06e6, 0x16a2: 0x06e2, 0x16a3: 0x0c9e, - 0x16a4: 0x17d8, 0x16a5: 0x0ca2, 0x16a6: 0x0cb6, 0x16a7: 0x0cba, 0x16a8: 0x0cbe, 0x16a9: 0x0cba, - 0x16aa: 0x0cca, 0x16ab: 0x0cce, 0x16ac: 0x0cde, 0x16ad: 0x0cd6, 0x16ae: 0x0cda, 0x16af: 0x0ce2, - 0x16b0: 0x0ce6, 0x16b1: 0x0cea, 0x16b2: 0x0cf6, 0x16b3: 0x0cfa, 0x16b4: 0x0d12, 0x16b5: 0x0d1a, - 0x16b6: 0x0d2a, 0x16b7: 0x0d3e, 0x16b8: 0x17e7, 0x16b9: 0x0d3a, 0x16ba: 0x0d2e, 0x16bb: 0x0d46, - 0x16bc: 0x0d4e, 0x16bd: 0x0d62, 0x16be: 0x17ec, 0x16bf: 0x0d6a, - // Block 0x5b, offset 0x16c0 - 0x16c0: 0x0d5e, 0x16c1: 0x0d56, 0x16c2: 0x06ea, 0x16c3: 0x0d72, 0x16c4: 0x0d7a, 0x16c5: 0x0d82, - 0x16c6: 0x0d76, 0x16c7: 0x06ee, 0x16c8: 0x0d92, 0x16c9: 0x0d9a, 0x16ca: 0x17f1, 0x16cb: 0x0dc6, - 0x16cc: 0x0dfa, 0x16cd: 0x0dd6, 0x16ce: 0x06fa, 0x16cf: 0x0de2, 0x16d0: 0x06f6, 0x16d1: 0x06f2, - 0x16d2: 0x08be, 0x16d3: 0x08c2, 0x16d4: 0x0dfe, 0x16d5: 0x0de6, 0x16d6: 0x12a6, 0x16d7: 0x075e, - 0x16d8: 0x0e0a, 0x16d9: 0x0e0e, 0x16da: 0x0e12, 0x16db: 0x0e26, 0x16dc: 0x0e1e, 0x16dd: 0x180a, - 0x16de: 0x06fe, 0x16df: 0x0e3a, 0x16e0: 0x0e2e, 0x16e1: 0x0e4a, 0x16e2: 0x0e52, 0x16e3: 0x1814, - 0x16e4: 0x0e56, 0x16e5: 0x0e42, 0x16e6: 0x0e5e, 0x16e7: 0x0702, 0x16e8: 0x0e62, 0x16e9: 0x0e66, - 0x16ea: 0x0e6a, 0x16eb: 0x0e76, 0x16ec: 0x1819, 0x16ed: 0x0e7e, 0x16ee: 0x0706, 0x16ef: 0x0e8a, - 0x16f0: 0x181e, 0x16f1: 0x0e8e, 0x16f2: 0x070a, 0x16f3: 0x0e9a, 0x16f4: 0x0ea6, 0x16f5: 0x0eb2, - 0x16f6: 0x0eb6, 0x16f7: 0x1823, 0x16f8: 0x17ba, 0x16f9: 0x1828, 0x16fa: 0x0ed6, 0x16fb: 0x182d, - 0x16fc: 0x0ee2, 0x16fd: 0x0eea, 0x16fe: 0x0eda, 0x16ff: 0x0ef6, - // Block 0x5c, offset 0x1700 - 0x1700: 0x0f06, 0x1701: 0x0f16, 0x1702: 0x0f0a, 0x1703: 0x0f0e, 0x1704: 0x0f1a, 0x1705: 0x0f1e, - 0x1706: 0x1832, 0x1707: 0x0f02, 0x1708: 0x0f36, 0x1709: 0x0f3a, 0x170a: 0x070e, 0x170b: 0x0f4e, - 0x170c: 0x0f4a, 0x170d: 0x1837, 0x170e: 0x0f2e, 0x170f: 0x0f6a, 0x1710: 0x183c, 0x1711: 0x1841, - 0x1712: 0x0f6e, 0x1713: 0x0f82, 0x1714: 0x0f7e, 0x1715: 0x0f7a, 0x1716: 0x0712, 0x1717: 0x0f86, - 0x1718: 0x0f96, 0x1719: 0x0f92, 0x171a: 0x0f9e, 0x171b: 0x177e, 0x171c: 0x0fae, 0x171d: 0x1846, - 0x171e: 0x0fba, 0x171f: 0x1850, 0x1720: 0x0fce, 0x1721: 0x0fda, 0x1722: 0x0fee, 0x1723: 0x1855, - 0x1724: 0x1002, 0x1725: 0x1006, 0x1726: 0x185a, 0x1727: 0x185f, 0x1728: 0x1022, 0x1729: 0x1032, - 0x172a: 0x0716, 0x172b: 0x1036, 0x172c: 0x071a, 0x172d: 0x071a, 0x172e: 0x104e, 0x172f: 0x1052, - 0x1730: 0x105a, 0x1731: 0x105e, 0x1732: 0x106a, 0x1733: 0x071e, 0x1734: 0x1082, 0x1735: 0x1864, - 0x1736: 0x109e, 0x1737: 0x1869, 0x1738: 0x10aa, 0x1739: 0x17ce, 0x173a: 0x10ba, 0x173b: 0x186e, - 0x173c: 0x1873, 0x173d: 0x1878, 0x173e: 0x0722, 0x173f: 0x0726, - // Block 0x5d, offset 0x1740 - 0x1740: 0x10f2, 0x1741: 0x1882, 0x1742: 0x187d, 0x1743: 0x1887, 0x1744: 0x188c, 0x1745: 0x10fa, - 0x1746: 0x10fe, 0x1747: 0x10fe, 0x1748: 0x1106, 0x1749: 0x072e, 0x174a: 0x110a, 0x174b: 0x0732, - 0x174c: 0x0736, 0x174d: 0x1896, 0x174e: 0x111e, 0x174f: 0x1126, 0x1750: 0x1132, 0x1751: 0x073a, - 0x1752: 0x189b, 0x1753: 0x1156, 0x1754: 0x18a0, 0x1755: 0x18a5, 0x1756: 0x1176, 0x1757: 0x118e, - 0x1758: 0x073e, 0x1759: 0x1196, 0x175a: 0x119a, 0x175b: 0x119e, 0x175c: 0x18aa, 0x175d: 0x18af, - 0x175e: 0x18af, 0x175f: 0x11b6, 0x1760: 0x0742, 0x1761: 0x18b4, 0x1762: 0x11ca, 0x1763: 0x11ce, - 0x1764: 0x0746, 0x1765: 0x18b9, 0x1766: 0x11ea, 0x1767: 0x074a, 0x1768: 0x11fa, 0x1769: 0x11f2, - 0x176a: 0x1202, 0x176b: 0x18c3, 0x176c: 0x121a, 0x176d: 0x074e, 0x176e: 0x1226, 0x176f: 0x122e, - 0x1770: 0x123e, 0x1771: 0x0752, 0x1772: 0x18cd, 0x1773: 0x18d2, 0x1774: 0x0756, 0x1775: 0x18d7, - 0x1776: 0x1256, 0x1777: 0x18dc, 0x1778: 0x1262, 0x1779: 0x126e, 0x177a: 0x1276, 0x177b: 0x18e1, - 0x177c: 0x18e6, 0x177d: 0x128a, 0x177e: 0x18eb, 0x177f: 0x1292, - // Block 0x5e, offset 0x1780 - 0x1780: 0x17fb, 0x1781: 0x075a, 0x1782: 0x12aa, 0x1783: 0x12ae, 0x1784: 0x0762, 0x1785: 0x12b2, - 0x1786: 0x0b2e, 0x1787: 0x18f0, 0x1788: 0x18f5, 0x1789: 0x1800, 0x178a: 0x1805, 0x178b: 0x12d2, - 0x178c: 0x12d6, 0x178d: 0x14ee, 0x178e: 0x0766, 0x178f: 0x1302, 0x1790: 0x12fe, 0x1791: 0x1306, - 0x1792: 0x093a, 0x1793: 0x130a, 0x1794: 0x130e, 0x1795: 0x1312, 0x1796: 0x131a, 0x1797: 0x18fa, - 0x1798: 0x1316, 0x1799: 0x131e, 0x179a: 0x1332, 0x179b: 0x1336, 0x179c: 0x1322, 0x179d: 0x133a, - 0x179e: 0x134e, 0x179f: 0x1362, 0x17a0: 0x132e, 0x17a1: 0x1342, 0x17a2: 0x1346, 0x17a3: 0x134a, - 0x17a4: 0x18ff, 0x17a5: 0x1909, 0x17a6: 0x1904, 0x17a7: 0x076a, 0x17a8: 0x136a, 0x17a9: 0x136e, - 0x17aa: 0x1376, 0x17ab: 0x191d, 0x17ac: 0x137a, 0x17ad: 0x190e, 0x17ae: 0x076e, 0x17af: 0x0772, - 0x17b0: 0x1913, 0x17b1: 0x1918, 0x17b2: 0x0776, 0x17b3: 0x139a, 0x17b4: 0x139e, 0x17b5: 0x13a2, - 0x17b6: 0x13a6, 0x17b7: 0x13b2, 0x17b8: 0x13ae, 0x17b9: 0x13ba, 0x17ba: 0x13b6, 0x17bb: 0x13c6, - 0x17bc: 0x13be, 0x17bd: 0x13c2, 0x17be: 0x13ca, 0x17bf: 0x077a, - // Block 0x5f, offset 0x17c0 - 0x17c0: 0x13d2, 0x17c1: 0x13d6, 0x17c2: 0x077e, 0x17c3: 0x13e6, 0x17c4: 0x13ea, 0x17c5: 0x1922, - 0x17c6: 0x13f6, 0x17c7: 0x13fa, 0x17c8: 0x0782, 0x17c9: 0x1406, 0x17ca: 0x06b6, 0x17cb: 0x1927, - 0x17cc: 0x192c, 0x17cd: 0x0786, 0x17ce: 0x078a, 0x17cf: 0x1432, 0x17d0: 0x144a, 0x17d1: 0x1466, - 0x17d2: 0x1476, 0x17d3: 0x1931, 0x17d4: 0x148a, 0x17d5: 0x148e, 0x17d6: 0x14a6, 0x17d7: 0x14b2, - 0x17d8: 0x193b, 0x17d9: 0x178d, 0x17da: 0x14be, 0x17db: 0x14ba, 0x17dc: 0x14c6, 0x17dd: 0x1792, - 0x17de: 0x14d2, 0x17df: 0x14de, 0x17e0: 0x1940, 0x17e1: 0x1945, 0x17e2: 0x151e, 0x17e3: 0x152a, - 0x17e4: 0x1532, 0x17e5: 0x194a, 0x17e6: 0x1536, 0x17e7: 0x1562, 0x17e8: 0x156e, 0x17e9: 0x1572, - 0x17ea: 0x156a, 0x17eb: 0x157e, 0x17ec: 0x1582, 0x17ed: 0x194f, 0x17ee: 0x158e, 0x17ef: 0x078e, - 0x17f0: 0x1596, 0x17f1: 0x1954, 0x17f2: 0x0792, 0x17f3: 0x15ce, 0x17f4: 0x0bbe, 0x17f5: 0x15e6, - 0x17f6: 0x1959, 0x17f7: 0x1963, 0x17f8: 0x0796, 0x17f9: 0x079a, 0x17fa: 0x160e, 0x17fb: 0x1968, - 0x17fc: 0x079e, 0x17fd: 0x196d, 0x17fe: 0x1626, 0x17ff: 0x1626, - // Block 0x60, offset 0x1800 - 0x1800: 0x162e, 0x1801: 0x1972, 0x1802: 0x1646, 0x1803: 0x07a2, 0x1804: 0x1656, 0x1805: 0x1662, - 0x1806: 0x166a, 0x1807: 0x1672, 0x1808: 0x07a6, 0x1809: 0x1977, 0x180a: 0x1686, 0x180b: 0x16a2, - 0x180c: 0x16ae, 0x180d: 0x07aa, 0x180e: 0x07ae, 0x180f: 0x16b2, 0x1810: 0x197c, 0x1811: 0x07b2, - 0x1812: 0x1981, 0x1813: 0x1986, 0x1814: 0x198b, 0x1815: 0x16d6, 0x1816: 0x07b6, 0x1817: 0x16ea, - 0x1818: 0x16f2, 0x1819: 0x16f6, 0x181a: 0x16fe, 0x181b: 0x1706, 0x181c: 0x170e, 0x181d: 0x1995, -} - -// nfkcIndex: 23 blocks, 1472 entries, 2944 bytes -// Block 0 is the zero block. -var nfkcIndex = [1472]uint16{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x5f, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x60, 0xc7: 0x04, - 0xc8: 0x05, 0xca: 0x61, 0xcb: 0x62, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09, - 0xd0: 0x0a, 0xd1: 0x63, 0xd2: 0x64, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x65, - 0xd8: 0x66, 0xd9: 0x0d, 0xdb: 0x67, 0xdc: 0x68, 0xdd: 0x69, 0xdf: 0x6a, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, - 0xf0: 0x14, - // Block 0x4, offset 0x100 - 0x120: 0x6b, 0x121: 0x6c, 0x122: 0x6d, 0x123: 0x0e, 0x124: 0x6e, 0x125: 0x6f, 0x126: 0x70, 0x127: 0x71, - 0x128: 0x72, 0x129: 0x73, 0x12a: 0x74, 0x12b: 0x75, 0x12c: 0x70, 0x12d: 0x76, 0x12e: 0x77, 0x12f: 0x78, - 0x130: 0x74, 0x131: 0x79, 0x132: 0x7a, 0x133: 0x7b, 0x134: 0x7c, 0x135: 0x7d, 0x137: 0x7e, - 0x138: 0x7f, 0x139: 0x80, 0x13a: 0x81, 0x13b: 0x82, 0x13c: 0x83, 0x13d: 0x84, 0x13e: 0x85, 0x13f: 0x86, - // Block 0x5, offset 0x140 - 0x140: 0x87, 0x142: 0x88, 0x143: 0x89, 0x144: 0x8a, 0x145: 0x8b, 0x146: 0x8c, 0x147: 0x8d, - 0x14d: 0x8e, - 0x15c: 0x8f, 0x15f: 0x90, - 0x162: 0x91, 0x164: 0x92, - 0x168: 0x93, 0x169: 0x94, 0x16a: 0x95, 0x16b: 0x96, 0x16c: 0x0f, 0x16d: 0x97, 0x16e: 0x98, 0x16f: 0x99, - 0x170: 0x9a, 0x173: 0x9b, 0x174: 0x9c, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12, - 0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a, - // Block 0x6, offset 0x180 - 0x180: 0x9d, 0x181: 0x9e, 0x182: 0x9f, 0x183: 0xa0, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0xa1, 0x187: 0xa2, - 0x188: 0xa3, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0xa4, 0x18c: 0xa5, - 0x191: 0x1f, 0x192: 0x20, 0x193: 0xa6, - 0x1a8: 0xa7, 0x1a9: 0xa8, 0x1ab: 0xa9, - 0x1b1: 0xaa, 0x1b3: 0xab, 0x1b5: 0xac, 0x1b7: 0xad, - 0x1ba: 0xae, 0x1bb: 0xaf, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xb0, - // Block 0x7, offset 0x1c0 - 0x1c0: 0xb1, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xb2, 0x1c5: 0x27, 0x1c6: 0x28, - 0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30, - // Block 0x8, offset 0x200 - 0x219: 0xb3, 0x21a: 0xb4, 0x21b: 0xb5, 0x21d: 0xb6, 0x21f: 0xb7, - 0x220: 0xb8, 0x223: 0xb9, 0x224: 0xba, 0x225: 0xbb, 0x226: 0xbc, 0x227: 0xbd, - 0x22a: 0xbe, 0x22b: 0xbf, 0x22d: 0xc0, 0x22f: 0xc1, - 0x230: 0xc2, 0x231: 0xc3, 0x232: 0xc4, 0x233: 0xc5, 0x234: 0xc6, 0x235: 0xc7, 0x236: 0xc8, 0x237: 0xc2, - 0x238: 0xc3, 0x239: 0xc4, 0x23a: 0xc5, 0x23b: 0xc6, 0x23c: 0xc7, 0x23d: 0xc8, 0x23e: 0xc2, 0x23f: 0xc3, - // Block 0x9, offset 0x240 - 0x240: 0xc4, 0x241: 0xc5, 0x242: 0xc6, 0x243: 0xc7, 0x244: 0xc8, 0x245: 0xc2, 0x246: 0xc3, 0x247: 0xc4, - 0x248: 0xc5, 0x249: 0xc6, 0x24a: 0xc7, 0x24b: 0xc8, 0x24c: 0xc2, 0x24d: 0xc3, 0x24e: 0xc4, 0x24f: 0xc5, - 0x250: 0xc6, 0x251: 0xc7, 0x252: 0xc8, 0x253: 0xc2, 0x254: 0xc3, 0x255: 0xc4, 0x256: 0xc5, 0x257: 0xc6, - 0x258: 0xc7, 0x259: 0xc8, 0x25a: 0xc2, 0x25b: 0xc3, 0x25c: 0xc4, 0x25d: 0xc5, 0x25e: 0xc6, 0x25f: 0xc7, - 0x260: 0xc8, 0x261: 0xc2, 0x262: 0xc3, 0x263: 0xc4, 0x264: 0xc5, 0x265: 0xc6, 0x266: 0xc7, 0x267: 0xc8, - 0x268: 0xc2, 0x269: 0xc3, 0x26a: 0xc4, 0x26b: 0xc5, 0x26c: 0xc6, 0x26d: 0xc7, 0x26e: 0xc8, 0x26f: 0xc2, - 0x270: 0xc3, 0x271: 0xc4, 0x272: 0xc5, 0x273: 0xc6, 0x274: 0xc7, 0x275: 0xc8, 0x276: 0xc2, 0x277: 0xc3, - 0x278: 0xc4, 0x279: 0xc5, 0x27a: 0xc6, 0x27b: 0xc7, 0x27c: 0xc8, 0x27d: 0xc2, 0x27e: 0xc3, 0x27f: 0xc4, - // Block 0xa, offset 0x280 - 0x280: 0xc5, 0x281: 0xc6, 0x282: 0xc7, 0x283: 0xc8, 0x284: 0xc2, 0x285: 0xc3, 0x286: 0xc4, 0x287: 0xc5, - 0x288: 0xc6, 0x289: 0xc7, 0x28a: 0xc8, 0x28b: 0xc2, 0x28c: 0xc3, 0x28d: 0xc4, 0x28e: 0xc5, 0x28f: 0xc6, - 0x290: 0xc7, 0x291: 0xc8, 0x292: 0xc2, 0x293: 0xc3, 0x294: 0xc4, 0x295: 0xc5, 0x296: 0xc6, 0x297: 0xc7, - 0x298: 0xc8, 0x299: 0xc2, 0x29a: 0xc3, 0x29b: 0xc4, 0x29c: 0xc5, 0x29d: 0xc6, 0x29e: 0xc7, 0x29f: 0xc8, - 0x2a0: 0xc2, 0x2a1: 0xc3, 0x2a2: 0xc4, 0x2a3: 0xc5, 0x2a4: 0xc6, 0x2a5: 0xc7, 0x2a6: 0xc8, 0x2a7: 0xc2, - 0x2a8: 0xc3, 0x2a9: 0xc4, 0x2aa: 0xc5, 0x2ab: 0xc6, 0x2ac: 0xc7, 0x2ad: 0xc8, 0x2ae: 0xc2, 0x2af: 0xc3, - 0x2b0: 0xc4, 0x2b1: 0xc5, 0x2b2: 0xc6, 0x2b3: 0xc7, 0x2b4: 0xc8, 0x2b5: 0xc2, 0x2b6: 0xc3, 0x2b7: 0xc4, - 0x2b8: 0xc5, 0x2b9: 0xc6, 0x2ba: 0xc7, 0x2bb: 0xc8, 0x2bc: 0xc2, 0x2bd: 0xc3, 0x2be: 0xc4, 0x2bf: 0xc5, - // Block 0xb, offset 0x2c0 - 0x2c0: 0xc6, 0x2c1: 0xc7, 0x2c2: 0xc8, 0x2c3: 0xc2, 0x2c4: 0xc3, 0x2c5: 0xc4, 0x2c6: 0xc5, 0x2c7: 0xc6, - 0x2c8: 0xc7, 0x2c9: 0xc8, 0x2ca: 0xc2, 0x2cb: 0xc3, 0x2cc: 0xc4, 0x2cd: 0xc5, 0x2ce: 0xc6, 0x2cf: 0xc7, - 0x2d0: 0xc8, 0x2d1: 0xc2, 0x2d2: 0xc3, 0x2d3: 0xc4, 0x2d4: 0xc5, 0x2d5: 0xc6, 0x2d6: 0xc7, 0x2d7: 0xc8, - 0x2d8: 0xc2, 0x2d9: 0xc3, 0x2da: 0xc4, 0x2db: 0xc5, 0x2dc: 0xc6, 0x2dd: 0xc7, 0x2de: 0xc9, - // Block 0xc, offset 0x300 - 0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34, - 0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c, - 0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44, - 0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xca, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b, - // Block 0xd, offset 0x340 - 0x347: 0xcb, - 0x34b: 0xcc, 0x34d: 0xcd, - 0x357: 0xce, - 0x35e: 0x4c, - 0x368: 0xcf, 0x36b: 0xd0, - 0x374: 0xd1, 0x375: 0xd2, - 0x37a: 0xd3, 0x37b: 0xd4, 0x37d: 0xd5, 0x37e: 0xd6, - // Block 0xe, offset 0x380 - 0x381: 0xd7, 0x382: 0xd8, 0x384: 0xd9, 0x385: 0xbc, 0x387: 0xda, - 0x388: 0xdb, 0x38b: 0xdc, 0x38c: 0xdd, 0x38d: 0xde, 0x38e: 0xdf, 0x38f: 0xe0, - 0x391: 0xe1, 0x392: 0xe2, 0x393: 0xe3, 0x396: 0xe4, 0x397: 0xe5, - 0x398: 0xe6, 0x39a: 0xe7, 0x39c: 0xe8, - 0x3a0: 0xe9, 0x3a4: 0xea, 0x3a5: 0xeb, 0x3a7: 0xec, - 0x3a8: 0xed, 0x3a9: 0xee, 0x3aa: 0xef, - 0x3b0: 0xe6, 0x3b5: 0xf0, 0x3b6: 0xf1, - 0x3bd: 0xf2, - // Block 0xf, offset 0x3c0 - 0x3c4: 0xf3, - 0x3eb: 0xf4, 0x3ec: 0xf5, - 0x3f5: 0xf6, - 0x3ff: 0xf7, - // Block 0x10, offset 0x400 - 0x432: 0xf8, - // Block 0x11, offset 0x440 - 0x473: 0xf9, - // Block 0x12, offset 0x480 - 0x485: 0xfa, 0x486: 0xfb, 0x487: 0xfc, - 0x489: 0xfd, - 0x490: 0xfe, 0x491: 0xff, 0x492: 0x100, 0x493: 0x101, 0x494: 0x102, 0x495: 0x103, 0x496: 0x104, 0x497: 0x105, - 0x498: 0x106, 0x499: 0x107, 0x49a: 0x4d, 0x49b: 0x108, 0x49c: 0x109, 0x49d: 0x10a, 0x49e: 0x10b, 0x49f: 0x4e, - // Block 0x13, offset 0x4c0 - 0x4c0: 0x4f, 0x4c1: 0x50, 0x4c2: 0x10c, 0x4c4: 0xf5, - 0x4ca: 0x10d, 0x4cb: 0x10e, - 0x4d3: 0x10f, 0x4d7: 0x110, - 0x4db: 0x111, - 0x4e3: 0x112, 0x4e5: 0x113, - 0x4f8: 0x51, 0x4f9: 0x52, 0x4fa: 0x53, - // Block 0x14, offset 0x500 - 0x504: 0x54, 0x505: 0x114, 0x506: 0x115, - 0x508: 0x55, 0x509: 0x116, - 0x52f: 0x117, - // Block 0x15, offset 0x540 - 0x560: 0x56, 0x561: 0x57, 0x562: 0x58, 0x563: 0x59, 0x564: 0x5a, 0x565: 0x5b, 0x566: 0x5c, 0x567: 0x5d, - 0x568: 0x5e, - // Block 0x16, offset 0x580 - 0x590: 0x0b, 0x591: 0x0c, 0x596: 0x0d, - 0x59b: 0x0e, 0x59c: 0x0f, 0x59d: 0x10, 0x59e: 0x11, 0x59f: 0x12, - 0x5af: 0x13, -} - -// nfkcSparseOffset: 185 entries, 370 bytes -var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1c, 0x26, 0x36, 0x38, 0x3d, 0x48, 0x57, 0x64, 0x6c, 0x71, 0x76, 0x78, 0x7c, 0x84, 0x8b, 0x8e, 0x96, 0x9a, 0x9e, 0xa0, 0xa2, 0xab, 0xaf, 0xb6, 0xbb, 0xbe, 0xc8, 0xcb, 0xd2, 0xda, 0xde, 0xe0, 0xe4, 0xe8, 0xee, 0xff, 0x10b, 0x10d, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11d, 0x11f, 0x121, 0x124, 0x127, 0x129, 0x12c, 0x12f, 0x133, 0x139, 0x145, 0x14e, 0x150, 0x153, 0x155, 0x160, 0x16b, 0x179, 0x187, 0x197, 0x1a5, 0x1ac, 0x1b2, 0x1c1, 0x1c5, 0x1c7, 0x1cb, 0x1cd, 0x1d0, 0x1d2, 0x1d5, 0x1d7, 0x1da, 0x1dc, 0x1de, 0x1e0, 0x1ec, 0x1f6, 0x200, 0x203, 0x207, 0x209, 0x20b, 0x211, 0x214, 0x217, 0x219, 0x21b, 0x21d, 0x21f, 0x225, 0x228, 0x22d, 0x22f, 0x236, 0x23c, 0x242, 0x24a, 0x250, 0x256, 0x25c, 0x260, 0x262, 0x264, 0x266, 0x268, 0x26d, 0x273, 0x276, 0x278, 0x27a, 0x27c, 0x27f, 0x285, 0x289, 0x28d, 0x295, 0x29c, 0x29f, 0x2a2, 0x2a4, 0x2a7, 0x2af, 0x2b9, 0x2c0, 0x2c4, 0x2cb, 0x2ce, 0x2d4, 0x2d6, 0x2d8, 0x2db, 0x2dd, 0x2e0, 0x2e5, 0x2e7, 0x2e9, 0x2eb, 0x2ed, 0x2ef, 0x2f2, 0x2f4, 0x2f6, 0x303, 0x305, 0x307, 0x30d, 0x30f, 0x311, 0x314, 0x321, 0x32b, 0x32d, 0x32f, 0x333, 0x338, 0x344, 0x349, 0x352, 0x358, 0x35d, 0x361, 0x366, 0x36a, 0x37a, 0x388, 0x396, 0x3a4, 0x3a6, 0x3a8, 0x3aa, 0x3ae, 0x3b1, 0x3b6, 0x3b8, 0x3bb, 0x3c6, 0x3c8, 0x3d2} - -// nfkcSparseValues: 980 entries, 3920 bytes -var nfkcSparseValues = [980]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0002, lo: 0x0d}, - {value: 0x0001, lo: 0xa0, hi: 0xa0}, - {value: 0x4377, lo: 0xa8, hi: 0xa8}, - {value: 0x0083, lo: 0xaa, hi: 0xaa}, - {value: 0x4363, lo: 0xaf, hi: 0xaf}, - {value: 0x0025, lo: 0xb2, hi: 0xb3}, - {value: 0x4359, lo: 0xb4, hi: 0xb4}, - {value: 0x0260, lo: 0xb5, hi: 0xb5}, - {value: 0x4390, lo: 0xb8, hi: 0xb8}, - {value: 0x0023, lo: 0xb9, hi: 0xb9}, - {value: 0x009f, lo: 0xba, hi: 0xba}, - {value: 0x234c, lo: 0xbc, hi: 0xbc}, - {value: 0x2340, lo: 0xbd, hi: 0xbd}, - {value: 0x23e2, lo: 0xbe, hi: 0xbe}, - // Block 0x1, offset 0xe - {value: 0x0091, lo: 0x03}, - {value: 0x4859, lo: 0xa0, hi: 0xa1}, - {value: 0x488b, lo: 0xaf, hi: 0xb0}, - {value: 0xa000, lo: 0xb7, hi: 0xb7}, - // Block 0x2, offset 0x12 - {value: 0x0004, lo: 0x09}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x0091, lo: 0xb0, hi: 0xb0}, - {value: 0x0140, lo: 0xb1, hi: 0xb1}, - {value: 0x0095, lo: 0xb2, hi: 0xb2}, - {value: 0x00a5, lo: 0xb3, hi: 0xb3}, - {value: 0x0179, lo: 0xb4, hi: 0xb4}, - {value: 0x017f, lo: 0xb5, hi: 0xb5}, - {value: 0x018b, lo: 0xb6, hi: 0xb6}, - {value: 0x00af, lo: 0xb7, hi: 0xb8}, - // Block 0x3, offset 0x1c - {value: 0x000a, lo: 0x09}, - {value: 0x436d, lo: 0x98, hi: 0x98}, - {value: 0x4372, lo: 0x99, hi: 0x9a}, - {value: 0x4395, lo: 0x9b, hi: 0x9b}, - {value: 0x435e, lo: 0x9c, hi: 0x9c}, - {value: 0x4381, lo: 0x9d, hi: 0x9d}, - {value: 0x0137, lo: 0xa0, hi: 0xa0}, - {value: 0x0099, lo: 0xa1, hi: 0xa1}, - {value: 0x00a7, lo: 0xa2, hi: 0xa3}, - {value: 0x01b8, lo: 0xa4, hi: 0xa4}, - // Block 0x4, offset 0x26 - {value: 0x0000, lo: 0x0f}, - {value: 0xa000, lo: 0x83, hi: 0x83}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0xa000, lo: 0x8b, hi: 0x8b}, - {value: 0xa000, lo: 0x8d, hi: 0x8d}, - {value: 0x3704, lo: 0x90, hi: 0x90}, - {value: 0x3710, lo: 0x91, hi: 0x91}, - {value: 0x36fe, lo: 0x93, hi: 0x93}, - {value: 0xa000, lo: 0x96, hi: 0x96}, - {value: 0x3776, lo: 0x97, hi: 0x97}, - {value: 0x3740, lo: 0x9c, hi: 0x9c}, - {value: 0x3728, lo: 0x9d, hi: 0x9d}, - {value: 0x3752, lo: 0x9e, hi: 0x9e}, - {value: 0xa000, lo: 0xb4, hi: 0xb5}, - {value: 0x377c, lo: 0xb6, hi: 0xb6}, - {value: 0x3782, lo: 0xb7, hi: 0xb7}, - // Block 0x5, offset 0x36 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x83, hi: 0x87}, - // Block 0x6, offset 0x38 - {value: 0x0001, lo: 0x04}, - {value: 0x8114, lo: 0x81, hi: 0x82}, - {value: 0x8133, lo: 0x84, hi: 0x84}, - {value: 0x812e, lo: 0x85, hi: 0x85}, - {value: 0x810e, lo: 0x87, hi: 0x87}, - // Block 0x7, offset 0x3d - {value: 0x0000, lo: 0x0a}, - {value: 0x8133, lo: 0x90, hi: 0x97}, - {value: 0x811a, lo: 0x98, hi: 0x98}, - {value: 0x811b, lo: 0x99, hi: 0x99}, - {value: 0x811c, lo: 0x9a, hi: 0x9a}, - {value: 0x37a0, lo: 0xa2, hi: 0xa2}, - {value: 0x37a6, lo: 0xa3, hi: 0xa3}, - {value: 0x37b2, lo: 0xa4, hi: 0xa4}, - {value: 0x37ac, lo: 0xa5, hi: 0xa5}, - {value: 0x37b8, lo: 0xa6, hi: 0xa6}, - {value: 0xa000, lo: 0xa7, hi: 0xa7}, - // Block 0x8, offset 0x48 - {value: 0x0000, lo: 0x0e}, - {value: 0x37ca, lo: 0x80, hi: 0x80}, - {value: 0xa000, lo: 0x81, hi: 0x81}, - {value: 0x37be, lo: 0x82, hi: 0x82}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x37c4, lo: 0x93, hi: 0x93}, - {value: 0xa000, lo: 0x95, hi: 0x95}, - {value: 0x8133, lo: 0x96, hi: 0x9c}, - {value: 0x8133, lo: 0x9f, hi: 0xa2}, - {value: 0x812e, lo: 0xa3, hi: 0xa3}, - {value: 0x8133, lo: 0xa4, hi: 0xa4}, - {value: 0x8133, lo: 0xa7, hi: 0xa8}, - {value: 0x812e, lo: 0xaa, hi: 0xaa}, - {value: 0x8133, lo: 0xab, hi: 0xac}, - {value: 0x812e, lo: 0xad, hi: 0xad}, - // Block 0x9, offset 0x57 - {value: 0x0000, lo: 0x0c}, - {value: 0x8120, lo: 0x91, hi: 0x91}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - {value: 0x812e, lo: 0xb1, hi: 0xb1}, - {value: 0x8133, lo: 0xb2, hi: 0xb3}, - {value: 0x812e, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb5, hi: 0xb6}, - {value: 0x812e, lo: 0xb7, hi: 0xb9}, - {value: 0x8133, lo: 0xba, hi: 0xba}, - {value: 0x812e, lo: 0xbb, hi: 0xbc}, - {value: 0x8133, lo: 0xbd, hi: 0xbd}, - {value: 0x812e, lo: 0xbe, hi: 0xbe}, - {value: 0x8133, lo: 0xbf, hi: 0xbf}, - // Block 0xa, offset 0x64 - {value: 0x0005, lo: 0x07}, - {value: 0x8133, lo: 0x80, hi: 0x80}, - {value: 0x8133, lo: 0x81, hi: 0x81}, - {value: 0x812e, lo: 0x82, hi: 0x83}, - {value: 0x812e, lo: 0x84, hi: 0x85}, - {value: 0x812e, lo: 0x86, hi: 0x87}, - {value: 0x812e, lo: 0x88, hi: 0x89}, - {value: 0x8133, lo: 0x8a, hi: 0x8a}, - // Block 0xb, offset 0x6c - {value: 0x0000, lo: 0x04}, - {value: 0x8133, lo: 0xab, hi: 0xb1}, - {value: 0x812e, lo: 0xb2, hi: 0xb2}, - {value: 0x8133, lo: 0xb3, hi: 0xb3}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - // Block 0xc, offset 0x71 - {value: 0x0000, lo: 0x04}, - {value: 0x8133, lo: 0x96, hi: 0x99}, - {value: 0x8133, lo: 0x9b, hi: 0xa3}, - {value: 0x8133, lo: 0xa5, hi: 0xa7}, - {value: 0x8133, lo: 0xa9, hi: 0xad}, - // Block 0xd, offset 0x76 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x99, hi: 0x9b}, - // Block 0xe, offset 0x78 - {value: 0x0000, lo: 0x03}, - {value: 0x8133, lo: 0x97, hi: 0x98}, - {value: 0x812e, lo: 0x99, hi: 0x9b}, - {value: 0x8133, lo: 0x9c, hi: 0x9f}, - // Block 0xf, offset 0x7c - {value: 0x0000, lo: 0x07}, - {value: 0xa000, lo: 0xa8, hi: 0xa8}, - {value: 0x3e37, lo: 0xa9, hi: 0xa9}, - {value: 0xa000, lo: 0xb0, hi: 0xb0}, - {value: 0x3e3f, lo: 0xb1, hi: 0xb1}, - {value: 0xa000, lo: 0xb3, hi: 0xb3}, - {value: 0x3e47, lo: 0xb4, hi: 0xb4}, - {value: 0x9903, lo: 0xbc, hi: 0xbc}, - // Block 0x10, offset 0x84 - {value: 0x0008, lo: 0x06}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x8133, lo: 0x91, hi: 0x91}, - {value: 0x812e, lo: 0x92, hi: 0x92}, - {value: 0x8133, lo: 0x93, hi: 0x93}, - {value: 0x8133, lo: 0x94, hi: 0x94}, - {value: 0x461b, lo: 0x98, hi: 0x9f}, - // Block 0x11, offset 0x8b - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x12, offset 0x8e - {value: 0x0008, lo: 0x07}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x3e4f, lo: 0x8b, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x465b, lo: 0x9c, hi: 0x9d}, - {value: 0x466b, lo: 0x9f, hi: 0x9f}, - {value: 0x8133, lo: 0xbe, hi: 0xbe}, - // Block 0x13, offset 0x96 - {value: 0x0000, lo: 0x03}, - {value: 0x4693, lo: 0xb3, hi: 0xb3}, - {value: 0x469b, lo: 0xb6, hi: 0xb6}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - // Block 0x14, offset 0x9a - {value: 0x0008, lo: 0x03}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x4673, lo: 0x99, hi: 0x9b}, - {value: 0x468b, lo: 0x9e, hi: 0x9e}, - // Block 0x15, offset 0x9e - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - // Block 0x16, offset 0xa0 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - // Block 0x17, offset 0xa2 - {value: 0x0000, lo: 0x08}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x3e67, lo: 0x88, hi: 0x88}, - {value: 0x3e5f, lo: 0x8b, hi: 0x8b}, - {value: 0x3e6f, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x96, hi: 0x97}, - {value: 0x46a3, lo: 0x9c, hi: 0x9c}, - {value: 0x46ab, lo: 0x9d, hi: 0x9d}, - // Block 0x18, offset 0xab - {value: 0x0000, lo: 0x03}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0x3e77, lo: 0x94, hi: 0x94}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x19, offset 0xaf - {value: 0x0000, lo: 0x06}, - {value: 0xa000, lo: 0x86, hi: 0x87}, - {value: 0x3e7f, lo: 0x8a, hi: 0x8a}, - {value: 0x3e8f, lo: 0x8b, hi: 0x8b}, - {value: 0x3e87, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - // Block 0x1a, offset 0xb6 - {value: 0x1801, lo: 0x04}, - {value: 0xa000, lo: 0x86, hi: 0x86}, - {value: 0x3e97, lo: 0x88, hi: 0x88}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x8121, lo: 0x95, hi: 0x96}, - // Block 0x1b, offset 0xbb - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbc, hi: 0xbc}, - {value: 0xa000, lo: 0xbf, hi: 0xbf}, - // Block 0x1c, offset 0xbe - {value: 0x0000, lo: 0x09}, - {value: 0x3e9f, lo: 0x80, hi: 0x80}, - {value: 0x9900, lo: 0x82, hi: 0x82}, - {value: 0xa000, lo: 0x86, hi: 0x86}, - {value: 0x3ea7, lo: 0x87, hi: 0x87}, - {value: 0x3eaf, lo: 0x88, hi: 0x88}, - {value: 0x4b25, lo: 0x8a, hi: 0x8a}, - {value: 0x4331, lo: 0x8b, hi: 0x8b}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x95, hi: 0x96}, - // Block 0x1d, offset 0xc8 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xbb, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x1e, offset 0xcb - {value: 0x0000, lo: 0x06}, - {value: 0xa000, lo: 0x86, hi: 0x87}, - {value: 0x3eb7, lo: 0x8a, hi: 0x8a}, - {value: 0x3ec7, lo: 0x8b, hi: 0x8b}, - {value: 0x3ebf, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - // Block 0x1f, offset 0xd2 - {value: 0x5a29, lo: 0x07}, - {value: 0x9905, lo: 0x8a, hi: 0x8a}, - {value: 0x9900, lo: 0x8f, hi: 0x8f}, - {value: 0xa000, lo: 0x99, hi: 0x99}, - {value: 0x3ecf, lo: 0x9a, hi: 0x9a}, - {value: 0x4b2d, lo: 0x9c, hi: 0x9c}, - {value: 0x433c, lo: 0x9d, hi: 0x9d}, - {value: 0x3ed7, lo: 0x9e, hi: 0x9f}, - // Block 0x20, offset 0xda - {value: 0x0000, lo: 0x03}, - {value: 0x2751, lo: 0xb3, hi: 0xb3}, - {value: 0x8123, lo: 0xb8, hi: 0xb9}, - {value: 0x8105, lo: 0xba, hi: 0xba}, - // Block 0x21, offset 0xde - {value: 0x0000, lo: 0x01}, - {value: 0x8124, lo: 0x88, hi: 0x8b}, - // Block 0x22, offset 0xe0 - {value: 0x0000, lo: 0x03}, - {value: 0x2766, lo: 0xb3, hi: 0xb3}, - {value: 0x8125, lo: 0xb8, hi: 0xb9}, - {value: 0x8105, lo: 0xba, hi: 0xba}, - // Block 0x23, offset 0xe4 - {value: 0x0000, lo: 0x03}, - {value: 0x8126, lo: 0x88, hi: 0x8b}, - {value: 0x2758, lo: 0x9c, hi: 0x9c}, - {value: 0x275f, lo: 0x9d, hi: 0x9d}, - // Block 0x24, offset 0xe8 - {value: 0x0000, lo: 0x05}, - {value: 0x03fe, lo: 0x8c, hi: 0x8c}, - {value: 0x812e, lo: 0x98, hi: 0x99}, - {value: 0x812e, lo: 0xb5, hi: 0xb5}, - {value: 0x812e, lo: 0xb7, hi: 0xb7}, - {value: 0x812c, lo: 0xb9, hi: 0xb9}, - // Block 0x25, offset 0xee - {value: 0x0000, lo: 0x10}, - {value: 0x2774, lo: 0x83, hi: 0x83}, - {value: 0x277b, lo: 0x8d, hi: 0x8d}, - {value: 0x2782, lo: 0x92, hi: 0x92}, - {value: 0x2789, lo: 0x97, hi: 0x97}, - {value: 0x2790, lo: 0x9c, hi: 0x9c}, - {value: 0x276d, lo: 0xa9, hi: 0xa9}, - {value: 0x8127, lo: 0xb1, hi: 0xb1}, - {value: 0x8128, lo: 0xb2, hi: 0xb2}, - {value: 0x4ca5, lo: 0xb3, hi: 0xb3}, - {value: 0x8129, lo: 0xb4, hi: 0xb4}, - {value: 0x4cae, lo: 0xb5, hi: 0xb5}, - {value: 0x46b3, lo: 0xb6, hi: 0xb6}, - {value: 0x476b, lo: 0xb7, hi: 0xb7}, - {value: 0x46bb, lo: 0xb8, hi: 0xb8}, - {value: 0x4776, lo: 0xb9, hi: 0xb9}, - {value: 0x8128, lo: 0xba, hi: 0xbd}, - // Block 0x26, offset 0xff - {value: 0x0000, lo: 0x0b}, - {value: 0x8128, lo: 0x80, hi: 0x80}, - {value: 0x4cb7, lo: 0x81, hi: 0x81}, - {value: 0x8133, lo: 0x82, hi: 0x83}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0x86, hi: 0x87}, - {value: 0x279e, lo: 0x93, hi: 0x93}, - {value: 0x27a5, lo: 0x9d, hi: 0x9d}, - {value: 0x27ac, lo: 0xa2, hi: 0xa2}, - {value: 0x27b3, lo: 0xa7, hi: 0xa7}, - {value: 0x27ba, lo: 0xac, hi: 0xac}, - {value: 0x2797, lo: 0xb9, hi: 0xb9}, - // Block 0x27, offset 0x10b - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x86, hi: 0x86}, - // Block 0x28, offset 0x10d - {value: 0x0000, lo: 0x05}, - {value: 0xa000, lo: 0xa5, hi: 0xa5}, - {value: 0x3edf, lo: 0xa6, hi: 0xa6}, - {value: 0x9900, lo: 0xae, hi: 0xae}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - {value: 0x8105, lo: 0xb9, hi: 0xba}, - // Block 0x29, offset 0x113 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x8d, hi: 0x8d}, - // Block 0x2a, offset 0x115 - {value: 0x0000, lo: 0x01}, - {value: 0x0402, lo: 0xbc, hi: 0xbc}, - // Block 0x2b, offset 0x117 - {value: 0x0000, lo: 0x01}, - {value: 0xa000, lo: 0x80, hi: 0x92}, - // Block 0x2c, offset 0x119 - {value: 0x0000, lo: 0x01}, - {value: 0xb900, lo: 0xa1, hi: 0xb5}, - // Block 0x2d, offset 0x11b - {value: 0x0000, lo: 0x01}, - {value: 0x9900, lo: 0xa8, hi: 0xbf}, - // Block 0x2e, offset 0x11d - {value: 0x0000, lo: 0x01}, - {value: 0x9900, lo: 0x80, hi: 0x82}, - // Block 0x2f, offset 0x11f - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x9d, hi: 0x9f}, - // Block 0x30, offset 0x121 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x94, hi: 0x95}, - {value: 0x8105, lo: 0xb4, hi: 0xb4}, - // Block 0x31, offset 0x124 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x92, hi: 0x92}, - {value: 0x8133, lo: 0x9d, hi: 0x9d}, - // Block 0x32, offset 0x127 - {value: 0x0000, lo: 0x01}, - {value: 0x8132, lo: 0xa9, hi: 0xa9}, - // Block 0x33, offset 0x129 - {value: 0x0004, lo: 0x02}, - {value: 0x812f, lo: 0xb9, hi: 0xba}, - {value: 0x812e, lo: 0xbb, hi: 0xbb}, - // Block 0x34, offset 0x12c - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x97, hi: 0x97}, - {value: 0x812e, lo: 0x98, hi: 0x98}, - // Block 0x35, offset 0x12f - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0xa0, hi: 0xa0}, - {value: 0x8133, lo: 0xb5, hi: 0xbc}, - {value: 0x812e, lo: 0xbf, hi: 0xbf}, - // Block 0x36, offset 0x133 - {value: 0x0000, lo: 0x05}, - {value: 0x8133, lo: 0xb0, hi: 0xb4}, - {value: 0x812e, lo: 0xb5, hi: 0xba}, - {value: 0x8133, lo: 0xbb, hi: 0xbc}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - {value: 0x812e, lo: 0xbf, hi: 0xbf}, - // Block 0x37, offset 0x139 - {value: 0x0000, lo: 0x0b}, - {value: 0x812e, lo: 0x80, hi: 0x80}, - {value: 0x8133, lo: 0x81, hi: 0x82}, - {value: 0x812e, lo: 0x83, hi: 0x84}, - {value: 0x8133, lo: 0x85, hi: 0x89}, - {value: 0x812e, lo: 0x8a, hi: 0x8a}, - {value: 0x8133, lo: 0x8b, hi: 0x9c}, - {value: 0x812e, lo: 0x9d, hi: 0x9d}, - {value: 0x8133, lo: 0xa0, hi: 0xa5}, - {value: 0x812e, lo: 0xa6, hi: 0xa6}, - {value: 0x8133, lo: 0xa7, hi: 0xaa}, - {value: 0x8136, lo: 0xab, hi: 0xab}, - // Block 0x38, offset 0x145 - {value: 0x0000, lo: 0x08}, - {value: 0x3f27, lo: 0x80, hi: 0x80}, - {value: 0x3f2f, lo: 0x81, hi: 0x81}, - {value: 0xa000, lo: 0x82, hi: 0x82}, - {value: 0x3f37, lo: 0x83, hi: 0x83}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0xab, hi: 0xab}, - {value: 0x812e, lo: 0xac, hi: 0xac}, - {value: 0x8133, lo: 0xad, hi: 0xb3}, - // Block 0x39, offset 0x14e - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xaa, hi: 0xab}, - // Block 0x3a, offset 0x150 - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xa6, hi: 0xa6}, - {value: 0x8105, lo: 0xb2, hi: 0xb3}, - // Block 0x3b, offset 0x153 - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - // Block 0x3c, offset 0x155 - {value: 0x0000, lo: 0x0a}, - {value: 0x8133, lo: 0x90, hi: 0x92}, - {value: 0x8101, lo: 0x94, hi: 0x94}, - {value: 0x812e, lo: 0x95, hi: 0x99}, - {value: 0x8133, lo: 0x9a, hi: 0x9b}, - {value: 0x812e, lo: 0x9c, hi: 0x9f}, - {value: 0x8133, lo: 0xa0, hi: 0xa0}, - {value: 0x8101, lo: 0xa2, hi: 0xa8}, - {value: 0x812e, lo: 0xad, hi: 0xad}, - {value: 0x8133, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb8, hi: 0xb9}, - // Block 0x3d, offset 0x160 - {value: 0x0002, lo: 0x0a}, - {value: 0x0043, lo: 0xac, hi: 0xac}, - {value: 0x00d1, lo: 0xad, hi: 0xad}, - {value: 0x0045, lo: 0xae, hi: 0xae}, - {value: 0x0049, lo: 0xb0, hi: 0xb1}, - {value: 0x00ec, lo: 0xb2, hi: 0xb2}, - {value: 0x004f, lo: 0xb3, hi: 0xba}, - {value: 0x005f, lo: 0xbc, hi: 0xbc}, - {value: 0x00fe, lo: 0xbd, hi: 0xbd}, - {value: 0x0061, lo: 0xbe, hi: 0xbe}, - {value: 0x0065, lo: 0xbf, hi: 0xbf}, - // Block 0x3e, offset 0x16b - {value: 0x0000, lo: 0x0d}, - {value: 0x0001, lo: 0x80, hi: 0x8a}, - {value: 0x0532, lo: 0x91, hi: 0x91}, - {value: 0x439a, lo: 0x97, hi: 0x97}, - {value: 0x001d, lo: 0xa4, hi: 0xa4}, - {value: 0x19a0, lo: 0xa5, hi: 0xa5}, - {value: 0x1c8c, lo: 0xa6, hi: 0xa6}, - {value: 0x0001, lo: 0xaf, hi: 0xaf}, - {value: 0x27c1, lo: 0xb3, hi: 0xb3}, - {value: 0x2935, lo: 0xb4, hi: 0xb4}, - {value: 0x27c8, lo: 0xb6, hi: 0xb6}, - {value: 0x293f, lo: 0xb7, hi: 0xb7}, - {value: 0x199a, lo: 0xbc, hi: 0xbc}, - {value: 0x4368, lo: 0xbe, hi: 0xbe}, - // Block 0x3f, offset 0x179 - {value: 0x0002, lo: 0x0d}, - {value: 0x1a60, lo: 0x87, hi: 0x87}, - {value: 0x1a5d, lo: 0x88, hi: 0x88}, - {value: 0x199d, lo: 0x89, hi: 0x89}, - {value: 0x2ac5, lo: 0x97, hi: 0x97}, - {value: 0x0001, lo: 0x9f, hi: 0x9f}, - {value: 0x0021, lo: 0xb0, hi: 0xb0}, - {value: 0x0093, lo: 0xb1, hi: 0xb1}, - {value: 0x0029, lo: 0xb4, hi: 0xb9}, - {value: 0x0017, lo: 0xba, hi: 0xba}, - {value: 0x055e, lo: 0xbb, hi: 0xbb}, - {value: 0x003b, lo: 0xbc, hi: 0xbc}, - {value: 0x0011, lo: 0xbd, hi: 0xbe}, - {value: 0x009d, lo: 0xbf, hi: 0xbf}, - // Block 0x40, offset 0x187 - {value: 0x0002, lo: 0x0f}, - {value: 0x0021, lo: 0x80, hi: 0x89}, - {value: 0x0017, lo: 0x8a, hi: 0x8a}, - {value: 0x055e, lo: 0x8b, hi: 0x8b}, - {value: 0x003b, lo: 0x8c, hi: 0x8c}, - {value: 0x0011, lo: 0x8d, hi: 0x8e}, - {value: 0x0083, lo: 0x90, hi: 0x90}, - {value: 0x008b, lo: 0x91, hi: 0x91}, - {value: 0x009f, lo: 0x92, hi: 0x92}, - {value: 0x00b1, lo: 0x93, hi: 0x93}, - {value: 0x011f, lo: 0x94, hi: 0x94}, - {value: 0x0091, lo: 0x95, hi: 0x95}, - {value: 0x0097, lo: 0x96, hi: 0x99}, - {value: 0x00a1, lo: 0x9a, hi: 0x9a}, - {value: 0x00a7, lo: 0x9b, hi: 0x9c}, - {value: 0x1ac9, lo: 0xa8, hi: 0xa8}, - // Block 0x41, offset 0x197 - {value: 0x0000, lo: 0x0d}, - {value: 0x8133, lo: 0x90, hi: 0x91}, - {value: 0x8101, lo: 0x92, hi: 0x93}, - {value: 0x8133, lo: 0x94, hi: 0x97}, - {value: 0x8101, lo: 0x98, hi: 0x9a}, - {value: 0x8133, lo: 0x9b, hi: 0x9c}, - {value: 0x8133, lo: 0xa1, hi: 0xa1}, - {value: 0x8101, lo: 0xa5, hi: 0xa6}, - {value: 0x8133, lo: 0xa7, hi: 0xa7}, - {value: 0x812e, lo: 0xa8, hi: 0xa8}, - {value: 0x8133, lo: 0xa9, hi: 0xa9}, - {value: 0x8101, lo: 0xaa, hi: 0xab}, - {value: 0x812e, lo: 0xac, hi: 0xaf}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - // Block 0x42, offset 0x1a5 - {value: 0x0007, lo: 0x06}, - {value: 0x22b0, lo: 0x89, hi: 0x89}, - {value: 0xa000, lo: 0x90, hi: 0x90}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0xa000, lo: 0x94, hi: 0x94}, - {value: 0x3b18, lo: 0x9a, hi: 0x9b}, - {value: 0x3b26, lo: 0xae, hi: 0xae}, - // Block 0x43, offset 0x1ac - {value: 0x000e, lo: 0x05}, - {value: 0x3b2d, lo: 0x8d, hi: 0x8e}, - {value: 0x3b34, lo: 0x8f, hi: 0x8f}, - {value: 0xa000, lo: 0x90, hi: 0x90}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0xa000, lo: 0x94, hi: 0x94}, - // Block 0x44, offset 0x1b2 - {value: 0x017a, lo: 0x0e}, - {value: 0xa000, lo: 0x83, hi: 0x83}, - {value: 0x3b42, lo: 0x84, hi: 0x84}, - {value: 0xa000, lo: 0x88, hi: 0x88}, - {value: 0x3b49, lo: 0x89, hi: 0x89}, - {value: 0xa000, lo: 0x8b, hi: 0x8b}, - {value: 0x3b50, lo: 0x8c, hi: 0x8c}, - {value: 0xa000, lo: 0xa3, hi: 0xa3}, - {value: 0x3b57, lo: 0xa4, hi: 0xa4}, - {value: 0xa000, lo: 0xa5, hi: 0xa5}, - {value: 0x3b5e, lo: 0xa6, hi: 0xa6}, - {value: 0x27cf, lo: 0xac, hi: 0xad}, - {value: 0x27d6, lo: 0xaf, hi: 0xaf}, - {value: 0x2953, lo: 0xb0, hi: 0xb0}, - {value: 0xa000, lo: 0xbc, hi: 0xbc}, - // Block 0x45, offset 0x1c1 - {value: 0x0007, lo: 0x03}, - {value: 0x3bc7, lo: 0xa0, hi: 0xa1}, - {value: 0x3bf1, lo: 0xa2, hi: 0xa3}, - {value: 0x3c1b, lo: 0xaa, hi: 0xad}, - // Block 0x46, offset 0x1c5 - {value: 0x0004, lo: 0x01}, - {value: 0x0586, lo: 0xa9, hi: 0xaa}, - // Block 0x47, offset 0x1c7 - {value: 0x0002, lo: 0x03}, - {value: 0x0057, lo: 0x80, hi: 0x8f}, - {value: 0x0083, lo: 0x90, hi: 0xa9}, - {value: 0x0021, lo: 0xaa, hi: 0xaa}, - // Block 0x48, offset 0x1cb - {value: 0x0000, lo: 0x01}, - {value: 0x2ad2, lo: 0x8c, hi: 0x8c}, - // Block 0x49, offset 0x1cd - {value: 0x0266, lo: 0x02}, - {value: 0x1cbc, lo: 0xb4, hi: 0xb4}, - {value: 0x1a5a, lo: 0xb5, hi: 0xb6}, - // Block 0x4a, offset 0x1d0 - {value: 0x0000, lo: 0x01}, - {value: 0x45dc, lo: 0x9c, hi: 0x9c}, - // Block 0x4b, offset 0x1d2 - {value: 0x0000, lo: 0x02}, - {value: 0x0095, lo: 0xbc, hi: 0xbc}, - {value: 0x006d, lo: 0xbd, hi: 0xbd}, - // Block 0x4c, offset 0x1d5 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xaf, hi: 0xb1}, - // Block 0x4d, offset 0x1d7 - {value: 0x0000, lo: 0x02}, - {value: 0x057a, lo: 0xaf, hi: 0xaf}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x4e, offset 0x1da - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xa0, hi: 0xbf}, - // Block 0x4f, offset 0x1dc - {value: 0x0000, lo: 0x01}, - {value: 0x0ebe, lo: 0x9f, hi: 0x9f}, - // Block 0x50, offset 0x1de - {value: 0x0000, lo: 0x01}, - {value: 0x172a, lo: 0xb3, hi: 0xb3}, - // Block 0x51, offset 0x1e0 - {value: 0x0004, lo: 0x0b}, - {value: 0x1692, lo: 0x80, hi: 0x82}, - {value: 0x16aa, lo: 0x83, hi: 0x83}, - {value: 0x16c2, lo: 0x84, hi: 0x85}, - {value: 0x16d2, lo: 0x86, hi: 0x89}, - {value: 0x16e6, lo: 0x8a, hi: 0x8c}, - {value: 0x16fa, lo: 0x8d, hi: 0x8d}, - {value: 0x1702, lo: 0x8e, hi: 0x8e}, - {value: 0x170a, lo: 0x8f, hi: 0x90}, - {value: 0x1716, lo: 0x91, hi: 0x93}, - {value: 0x1726, lo: 0x94, hi: 0x94}, - {value: 0x172e, lo: 0x95, hi: 0x95}, - // Block 0x52, offset 0x1ec - {value: 0x0004, lo: 0x09}, - {value: 0x0001, lo: 0x80, hi: 0x80}, - {value: 0x812d, lo: 0xaa, hi: 0xaa}, - {value: 0x8132, lo: 0xab, hi: 0xab}, - {value: 0x8134, lo: 0xac, hi: 0xac}, - {value: 0x812f, lo: 0xad, hi: 0xad}, - {value: 0x8130, lo: 0xae, hi: 0xae}, - {value: 0x8130, lo: 0xaf, hi: 0xaf}, - {value: 0x05ae, lo: 0xb6, hi: 0xb6}, - {value: 0x0982, lo: 0xb8, hi: 0xba}, - // Block 0x53, offset 0x1f6 - {value: 0x0006, lo: 0x09}, - {value: 0x0406, lo: 0xb1, hi: 0xb1}, - {value: 0x040a, lo: 0xb2, hi: 0xb2}, - {value: 0x4bcc, lo: 0xb3, hi: 0xb3}, - {value: 0x040e, lo: 0xb4, hi: 0xb4}, - {value: 0x4bd2, lo: 0xb5, hi: 0xb6}, - {value: 0x0412, lo: 0xb7, hi: 0xb7}, - {value: 0x0416, lo: 0xb8, hi: 0xb8}, - {value: 0x041a, lo: 0xb9, hi: 0xb9}, - {value: 0x4bde, lo: 0xba, hi: 0xbf}, - // Block 0x54, offset 0x200 - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0xaf, hi: 0xaf}, - {value: 0x8133, lo: 0xb4, hi: 0xbd}, - // Block 0x55, offset 0x203 - {value: 0x0000, lo: 0x03}, - {value: 0x02d8, lo: 0x9c, hi: 0x9c}, - {value: 0x02de, lo: 0x9d, hi: 0x9d}, - {value: 0x8133, lo: 0x9e, hi: 0x9f}, - // Block 0x56, offset 0x207 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb0, hi: 0xb1}, - // Block 0x57, offset 0x209 - {value: 0x0000, lo: 0x01}, - {value: 0x173e, lo: 0xb0, hi: 0xb0}, - // Block 0x58, offset 0x20b - {value: 0x0006, lo: 0x05}, - {value: 0x0067, lo: 0xb1, hi: 0xb1}, - {value: 0x0047, lo: 0xb2, hi: 0xb3}, - {value: 0x0063, lo: 0xb4, hi: 0xb4}, - {value: 0x00dd, lo: 0xb8, hi: 0xb8}, - {value: 0x00e9, lo: 0xb9, hi: 0xb9}, - // Block 0x59, offset 0x211 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x86, hi: 0x86}, - {value: 0x8105, lo: 0xac, hi: 0xac}, - // Block 0x5a, offset 0x214 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x84, hi: 0x84}, - {value: 0x8133, lo: 0xa0, hi: 0xb1}, - // Block 0x5b, offset 0x217 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xab, hi: 0xad}, - // Block 0x5c, offset 0x219 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x93, hi: 0x93}, - // Block 0x5d, offset 0x21b - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0xb3, hi: 0xb3}, - // Block 0x5e, offset 0x21d - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x80, hi: 0x80}, - // Block 0x5f, offset 0x21f - {value: 0x0000, lo: 0x05}, - {value: 0x8133, lo: 0xb0, hi: 0xb0}, - {value: 0x8133, lo: 0xb2, hi: 0xb3}, - {value: 0x812e, lo: 0xb4, hi: 0xb4}, - {value: 0x8133, lo: 0xb7, hi: 0xb8}, - {value: 0x8133, lo: 0xbe, hi: 0xbf}, - // Block 0x60, offset 0x225 - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x81, hi: 0x81}, - {value: 0x8105, lo: 0xb6, hi: 0xb6}, - // Block 0x61, offset 0x228 - {value: 0x000c, lo: 0x04}, - {value: 0x173a, lo: 0x9c, hi: 0x9d}, - {value: 0x014f, lo: 0x9e, hi: 0x9e}, - {value: 0x174a, lo: 0x9f, hi: 0x9f}, - {value: 0x01a6, lo: 0xa9, hi: 0xa9}, - // Block 0x62, offset 0x22d - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xad, hi: 0xad}, - // Block 0x63, offset 0x22f - {value: 0x0000, lo: 0x06}, - {value: 0xe500, lo: 0x80, hi: 0x80}, - {value: 0xc600, lo: 0x81, hi: 0x9b}, - {value: 0xe500, lo: 0x9c, hi: 0x9c}, - {value: 0xc600, lo: 0x9d, hi: 0xb7}, - {value: 0xe500, lo: 0xb8, hi: 0xb8}, - {value: 0xc600, lo: 0xb9, hi: 0xbf}, - // Block 0x64, offset 0x236 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x93}, - {value: 0xe500, lo: 0x94, hi: 0x94}, - {value: 0xc600, lo: 0x95, hi: 0xaf}, - {value: 0xe500, lo: 0xb0, hi: 0xb0}, - {value: 0xc600, lo: 0xb1, hi: 0xbf}, - // Block 0x65, offset 0x23c - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x8b}, - {value: 0xe500, lo: 0x8c, hi: 0x8c}, - {value: 0xc600, lo: 0x8d, hi: 0xa7}, - {value: 0xe500, lo: 0xa8, hi: 0xa8}, - {value: 0xc600, lo: 0xa9, hi: 0xbf}, - // Block 0x66, offset 0x242 - {value: 0x0000, lo: 0x07}, - {value: 0xc600, lo: 0x80, hi: 0x83}, - {value: 0xe500, lo: 0x84, hi: 0x84}, - {value: 0xc600, lo: 0x85, hi: 0x9f}, - {value: 0xe500, lo: 0xa0, hi: 0xa0}, - {value: 0xc600, lo: 0xa1, hi: 0xbb}, - {value: 0xe500, lo: 0xbc, hi: 0xbc}, - {value: 0xc600, lo: 0xbd, hi: 0xbf}, - // Block 0x67, offset 0x24a - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x97}, - {value: 0xe500, lo: 0x98, hi: 0x98}, - {value: 0xc600, lo: 0x99, hi: 0xb3}, - {value: 0xe500, lo: 0xb4, hi: 0xb4}, - {value: 0xc600, lo: 0xb5, hi: 0xbf}, - // Block 0x68, offset 0x250 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x8f}, - {value: 0xe500, lo: 0x90, hi: 0x90}, - {value: 0xc600, lo: 0x91, hi: 0xab}, - {value: 0xe500, lo: 0xac, hi: 0xac}, - {value: 0xc600, lo: 0xad, hi: 0xbf}, - // Block 0x69, offset 0x256 - {value: 0x0000, lo: 0x05}, - {value: 0xc600, lo: 0x80, hi: 0x87}, - {value: 0xe500, lo: 0x88, hi: 0x88}, - {value: 0xc600, lo: 0x89, hi: 0xa3}, - {value: 0xe500, lo: 0xa4, hi: 0xa4}, - {value: 0xc600, lo: 0xa5, hi: 0xbf}, - // Block 0x6a, offset 0x25c - {value: 0x0000, lo: 0x03}, - {value: 0xc600, lo: 0x80, hi: 0x87}, - {value: 0xe500, lo: 0x88, hi: 0x88}, - {value: 0xc600, lo: 0x89, hi: 0xa3}, - // Block 0x6b, offset 0x260 - {value: 0x0002, lo: 0x01}, - {value: 0x0003, lo: 0x81, hi: 0xbf}, - // Block 0x6c, offset 0x262 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xbd, hi: 0xbd}, - // Block 0x6d, offset 0x264 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0xa0, hi: 0xa0}, - // Block 0x6e, offset 0x266 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb6, hi: 0xba}, - // Block 0x6f, offset 0x268 - {value: 0x0000, lo: 0x04}, - {value: 0x410f, lo: 0x89, hi: 0x89}, - {value: 0xa000, lo: 0x92, hi: 0x92}, - {value: 0xa000, lo: 0x9a, hi: 0x9a}, - {value: 0x4117, lo: 0xa4, hi: 0xa4}, - // Block 0x70, offset 0x26d - {value: 0x002d, lo: 0x05}, - {value: 0x812e, lo: 0x8d, hi: 0x8d}, - {value: 0x8133, lo: 0x8f, hi: 0x8f}, - {value: 0x8133, lo: 0xb8, hi: 0xb8}, - {value: 0x8101, lo: 0xb9, hi: 0xba}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x71, offset 0x273 - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0xa5, hi: 0xa5}, - {value: 0x812e, lo: 0xa6, hi: 0xa6}, - // Block 0x72, offset 0x276 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xa4, hi: 0xa7}, - // Block 0x73, offset 0x278 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xa9, hi: 0xad}, - // Block 0x74, offset 0x27a - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xab, hi: 0xac}, - // Block 0x75, offset 0x27c - {value: 0x0000, lo: 0x02}, - {value: 0x812e, lo: 0xba, hi: 0xbb}, - {value: 0x812e, lo: 0xbd, hi: 0xbf}, - // Block 0x76, offset 0x27f - {value: 0x0000, lo: 0x05}, - {value: 0x812e, lo: 0x86, hi: 0x87}, - {value: 0x8133, lo: 0x88, hi: 0x8a}, - {value: 0x812e, lo: 0x8b, hi: 0x8b}, - {value: 0x8133, lo: 0x8c, hi: 0x8c}, - {value: 0x812e, lo: 0x8d, hi: 0x90}, - // Block 0x77, offset 0x285 - {value: 0x0005, lo: 0x03}, - {value: 0x8133, lo: 0x82, hi: 0x82}, - {value: 0x812e, lo: 0x83, hi: 0x84}, - {value: 0x812e, lo: 0x85, hi: 0x85}, - // Block 0x78, offset 0x289 - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0x86, hi: 0x86}, - {value: 0x8105, lo: 0xb0, hi: 0xb0}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x79, offset 0x28d - {value: 0x17fe, lo: 0x07}, - {value: 0xa000, lo: 0x99, hi: 0x99}, - {value: 0x4287, lo: 0x9a, hi: 0x9a}, - {value: 0xa000, lo: 0x9b, hi: 0x9b}, - {value: 0x4291, lo: 0x9c, hi: 0x9c}, - {value: 0xa000, lo: 0xa5, hi: 0xa5}, - {value: 0x429b, lo: 0xab, hi: 0xab}, - {value: 0x8105, lo: 0xb9, hi: 0xba}, - // Block 0x7a, offset 0x295 - {value: 0x0000, lo: 0x06}, - {value: 0x8133, lo: 0x80, hi: 0x82}, - {value: 0x9900, lo: 0xa7, hi: 0xa7}, - {value: 0x42a5, lo: 0xae, hi: 0xae}, - {value: 0x42af, lo: 0xaf, hi: 0xaf}, - {value: 0xa000, lo: 0xb1, hi: 0xb2}, - {value: 0x8105, lo: 0xb3, hi: 0xb4}, - // Block 0x7b, offset 0x29c - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x80, hi: 0x80}, - {value: 0x8103, lo: 0x8a, hi: 0x8a}, - // Block 0x7c, offset 0x29f - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb5, hi: 0xb5}, - {value: 0x8103, lo: 0xb6, hi: 0xb6}, - // Block 0x7d, offset 0x2a2 - {value: 0x0002, lo: 0x01}, - {value: 0x8103, lo: 0xa9, hi: 0xaa}, - // Block 0x7e, offset 0x2a4 - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0xbb, hi: 0xbc}, - {value: 0x9900, lo: 0xbe, hi: 0xbe}, - // Block 0x7f, offset 0x2a7 - {value: 0x0000, lo: 0x07}, - {value: 0xa000, lo: 0x87, hi: 0x87}, - {value: 0x42b9, lo: 0x8b, hi: 0x8b}, - {value: 0x42c3, lo: 0x8c, hi: 0x8c}, - {value: 0x8105, lo: 0x8d, hi: 0x8d}, - {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x8133, lo: 0xa6, hi: 0xac}, - {value: 0x8133, lo: 0xb0, hi: 0xb4}, - // Block 0x80, offset 0x2af - {value: 0x5d33, lo: 0x09}, - {value: 0xa000, lo: 0x82, hi: 0x82}, - {value: 0x42cd, lo: 0x83, hi: 0x84}, - {value: 0x42d7, lo: 0x85, hi: 0x85}, - {value: 0xa000, lo: 0x8b, hi: 0x8b}, - {value: 0x42e1, lo: 0x8e, hi: 0x8e}, - {value: 0xa000, lo: 0x90, hi: 0x90}, - {value: 0x42eb, lo: 0x91, hi: 0x91}, - {value: 0x9900, lo: 0xb8, hi: 0xb8}, - {value: 0x9900, lo: 0xbb, hi: 0xbb}, - // Block 0x81, offset 0x2b9 - {value: 0x0000, lo: 0x06}, - {value: 0xb900, lo: 0x82, hi: 0x82}, - {value: 0x4c14, lo: 0x85, hi: 0x85}, - {value: 0x4c09, lo: 0x87, hi: 0x87}, - {value: 0x4c1f, lo: 0x88, hi: 0x88}, - {value: 0x9900, lo: 0x89, hi: 0x89}, - {value: 0x8105, lo: 0x8e, hi: 0x90}, - // Block 0x82, offset 0x2c0 - {value: 0x0000, lo: 0x03}, - {value: 0x8105, lo: 0x82, hi: 0x82}, - {value: 0x8103, lo: 0x86, hi: 0x86}, - {value: 0x8133, lo: 0x9e, hi: 0x9e}, - // Block 0x83, offset 0x2c4 - {value: 0x560b, lo: 0x06}, - {value: 0x9900, lo: 0xb0, hi: 0xb0}, - {value: 0xa000, lo: 0xb9, hi: 0xb9}, - {value: 0x9900, lo: 0xba, hi: 0xba}, - {value: 0x42ff, lo: 0xbb, hi: 0xbb}, - {value: 0x42f5, lo: 0xbc, hi: 0xbd}, - {value: 0x4309, lo: 0xbe, hi: 0xbe}, - // Block 0x84, offset 0x2cb - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0x82, hi: 0x82}, - {value: 0x8103, lo: 0x83, hi: 0x83}, - // Block 0x85, offset 0x2ce - {value: 0x0000, lo: 0x05}, - {value: 0x9900, lo: 0xaf, hi: 0xaf}, - {value: 0xa000, lo: 0xb8, hi: 0xb9}, - {value: 0x4313, lo: 0xba, hi: 0xba}, - {value: 0x431d, lo: 0xbb, hi: 0xbb}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x86, offset 0x2d4 - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0x80, hi: 0x80}, - // Block 0x87, offset 0x2d6 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xbf, hi: 0xbf}, - // Block 0x88, offset 0x2d8 - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb6, hi: 0xb6}, - {value: 0x8103, lo: 0xb7, hi: 0xb7}, - // Block 0x89, offset 0x2db - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xab, hi: 0xab}, - // Block 0x8a, offset 0x2dd - {value: 0x0000, lo: 0x02}, - {value: 0x8105, lo: 0xb9, hi: 0xb9}, - {value: 0x8103, lo: 0xba, hi: 0xba}, - // Block 0x8b, offset 0x2e0 - {value: 0x0000, lo: 0x04}, - {value: 0x9900, lo: 0xb0, hi: 0xb0}, - {value: 0xa000, lo: 0xb5, hi: 0xb5}, - {value: 0x4327, lo: 0xb8, hi: 0xb8}, - {value: 0x8105, lo: 0xbd, hi: 0xbe}, - // Block 0x8c, offset 0x2e5 - {value: 0x0000, lo: 0x01}, - {value: 0x8103, lo: 0x83, hi: 0x83}, - // Block 0x8d, offset 0x2e7 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xa0, hi: 0xa0}, - // Block 0x8e, offset 0x2e9 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0xb4, hi: 0xb4}, - // Block 0x8f, offset 0x2eb - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x87, hi: 0x87}, - // Block 0x90, offset 0x2ed - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x99, hi: 0x99}, - // Block 0x91, offset 0x2ef - {value: 0x0000, lo: 0x02}, - {value: 0x8103, lo: 0x82, hi: 0x82}, - {value: 0x8105, lo: 0x84, hi: 0x85}, - // Block 0x92, offset 0x2f2 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x97, hi: 0x97}, - // Block 0x93, offset 0x2f4 - {value: 0x0000, lo: 0x01}, - {value: 0x8105, lo: 0x81, hi: 0x82}, - // Block 0x94, offset 0x2f6 - {value: 0x0000, lo: 0x0c}, - {value: 0xb900, lo: 0x9e, hi: 0x9e}, - {value: 0x9900, lo: 0x9f, hi: 0xa0}, - {value: 0x4c83, lo: 0xa1, hi: 0xa1}, - {value: 0x4c8e, lo: 0xa2, hi: 0xa2}, - {value: 0x4c2a, lo: 0xa3, hi: 0xa3}, - {value: 0x4c40, lo: 0xa4, hi: 0xa4}, - {value: 0x4c35, lo: 0xa5, hi: 0xa5}, - {value: 0x4c56, lo: 0xa6, hi: 0xa6}, - {value: 0x4c74, lo: 0xa7, hi: 0xa7}, - {value: 0x4c65, lo: 0xa8, hi: 0xa8}, - {value: 0xb900, lo: 0xa9, hi: 0xa9}, - {value: 0x8105, lo: 0xaf, hi: 0xaf}, - // Block 0x95, offset 0x303 - {value: 0x0000, lo: 0x01}, - {value: 0x8101, lo: 0xb0, hi: 0xb4}, - // Block 0x96, offset 0x305 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xb0, hi: 0xb6}, - // Block 0x97, offset 0x307 - {value: 0x0000, lo: 0x05}, - {value: 0xa000, lo: 0xa3, hi: 0xa3}, - {value: 0xb900, lo: 0xa7, hi: 0xa7}, - {value: 0x4c4b, lo: 0xa8, hi: 0xa8}, - {value: 0x4b35, lo: 0xa9, hi: 0xa9}, - {value: 0x4347, lo: 0xaa, hi: 0xaa}, - // Block 0x98, offset 0x30d - {value: 0x0000, lo: 0x01}, - {value: 0x8102, lo: 0xb0, hi: 0xb1}, - // Block 0x99, offset 0x30f - {value: 0x0000, lo: 0x01}, - {value: 0x8101, lo: 0x9e, hi: 0x9e}, - // Block 0x9a, offset 0x311 - {value: 0x0002, lo: 0x02}, - {value: 0x0043, lo: 0x96, hi: 0xaf}, - {value: 0x0021, lo: 0xb0, hi: 0xb9}, - // Block 0x9b, offset 0x314 - {value: 0x0000, lo: 0x0c}, - {value: 0x4743, lo: 0x9e, hi: 0x9e}, - {value: 0x474d, lo: 0x9f, hi: 0x9f}, - {value: 0x4781, lo: 0xa0, hi: 0xa0}, - {value: 0x478f, lo: 0xa1, hi: 0xa1}, - {value: 0x479d, lo: 0xa2, hi: 0xa2}, - {value: 0x47ab, lo: 0xa3, hi: 0xa3}, - {value: 0x47b9, lo: 0xa4, hi: 0xa4}, - {value: 0x812c, lo: 0xa5, hi: 0xa6}, - {value: 0x8101, lo: 0xa7, hi: 0xa9}, - {value: 0x8131, lo: 0xad, hi: 0xad}, - {value: 0x812c, lo: 0xae, hi: 0xb2}, - {value: 0x812e, lo: 0xbb, hi: 0xbf}, - // Block 0x9c, offset 0x321 - {value: 0x0000, lo: 0x09}, - {value: 0x812e, lo: 0x80, hi: 0x82}, - {value: 0x8133, lo: 0x85, hi: 0x89}, - {value: 0x812e, lo: 0x8a, hi: 0x8b}, - {value: 0x8133, lo: 0xaa, hi: 0xad}, - {value: 0x4757, lo: 0xbb, hi: 0xbb}, - {value: 0x4761, lo: 0xbc, hi: 0xbc}, - {value: 0x47c7, lo: 0xbd, hi: 0xbd}, - {value: 0x47e3, lo: 0xbe, hi: 0xbe}, - {value: 0x47d5, lo: 0xbf, hi: 0xbf}, - // Block 0x9d, offset 0x32b - {value: 0x0000, lo: 0x01}, - {value: 0x47f1, lo: 0x80, hi: 0x80}, - // Block 0x9e, offset 0x32d - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x82, hi: 0x84}, - // Block 0x9f, offset 0x32f - {value: 0x0002, lo: 0x03}, - {value: 0x0043, lo: 0x80, hi: 0x99}, - {value: 0x0083, lo: 0x9a, hi: 0xb3}, - {value: 0x0043, lo: 0xb4, hi: 0xbf}, - // Block 0xa0, offset 0x333 - {value: 0x0002, lo: 0x04}, - {value: 0x005b, lo: 0x80, hi: 0x8d}, - {value: 0x0083, lo: 0x8e, hi: 0x94}, - {value: 0x0093, lo: 0x96, hi: 0xa7}, - {value: 0x0043, lo: 0xa8, hi: 0xbf}, - // Block 0xa1, offset 0x338 - {value: 0x0002, lo: 0x0b}, - {value: 0x0073, lo: 0x80, hi: 0x81}, - {value: 0x0083, lo: 0x82, hi: 0x9b}, - {value: 0x0043, lo: 0x9c, hi: 0x9c}, - {value: 0x0047, lo: 0x9e, hi: 0x9f}, - {value: 0x004f, lo: 0xa2, hi: 0xa2}, - {value: 0x0055, lo: 0xa5, hi: 0xa6}, - {value: 0x005d, lo: 0xa9, hi: 0xac}, - {value: 0x0067, lo: 0xae, hi: 0xb5}, - {value: 0x0083, lo: 0xb6, hi: 0xb9}, - {value: 0x008d, lo: 0xbb, hi: 0xbb}, - {value: 0x0091, lo: 0xbd, hi: 0xbf}, - // Block 0xa2, offset 0x344 - {value: 0x0002, lo: 0x04}, - {value: 0x0097, lo: 0x80, hi: 0x83}, - {value: 0x00a1, lo: 0x85, hi: 0x8f}, - {value: 0x0043, lo: 0x90, hi: 0xa9}, - {value: 0x0083, lo: 0xaa, hi: 0xbf}, - // Block 0xa3, offset 0x349 - {value: 0x0002, lo: 0x08}, - {value: 0x00af, lo: 0x80, hi: 0x83}, - {value: 0x0043, lo: 0x84, hi: 0x85}, - {value: 0x0049, lo: 0x87, hi: 0x8a}, - {value: 0x0055, lo: 0x8d, hi: 0x94}, - {value: 0x0067, lo: 0x96, hi: 0x9c}, - {value: 0x0083, lo: 0x9e, hi: 0xb7}, - {value: 0x0043, lo: 0xb8, hi: 0xb9}, - {value: 0x0049, lo: 0xbb, hi: 0xbe}, - // Block 0xa4, offset 0x352 - {value: 0x0002, lo: 0x05}, - {value: 0x0053, lo: 0x80, hi: 0x84}, - {value: 0x005f, lo: 0x86, hi: 0x86}, - {value: 0x0067, lo: 0x8a, hi: 0x90}, - {value: 0x0083, lo: 0x92, hi: 0xab}, - {value: 0x0043, lo: 0xac, hi: 0xbf}, - // Block 0xa5, offset 0x358 - {value: 0x0002, lo: 0x04}, - {value: 0x006b, lo: 0x80, hi: 0x85}, - {value: 0x0083, lo: 0x86, hi: 0x9f}, - {value: 0x0043, lo: 0xa0, hi: 0xb9}, - {value: 0x0083, lo: 0xba, hi: 0xbf}, - // Block 0xa6, offset 0x35d - {value: 0x0002, lo: 0x03}, - {value: 0x008f, lo: 0x80, hi: 0x93}, - {value: 0x0043, lo: 0x94, hi: 0xad}, - {value: 0x0083, lo: 0xae, hi: 0xbf}, - // Block 0xa7, offset 0x361 - {value: 0x0002, lo: 0x04}, - {value: 0x00a7, lo: 0x80, hi: 0x87}, - {value: 0x0043, lo: 0x88, hi: 0xa1}, - {value: 0x0083, lo: 0xa2, hi: 0xbb}, - {value: 0x0043, lo: 0xbc, hi: 0xbf}, - // Block 0xa8, offset 0x366 - {value: 0x0002, lo: 0x03}, - {value: 0x004b, lo: 0x80, hi: 0x95}, - {value: 0x0083, lo: 0x96, hi: 0xaf}, - {value: 0x0043, lo: 0xb0, hi: 0xbf}, - // Block 0xa9, offset 0x36a - {value: 0x0003, lo: 0x0f}, - {value: 0x023c, lo: 0x80, hi: 0x80}, - {value: 0x0556, lo: 0x81, hi: 0x81}, - {value: 0x023f, lo: 0x82, hi: 0x9a}, - {value: 0x0552, lo: 0x9b, hi: 0x9b}, - {value: 0x024b, lo: 0x9c, hi: 0x9c}, - {value: 0x0254, lo: 0x9d, hi: 0x9d}, - {value: 0x025a, lo: 0x9e, hi: 0x9e}, - {value: 0x027e, lo: 0x9f, hi: 0x9f}, - {value: 0x026f, lo: 0xa0, hi: 0xa0}, - {value: 0x026c, lo: 0xa1, hi: 0xa1}, - {value: 0x01f7, lo: 0xa2, hi: 0xb2}, - {value: 0x020c, lo: 0xb3, hi: 0xb3}, - {value: 0x022a, lo: 0xb4, hi: 0xba}, - {value: 0x0556, lo: 0xbb, hi: 0xbb}, - {value: 0x023f, lo: 0xbc, hi: 0xbf}, - // Block 0xaa, offset 0x37a - {value: 0x0003, lo: 0x0d}, - {value: 0x024b, lo: 0x80, hi: 0x94}, - {value: 0x0552, lo: 0x95, hi: 0x95}, - {value: 0x024b, lo: 0x96, hi: 0x96}, - {value: 0x0254, lo: 0x97, hi: 0x97}, - {value: 0x025a, lo: 0x98, hi: 0x98}, - {value: 0x027e, lo: 0x99, hi: 0x99}, - {value: 0x026f, lo: 0x9a, hi: 0x9a}, - {value: 0x026c, lo: 0x9b, hi: 0x9b}, - {value: 0x01f7, lo: 0x9c, hi: 0xac}, - {value: 0x020c, lo: 0xad, hi: 0xad}, - {value: 0x022a, lo: 0xae, hi: 0xb4}, - {value: 0x0556, lo: 0xb5, hi: 0xb5}, - {value: 0x023f, lo: 0xb6, hi: 0xbf}, - // Block 0xab, offset 0x388 - {value: 0x0003, lo: 0x0d}, - {value: 0x025d, lo: 0x80, hi: 0x8e}, - {value: 0x0552, lo: 0x8f, hi: 0x8f}, - {value: 0x024b, lo: 0x90, hi: 0x90}, - {value: 0x0254, lo: 0x91, hi: 0x91}, - {value: 0x025a, lo: 0x92, hi: 0x92}, - {value: 0x027e, lo: 0x93, hi: 0x93}, - {value: 0x026f, lo: 0x94, hi: 0x94}, - {value: 0x026c, lo: 0x95, hi: 0x95}, - {value: 0x01f7, lo: 0x96, hi: 0xa6}, - {value: 0x020c, lo: 0xa7, hi: 0xa7}, - {value: 0x022a, lo: 0xa8, hi: 0xae}, - {value: 0x0556, lo: 0xaf, hi: 0xaf}, - {value: 0x023f, lo: 0xb0, hi: 0xbf}, - // Block 0xac, offset 0x396 - {value: 0x0003, lo: 0x0d}, - {value: 0x026f, lo: 0x80, hi: 0x88}, - {value: 0x0552, lo: 0x89, hi: 0x89}, - {value: 0x024b, lo: 0x8a, hi: 0x8a}, - {value: 0x0254, lo: 0x8b, hi: 0x8b}, - {value: 0x025a, lo: 0x8c, hi: 0x8c}, - {value: 0x027e, lo: 0x8d, hi: 0x8d}, - {value: 0x026f, lo: 0x8e, hi: 0x8e}, - {value: 0x026c, lo: 0x8f, hi: 0x8f}, - {value: 0x01f7, lo: 0x90, hi: 0xa0}, - {value: 0x020c, lo: 0xa1, hi: 0xa1}, - {value: 0x022a, lo: 0xa2, hi: 0xa8}, - {value: 0x0556, lo: 0xa9, hi: 0xa9}, - {value: 0x023f, lo: 0xaa, hi: 0xbf}, - // Block 0xad, offset 0x3a4 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0x8f, hi: 0x8f}, - // Block 0xae, offset 0x3a6 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xae, hi: 0xae}, - // Block 0xaf, offset 0x3a8 - {value: 0x0000, lo: 0x01}, - {value: 0x8133, lo: 0xac, hi: 0xaf}, - // Block 0xb0, offset 0x3aa - {value: 0x0000, lo: 0x03}, - {value: 0x8134, lo: 0xac, hi: 0xad}, - {value: 0x812e, lo: 0xae, hi: 0xae}, - {value: 0x8133, lo: 0xaf, hi: 0xaf}, - // Block 0xb1, offset 0x3ae - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0xae, hi: 0xae}, - {value: 0x812e, lo: 0xaf, hi: 0xaf}, - // Block 0xb2, offset 0x3b1 - {value: 0x0000, lo: 0x04}, - {value: 0x8133, lo: 0xa3, hi: 0xa3}, - {value: 0x8133, lo: 0xa6, hi: 0xa6}, - {value: 0x8133, lo: 0xae, hi: 0xaf}, - {value: 0x8133, lo: 0xb5, hi: 0xb5}, - // Block 0xb3, offset 0x3b6 - {value: 0x0000, lo: 0x01}, - {value: 0x812e, lo: 0x90, hi: 0x96}, - // Block 0xb4, offset 0x3b8 - {value: 0x0000, lo: 0x02}, - {value: 0x8133, lo: 0x84, hi: 0x89}, - {value: 0x8103, lo: 0x8a, hi: 0x8a}, - // Block 0xb5, offset 0x3bb - {value: 0x0002, lo: 0x0a}, - {value: 0x0063, lo: 0x80, hi: 0x89}, - {value: 0x1a7e, lo: 0x8a, hi: 0x8a}, - {value: 0x1ab1, lo: 0x8b, hi: 0x8b}, - {value: 0x1acc, lo: 0x8c, hi: 0x8c}, - {value: 0x1ad2, lo: 0x8d, hi: 0x8d}, - {value: 0x1cf0, lo: 0x8e, hi: 0x8e}, - {value: 0x1ade, lo: 0x8f, hi: 0x8f}, - {value: 0x1aa8, lo: 0xaa, hi: 0xaa}, - {value: 0x1aab, lo: 0xab, hi: 0xab}, - {value: 0x1aae, lo: 0xac, hi: 0xac}, - // Block 0xb6, offset 0x3c6 - {value: 0x0000, lo: 0x01}, - {value: 0x1a6c, lo: 0x90, hi: 0x90}, - // Block 0xb7, offset 0x3c8 - {value: 0x0028, lo: 0x09}, - {value: 0x2999, lo: 0x80, hi: 0x80}, - {value: 0x295d, lo: 0x81, hi: 0x81}, - {value: 0x2967, lo: 0x82, hi: 0x82}, - {value: 0x297b, lo: 0x83, hi: 0x84}, - {value: 0x2985, lo: 0x85, hi: 0x86}, - {value: 0x2971, lo: 0x87, hi: 0x87}, - {value: 0x298f, lo: 0x88, hi: 0x88}, - {value: 0x0c6a, lo: 0x90, hi: 0x90}, - {value: 0x09e2, lo: 0x91, hi: 0x91}, - // Block 0xb8, offset 0x3d2 - {value: 0x0002, lo: 0x01}, - {value: 0x0021, lo: 0xb0, hi: 0xb9}, -} - -// recompMap: 7688 bytes (entries only) -var recompMap map[uint32]rune -var recompMapOnce sync.Once - -const recompMapPacked = "" + - "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 - "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 - "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 - "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 - "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 - "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 - "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 - "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 - "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 - "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA - "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB - "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC - "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD - "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE - "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF - "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 - "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 - "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 - "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 - "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 - "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 - "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 - "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA - "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB - "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC - "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD - "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 - "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 - "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 - "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 - "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 - "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 - "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 - "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 - "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 - "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA - "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB - "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC - "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED - "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE - "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF - "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 - "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 - "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 - "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 - "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 - "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 - "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 - "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA - "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB - "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC - "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD - "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF - "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 - "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 - "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 - "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 - "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 - "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 - "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 - "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 - "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 - "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 - "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A - "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B - "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C - "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D - "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E - "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F - "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 - "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 - "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 - "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 - "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 - "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 - "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 - "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 - "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A - "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B - "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C - "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D - "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E - "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F - "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 - "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 - "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 - "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 - "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 - "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 - "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 - "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 - "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A - "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B - "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C - "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D - "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E - "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F - "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 - "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 - "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 - "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 - "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 - "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 - "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A - "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B - "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C - "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D - "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E - "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 - "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 - "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 - "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 - "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 - "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 - "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C - "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D - "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E - "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F - "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 - "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 - "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 - "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 - "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 - "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 - "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 - "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 - "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A - "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B - "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C - "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D - "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E - "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F - "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 - "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 - "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 - "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 - "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 - "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 - "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 - "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 - "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A - "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B - "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C - "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D - "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E - "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F - "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 - "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 - "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 - "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 - "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 - "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 - "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 - "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 - "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 - "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 - "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A - "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B - "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C - "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D - "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E - "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 - "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 - "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF - "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 - "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD - "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE - "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF - "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 - "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 - "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 - "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 - "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 - "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 - "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 - "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 - "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 - "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 - "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA - "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB - "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC - "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE - "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF - "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 - "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 - "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 - "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 - "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 - "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 - "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 - "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 - "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA - "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB - "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC - "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED - "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE - "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF - "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 - "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 - "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 - "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 - "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 - "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA - "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB - "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC - "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD - "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE - "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF - "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 - "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 - "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 - "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 - "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 - "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 - "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 - "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 - "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 - "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 - "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A - "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B - "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C - "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D - "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E - "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F - "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 - "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 - "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 - "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 - "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 - "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 - "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 - "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 - "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 - "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 - "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A - "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B - "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E - "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F - "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 - "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 - "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 - "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 - "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A - "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B - "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C - "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D - "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E - "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F - "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 - "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 - "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 - "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 - "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 - "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 - "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 - "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 - "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A - "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C - "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E - "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F - "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 - "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA - "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB - "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC - "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD - "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE - "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF - "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 - "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA - "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB - "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC - "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD - "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE - "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 - "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 - "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 - "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 - "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 - "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 - "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C - "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D - "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E - "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 - "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 - "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 - "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 - "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 - "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 - "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C - "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D - "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E - "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 - "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 - "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 - "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 - "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 - "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 - "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 - "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 - "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 - "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 - "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA - "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB - "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC - "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD - "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE - "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF - "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 - "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 - "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 - "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 - "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 - "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 - "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA - "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB - "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC - "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED - "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE - "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF - "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 - "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 - "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 - "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 - "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 - "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 - "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 - "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 - "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 - "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 - "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 - "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 - "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 - "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 - "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 - "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 - "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 - "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 - "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 - "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB - "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC - "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 - "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B - "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C - "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 - "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA - "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB - "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC - "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 - "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 - "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 - "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 - "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA - "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB - "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A - "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B - "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C - "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA - "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC - "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD - "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE - "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 - "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 - "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 - "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A - "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C - "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E - "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 - "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B - "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D - "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 - "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 - "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 - "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 - "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 - "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 - "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 - "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 - "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 - "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 - "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 - "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 - "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 - "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A - "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B - "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C - "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D - "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E - "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F - "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 - "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 - "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 - "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 - "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 - "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 - "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 - "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 - "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 - "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 - "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A - "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B - "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C - "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D - "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E - "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F - "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 - "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 - "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 - "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 - "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 - "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 - "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 - "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 - "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 - "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 - "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A - "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B - "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C - "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D - "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E - "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F - "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 - "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 - "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 - "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 - "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 - "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 - "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 - "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 - "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 - "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 - "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A - "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B - "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C - "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D - "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E - "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F - "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 - "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 - "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 - "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 - "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 - "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 - "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 - "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 - "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 - "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 - "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A - "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B - "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C - "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D - "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E - "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F - "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 - "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 - "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 - "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 - "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 - "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 - "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 - "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 - "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 - "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 - "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A - "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B - "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C - "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D - "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E - "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F - "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 - "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 - "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 - "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 - "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 - "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 - "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 - "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 - "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 - "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 - "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A - "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B - "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C - "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D - "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E - "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F - "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 - "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 - "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 - "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 - "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 - "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 - "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 - "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 - "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 - "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 - "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A - "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B - "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C - "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D - "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E - "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F - "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 - "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 - "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 - "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 - "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 - "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 - "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 - "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 - "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 - "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 - "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A - "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B - "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C - "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D - "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E - "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F - "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 - "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 - "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 - "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 - "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 - "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 - "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 - "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 - "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 - "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 - "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B - "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 - "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 - "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 - "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 - "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 - "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 - "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 - "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 - "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 - "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 - "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA - "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB - "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC - "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD - "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE - "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF - "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 - "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 - "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 - "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 - "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 - "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 - "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 - "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 - "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 - "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 - "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA - "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB - "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC - "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD - "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE - "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF - "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 - "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 - "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 - "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 - "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 - "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 - "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 - "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 - "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 - "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 - "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA - "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB - "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC - "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD - "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE - "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF - "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 - "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 - "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 - "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 - "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 - "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 - "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 - "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 - "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 - "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 - "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA - "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB - "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC - "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD - "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE - "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF - "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 - "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 - "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 - "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 - "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 - "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 - "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 - "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 - "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 - "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 - "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA - "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB - "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC - "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED - "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE - "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF - "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 - "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 - "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 - "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 - "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 - "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 - "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 - "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 - "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 - "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 - "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 - "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 - "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 - "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 - "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 - "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 - "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 - "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 - "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 - "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 - "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A - "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B - "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C - "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D - "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E - "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F - "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 - "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 - "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 - "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 - "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 - "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 - "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 - "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 - "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A - "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B - "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C - "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D - "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 - "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 - "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 - "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 - "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 - "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 - "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 - "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 - "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 - "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 - "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A - "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B - "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C - "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D - "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E - "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F - "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 - "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 - "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 - "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 - "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 - "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 - "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 - "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 - "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 - "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 - "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A - "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B - "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C - "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D - "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E - "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F - "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 - "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 - "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 - "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 - "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 - "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 - "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 - "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 - "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A - "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B - "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C - "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D - "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 - "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 - "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 - "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 - "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 - "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 - "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 - "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 - "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 - "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B - "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D - "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F - "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 - "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 - "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 - "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 - "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 - "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 - "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 - "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 - "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 - "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 - "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A - "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B - "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C - "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D - "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E - "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F - "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 - "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 - "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 - "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 - "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 - "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A - "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C - "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 - "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 - "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 - "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 - "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 - "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 - "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 - "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 - "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 - "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 - "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A - "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B - "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C - "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D - "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E - "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F - "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 - "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 - "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 - "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 - "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 - "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 - "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 - "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 - "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 - "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 - "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A - "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B - "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C - "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D - "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E - "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F - "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 - "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 - "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 - "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 - "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 - "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 - "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 - "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 - "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 - "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 - "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA - "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB - "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC - "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD - "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE - "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF - "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 - "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 - "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 - "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 - "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 - "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 - "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 - "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 - "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 - "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA - "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC - "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 - "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 - "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 - "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 - "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 - "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 - "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 - "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA - "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC - "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD - "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE - "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF - "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 - "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 - "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 - "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 - "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 - "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 - "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 - "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA - "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD - "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE - "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF - "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 - "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 - "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 - "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 - "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 - "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 - "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 - "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 - "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 - "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA - "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC - "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED - "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 - "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 - "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 - "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 - "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 - "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 - "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA - "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC - "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A - "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B - "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE - "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD - "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE - "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF - "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 - "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 - "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C - "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 - "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 - "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 - "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 - "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 - "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 - "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 - "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 - "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D - "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E - "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F - "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 - "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 - "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 - "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 - "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 - "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 - "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 - "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 - "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 - "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 - "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 - "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 - "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC - "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD - "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE - "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF - "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 - "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 - "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 - "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 - "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA - "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB - "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC - "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED - "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C - "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E - "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 - "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 - "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 - "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 - "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 - "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A - "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C - "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E - "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 - "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 - "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 - "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 - "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 - "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 - "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 - "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 - "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 - "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 - "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 - "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 - "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A - "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C - "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D - "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 - "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E - "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC - "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE - "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 - "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 - "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 - "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 - "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 - "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA - "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC - "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE - "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 - "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 - "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 - "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 - "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 - "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 - "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 - "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 - "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 - "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 - "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 - "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 - "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA - "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC - "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD - "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 - "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 - "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 - "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 - "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA - "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE - "\x05\xd2\x03\a\x00\x01\x05\xc9" + // 0x05D20307: 0x000105C9 - "\x05\xda\x03\a\x00\x01\x05\xe4" + // 0x05DA0307: 0x000105E4 - "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A - "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C - "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB - "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E - "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F - "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B - "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C - "\x13\x82\x13\xc9\x00\x01\x13\x83" + // 0x138213C9: 0x00011383 - "\x13\x84\x13\xbb\x00\x01\x13\x85" + // 0x138413BB: 0x00011385 - "\x13\x8b\x13\xc2\x00\x01\x13\x8e" + // 0x138B13C2: 0x0001138E - "\x13\x90\x13\xc9\x00\x01\x13\x91" + // 0x139013C9: 0x00011391 - "\x13\xc2\x13\xc2\x00\x01\x13\xc5" + // 0x13C213C2: 0x000113C5 - "\x13\xc2\x13\xb8\x00\x01\x13\xc7" + // 0x13C213B8: 0x000113C7 - "\x13\xc2\x13\xc9\x00\x01\x13\xc8" + // 0x13C213C9: 0x000113C8 - "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB - "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC - "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE - "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA - "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB - "\x195\x190\x00\x01\x198" + // 0x19351930: 0x00011938 - "a\x1ea\x1e\x00\x01a!" + // 0x611E611E: 0x00016121 - "a\x1ea)\x00\x01a\"" + // 0x611E6129: 0x00016122 - "a\x1ea\x1f\x00\x01a#" + // 0x611E611F: 0x00016123 - "a)a\x1f\x00\x01a$" + // 0x6129611F: 0x00016124 - "a\x1ea \x00\x01a%" + // 0x611E6120: 0x00016125 - "a!a\x1f\x00\x01a&" + // 0x6121611F: 0x00016126 - "a\"a\x1f\x00\x01a'" + // 0x6122611F: 0x00016127 - "a!a \x00\x01a(" + // 0x61216120: 0x00016128 - "mgmg\x00\x01mh" + // 0x6D676D67: 0x00016D68 - "mcmg\x00\x01mi" + // 0x6D636D67: 0x00016D69 - "mimg\x00\x01mj" + // 0x6D696D67: 0x00016D6A - "" - // Total size of tables: 57KB (58086 bytes) diff --git a/embed/vendor/golang.org/x/text/unicode/norm/transform.go b/embed/vendor/golang.org/x/text/unicode/norm/transform.go deleted file mode 100644 index a1d366ae..00000000 --- a/embed/vendor/golang.org/x/text/unicode/norm/transform.go +++ /dev/null @@ -1,88 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package norm - -import ( - "unicode/utf8" - - "golang.org/x/text/transform" -) - -// Reset implements the Reset method of the transform.Transformer interface. -func (Form) Reset() {} - -// Transform implements the Transform method of the transform.Transformer -// interface. It may need to write segments of up to MaxSegmentSize at once. -// Users should either catch ErrShortDst and allow dst to grow or have dst be at -// least of size MaxTransformChunkSize to be guaranteed of progress. -func (f Form) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - // Cap the maximum number of src bytes to check. - b := src - eof := atEOF - if ns := len(dst); ns < len(b) { - err = transform.ErrShortDst - eof = false - b = b[:ns] - } - i, ok := formTable[f].quickSpan(inputBytes(b), 0, len(b), eof) - n := copy(dst, b[:i]) - if !ok { - nDst, nSrc, err = f.transform(dst[n:], src[n:], atEOF) - return nDst + n, nSrc + n, err - } - - if err == nil && n < len(src) && !atEOF { - err = transform.ErrShortSrc - } - return n, n, err -} - -func flushTransform(rb *reorderBuffer) bool { - // Write out (must fully fit in dst, or else it is an ErrShortDst). - if len(rb.out) < rb.nrune*utf8.UTFMax { - return false - } - rb.out = rb.out[rb.flushCopy(rb.out):] - return true -} - -var errs = []error{nil, transform.ErrShortDst, transform.ErrShortSrc} - -// transform implements the transform.Transformer interface. It is only called -// when quickSpan does not pass for a given string. -func (f Form) transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - // TODO: get rid of reorderBuffer. See CL 23460044. - rb := reorderBuffer{} - rb.init(f, src) - for { - // Load segment into reorder buffer. - rb.setFlusher(dst[nDst:], flushTransform) - end := decomposeSegment(&rb, nSrc, atEOF) - if end < 0 { - return nDst, nSrc, errs[-end] - } - nDst = len(dst) - len(rb.out) - nSrc = end - - // Next quickSpan. - end = rb.nsrc - eof := atEOF - if n := nSrc + len(dst) - nDst; n < end { - err = transform.ErrShortDst - end = n - eof = false - } - end, ok := rb.f.quickSpan(rb.src, nSrc, end, eof) - n := copy(dst[nDst:], rb.src.bytes[nSrc:end]) - nSrc += n - nDst += n - if ok { - if err == nil && n < rb.nsrc && !atEOF { - err = transform.ErrShortSrc - } - return nDst, nSrc, err - } - } -} diff --git a/embed/vendor/golang.org/x/text/unicode/norm/trie.go b/embed/vendor/golang.org/x/text/unicode/norm/trie.go deleted file mode 100644 index e4250ae2..00000000 --- a/embed/vendor/golang.org/x/text/unicode/norm/trie.go +++ /dev/null @@ -1,54 +0,0 @@ -// Copyright 2011 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package norm - -type valueRange struct { - value uint16 // header: value:stride - lo, hi byte // header: lo:n -} - -type sparseBlocks struct { - values []valueRange - offset []uint16 -} - -var nfcSparse = sparseBlocks{ - values: nfcSparseValues[:], - offset: nfcSparseOffset[:], -} - -var nfkcSparse = sparseBlocks{ - values: nfkcSparseValues[:], - offset: nfkcSparseOffset[:], -} - -var ( - nfcData = newNfcTrie(0) - nfkcData = newNfkcTrie(0) -) - -// lookup determines the type of block n and looks up the value for b. -// For n < t.cutoff, the block is a simple lookup table. Otherwise, the block -// is a list of ranges with an accompanying value. Given a matching range r, -// the value for b is by r.value + (b - r.lo) * stride. -func (t *sparseBlocks) lookup(n uint32, b byte) uint16 { - offset := t.offset[n] - header := t.values[offset] - lo := offset + 1 - hi := lo + uint16(header.lo) - for lo < hi { - m := lo + (hi-lo)/2 - r := t.values[m] - if r.lo <= b && b <= r.hi { - return r.value + uint16(b-r.lo)*header.value - } - if b < r.lo { - hi = m - } else { - lo = m + 1 - } - } - return 0 -} diff --git a/embed/vendor/modules.txt b/embed/vendor/modules.txt deleted file mode 100644 index a02ab0c8..00000000 --- a/embed/vendor/modules.txt +++ /dev/null @@ -1,20 +0,0 @@ -# github.com/refaktor/rye v0.0.0-00010101000000-000000000000 => ../ -## explicit; go 1.26.1 -github.com/refaktor/rye/env -github.com/refaktor/rye/evaldo -github.com/refaktor/rye/loader -github.com/refaktor/rye/util -# golang.org/x/crypto v0.52.0 -## explicit; go 1.25.0 -golang.org/x/crypto/pbkdf2 -# golang.org/x/text v0.37.0 -## explicit; go 1.25.0 -golang.org/x/text/cases -golang.org/x/text/internal -golang.org/x/text/internal/language -golang.org/x/text/internal/language/compact -golang.org/x/text/internal/tag -golang.org/x/text/language -golang.org/x/text/transform -golang.org/x/text/unicode/norm -# github.com/refaktor/rye => ../ diff --git a/embed2/go.mod b/embed2/go.mod index 497f4ec3..b55a3fc2 100644 --- a/embed2/go.mod +++ b/embed2/go.mod @@ -2,27 +2,20 @@ module github.com/refaktor/rye/embed2 go 1.26.1 -replace github.com/refaktor/rye => ../ +// replace github.com/refaktor/rye => ../ -require github.com/refaktor/rye v0.0.0-00010101000000-000000000000 +require github.com/refaktor/rye v0.2.58 require ( - github.com/clipperhouse/uax29/v2 v2.7.0 // indirect github.com/drewlanenga/govector v0.0.0-20220726163947-b958ac08bc93 // indirect github.com/elastic/go-seccomp-bpf v1.6.0 // indirect github.com/fsnotify/fsnotify v1.10.1 // indirect - github.com/kopoli/go-terminal-size v0.0.0-20170219200355-5c97524c8b54 // indirect github.com/kr/pretty v0.3.1 // indirect github.com/landlock-lsm/go-landlock v0.8.1 // indirect - github.com/mattn/go-isatty v0.0.22 // indirect - github.com/mattn/go-runewidth v0.0.24 // indirect - github.com/pkg/term v1.2.0-beta.2.0.20211217091447-1a4a3b719465 // indirect github.com/refaktor/keyboard v0.0.0-20260517095250-755a59d30156 // indirect golang.org/x/crypto v0.52.0 // indirect golang.org/x/net v0.55.0 // indirect - golang.org/x/sync v0.20.0 // indirect golang.org/x/sys v0.45.0 // indirect - golang.org/x/term v0.43.0 // indirect golang.org/x/text v0.37.0 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect kernel.org/pub/linux/libs/security/libcap/psx v1.2.77 // indirect diff --git a/embed2/go.sum b/embed2/go.sum index cf207718..1fd3d273 100644 --- a/embed2/go.sum +++ b/embed2/go.sum @@ -1,7 +1,5 @@ github.com/bmizerany/assert v0.0.0-20160611221934-b7ed37b82869 h1:DDGfHa7BWjL4YnC6+E63dPcxHo2sUxDIu8g3QgEJdRY= github.com/bmizerany/assert v0.0.0-20160611221934-b7ed37b82869/go.mod h1:Ekp36dRnpXw/yCqJaO+ZrUyxD+3VXMFFr56k5XYrpB4= -github.com/clipperhouse/uax29/v2 v2.7.0 h1:+gs4oBZ2gPfVrKPthwbMzWZDaAFPGYK72F0NJv2v7Vk= -github.com/clipperhouse/uax29/v2 v2.7.0/go.mod h1:EFJ2TJMRUaplDxHKj1qAEhCtQPW2tJSwu5BF98AuoVM= github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E= github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc h1:U9qPSI2PIWSS1VwoXQT9A3Wy9MM3WgvqSxFWenqJduM= github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= @@ -11,25 +9,19 @@ github.com/elastic/go-seccomp-bpf v1.6.0 h1:NYduiYxRJ0ZkIyQVwlSskcqPPSg6ynu5pK0/ github.com/elastic/go-seccomp-bpf v1.6.0/go.mod h1:5tFsTvH4NtWGfpjsOQD53H8HdVQ+zSZFRUDSGevC0Kc= github.com/fsnotify/fsnotify v1.10.1 h1:b0/UzAf9yR5rhf3RPm9gf3ehBPpf0oZKIjtpKrx59Ho= github.com/fsnotify/fsnotify v1.10.1/go.mod h1:TLheqan6HD6GBK6PrDWyDPBaEV8LspOxvPSjC+bVfgo= -github.com/kopoli/go-terminal-size v0.0.0-20170219200355-5c97524c8b54 h1:0SMHxjkLKNawqUjjnMlCtEdj6uWZjv0+qDZ3F6GOADI= -github.com/kopoli/go-terminal-size v0.0.0-20170219200355-5c97524c8b54/go.mod h1:bm7MVZZvHQBfqHG5X59jrRE/3ak6HvK+/Zb6aZhLR2s= github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE= github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk= github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE= github.com/landlock-lsm/go-landlock v0.8.1 h1:Krs1co16IzN7bQcFYIdtNF+BKwZem3geRBkVsZtlCKU= github.com/landlock-lsm/go-landlock v0.8.1/go.mod h1:mn5GSi81Jf7yMs5WSi+SUi4sUeNLUGVdbT4Id6wXNQw= -github.com/mattn/go-isatty v0.0.22 h1:j8l17JJ9i6VGPUFUYoTUKPSgKe/83EYU2zBC7YNKMw4= -github.com/mattn/go-isatty v0.0.22/go.mod h1:ZXfXG4SQHsB/w3ZeOYbR0PrPwLy+n6xiMrJlRFqopa4= -github.com/mattn/go-runewidth v0.0.24 h1:cpokDiIn0MGnhdHwuWnJBITySJ20QyNGnY2kR/ay2DU= -github.com/mattn/go-runewidth v0.0.24/go.mod h1:XBkDxAl56ILZc9knddidhrOlY5R/pDhgLpndooCuJAs= github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA= -github.com/pkg/term v1.2.0-beta.2.0.20211217091447-1a4a3b719465 h1:J1AQza02ffZ4VP77HnZ5kRyzf6ak1LkjYQutOCdvckI= -github.com/pkg/term v1.2.0-beta.2.0.20211217091447-1a4a3b719465/go.mod h1:E25nymQcrSllhX42Ok8MRm1+hyBdHY0dCeiKZ9jpNGw= github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 h1:Jamvg5psRIccs7FGNTlIRMkT8wgtp5eCXdBlqhYGL6U= github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/refaktor/keyboard v0.0.0-20260517095250-755a59d30156 h1:65WdY1ncb72bv7BDabW9iiCnUtgCddiP2qCA++bhTMo= github.com/refaktor/keyboard v0.0.0-20260517095250-755a59d30156/go.mod h1:GwFCpZSiID9sqQ9Zm0tCmw8eeI9hThLQ7pv1wcTp0I0= +github.com/refaktor/rye v0.2.58 h1:LA3nSECCIwFCps2Q1IkiQgRDXxyYxS7zCfg9sNpUuf0= +github.com/refaktor/rye v0.2.58/go.mod h1:ROVNEuIvbrBxrvS+/MmOG7taFdypETB6BGlXR+MmBkI= github.com/rogpeppe/go-internal v1.9.0 h1:73kH8U+JUqXU8lRuOHeVHaa/SZPifC7BkcraZVejAe8= github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs= github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA= @@ -38,13 +30,8 @@ golang.org/x/crypto v0.52.0 h1:RMs7fP2rXdep0CftQlK8Uf+kibLm7qkCcradZWYz988= golang.org/x/crypto v0.52.0/go.mod h1:1QgfPxDqh0T2M/elOJtp9RvuR95kVjir0e6/BvEmGbc= golang.org/x/net v0.55.0 h1:bcvxaJn3e1U6InsFWt1JUq1aSjnRxLzT2rtD2KfkDF8= golang.org/x/net v0.55.0/go.mod h1:L5U2KuzuOe1lY7Z+aWVIKK6qEeJXnXV9yzGA+WCHJww= -golang.org/x/sync v0.20.0 h1:e0PTpb7pjO8GAtTs2dQ6jYa5BWYlMuX047Dco/pItO4= -golang.org/x/sync v0.20.0/go.mod h1:9xrNwdLfx4jkKbNva9FpL6vEN7evnE43NNNJQ2LF3+0= -golang.org/x/sys v0.0.0-20200909081042-eff7692f9009/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.45.0 h1:dO4czNzziLiiXplLQgBCEpCvXQ3dnkn0SdaZSYdQ+FY= golang.org/x/sys v0.45.0/go.mod h1:4GL1E5IUh+htKOUEOaiffhrAeqysfVGipDYzABqnCmw= -golang.org/x/term v0.43.0 h1:S4RLU2sB31O/NCl+zFN9Aru9A/Cq2aqKpTZJ6B+DwT4= -golang.org/x/term v0.43.0/go.mod h1:lrhlHNdQJHO+1qVYiHfFKVuVioJIheAc3fBSMFYEIsk= golang.org/x/text v0.37.0 h1:Cqjiwd9eSg8e0QAkyCaQTNHFIIzWtidPahFWR83rTrc= golang.org/x/text v0.37.0/go.mod h1:a5sjxXGs9hsn/AJVwuElvCAo9v8QYLzvavO5z2PiM38= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= diff --git a/evaldo/evaldo.go b/evaldo/evaldo.go index 9523a513..fb10135f 100644 --- a/evaldo/evaldo.go +++ b/evaldo/evaldo.go @@ -119,15 +119,27 @@ func EvalBlockInj_Rye2(ps *env.ProgramState, inj env.Object, injnow bool) { // token (Pipeword, Dotword, LSetword, Opword) - an orphaned chain left by ^fix. // If the next token starts a fresh independent expression, clear ReturnFlag and // continue so that code after e.g. a "for" loop keeps running. - if ps.ErrorFlag || ps.ReturnFlag || ps.FailureFlag { + if ps.ErrorFlag || ps.ReturnFlag { // fmt.Println("EVAL BLOCK INJ") // fmt.Println(ps.ErrorFlag, ps.ReturnFlag, ps.CallDepth) - // At top level (CallDepth == 0), convert unhandled failures to errors - // so they are displayed and stop evaluation (same semantics as tryHandleFailure) - if ps.FailureFlag && ps.CallDepth == 0 && !ps.ErrorFlag { - ps.ErrorFlag = true - return - } + // At top level (CallDepth == 0), a FailureFlag without ErrorFlag should + // not be immediately converted to error. Check if a handler token follows + // (pipeword, dotword, etc.) that could process the failure (e.g. |disarm, + // |fix, |check). If so, let the loop continue so the handler can act. + /* if ps.FailureFlag && ps.CallDepth == 0 && !ps.ErrorFlag { + if ps.Ser.Pos() < ps.Ser.Len() { + switch ps.Ser.Peek().(type) { + case env.Pipeword, env.Dotword, env.LSetword, env.Opword: + // Handler token follows — let the loop continue + default: + ps.ErrorFlag = true + return + } + } else { + ps.ErrorFlag = true + return + } + }*/ if ps.ErrorFlag || ps.CallDepth > 0 { return } @@ -230,7 +242,7 @@ func EvalExpression(ps *env.ProgramState, inj env.Object, injnow bool, limited b } // Eval expression that doesn't get value from the left EvalExpression_DispatchType(ps) - if ps.ReturnFlag || ps.ErrorFlag || ps.FailureFlag { + if ps.ReturnFlag || ps.ErrorFlag { // W0607 return injnow } } else { @@ -278,7 +290,7 @@ func EvalExpressionInjLimited(ps *env.ProgramState, inj env.Object, injnow bool) // allowDotwords=false: prevents nested dotwords from being consumed as arguments (set when collecting dotword args) func OptionallyEvalExpressionRight(nextObj env.Object, ps *env.ProgramState, limited bool, allowOpwords bool, allowDotwords bool) { // fmt.Println("--OptionallyEvalExpressionRight:1") - if nextObj == nil || ps.ReturnFlag || ps.ErrorFlag || ps.FailureFlag { + if nextObj == nil || ps.ReturnFlag || ps.ErrorFlag { // W0607 return } // exit quickly for most common value types - any type that DispatchType @@ -322,7 +334,7 @@ func OptionallyEvalExpressionRight(nextObj env.Object, ps *env.ProgramState, lim var firstVal env.Object if pipeSecond && !ps.Ser.AtLast() { EvalExpression_CollectArg(ps, true, false) - if ps.ReturnFlag || ps.ErrorFlag || ps.FailureFlag { + if ps.ReturnFlag || ps.ErrorFlag { // W0607 return } firstVal = ps.Res @@ -338,7 +350,7 @@ func OptionallyEvalExpressionRight(nextObj env.Object, ps *env.ProgramState, lim default: return } - if ps.ReturnFlag || ps.ErrorFlag || ps.FailureFlag { + if ps.ReturnFlag || ps.ErrorFlag { // W0607 return } OptionallyEvalExpressionRight(ps.Ser.Peek(), ps, limited, allowOpwords, allowDotwords) @@ -363,7 +375,7 @@ func OptionallyEvalExpressionRight(nextObj env.Object, ps *env.ProgramState, lim ps.Ser.Next() // Pass dotword=true so argument collection blocks further dotwords (symmetric to opword blocking opwords) EvalWord(ps, opword.ToWord(), ps.Res, false, opword.Force > 0, true, true) - if ps.ReturnFlag || ps.ErrorFlag || ps.FailureFlag { + if ps.ReturnFlag || ps.ErrorFlag { // W0607 return } // Continue dotword chain if another dotword follows (at same level, allowDotwords unchanged). @@ -994,7 +1006,7 @@ func EvalWord(ps *env.ProgramState, word env.Object, leftVal env.Object, toLeft // first, then call Read on that URI. Previously, EvalExpression_DispatchType // only grabbed the bare next atom (%file), giving generic words wrong priority. EvalExpression_CollectArg(ps, true, false) - if ps.ReturnFlag || ps.ErrorFlag || ps.FailureFlag { + if ps.ReturnFlag || ps.ErrorFlag { // W0607 // Don't return yet - fall through to "Word not found" error. // This handles cases like "undefined_word |Print" where pipeword barrier // would otherwise mask the real error. @@ -1010,7 +1022,7 @@ func EvalWord(ps *env.ProgramState, word env.Object, leftVal env.Object, toLeft if pipeSecond && !argCollectionFailed { if !ps.Ser.AtLast() { EvalExpression_CollectArg(ps, true, false) - if ps.ReturnFlag || ps.ErrorFlag || ps.FailureFlag { + if ps.ReturnFlag || ps.ErrorFlag { // W0607 argCollectionFailed = true argCollectionError = ps.Res // preserve the real error ps.ErrorFlag = false @@ -1964,7 +1976,7 @@ func CallBuiltin_CollectArgs(bi env.Builtin, ps *env.ProgramState, arg0_ env.Obj if checkForFailureWithBuiltin(bi, ps, 1) { return } - if ps.ReturnFlag || ps.ErrorFlag || ps.FailureFlag { + if ps.ReturnFlag || ps.ErrorFlag { // W0607 ps.Res = env.NewError4(0, "Argument 2 of "+strconv.Itoa(bi.Argsn)+" missing for builtin "+FormatBuiltinReference(bi.Doc)+". Check that all required arguments are provided.", getParentErr(), nil) return } @@ -1978,7 +1990,7 @@ func CallBuiltin_CollectArgs(bi env.Builtin, ps *env.ProgramState, arg0_ env.Obj if checkForFailureWithBuiltin(bi, ps, 2) { return } - if ps.ReturnFlag || ps.ErrorFlag || ps.FailureFlag { + if ps.ReturnFlag || ps.ErrorFlag { // W0607 ps.Res = env.NewError4(0, "Argument 3 missing. Check that all required arguments are provided for the builtin function.", getParentErr(), nil) return } @@ -1991,7 +2003,7 @@ func CallBuiltin_CollectArgs(bi env.Builtin, ps *env.ProgramState, arg0_ env.Obj if checkForFailureWithBuiltin(bi, ps, 3) { return } - if ps.ReturnFlag || ps.ErrorFlag || ps.FailureFlag { + if ps.ReturnFlag || ps.ErrorFlag { // W0607 ps.Res = env.NewError4(0, "Argument 4 missing. Check that all required arguments are provided for the builtin function.", getParentErr(), nil) return } @@ -2004,7 +2016,7 @@ func CallBuiltin_CollectArgs(bi env.Builtin, ps *env.ProgramState, arg0_ env.Obj if checkForFailureWithBuiltin(bi, ps, 4) { return } - if ps.ReturnFlag || ps.ErrorFlag || ps.FailureFlag { + if ps.ReturnFlag || ps.ErrorFlag { // W0607 ps.Res = env.NewError4(0, "Argument 5 missing. Check that all required arguments are provided for the builtin function.", getParentErr(), nil) return } @@ -2517,7 +2529,8 @@ func trace(s string) {} // tryHandleFailure attempts to handle a failure by calling context error handlers. // Called from: EvalBlockInj // Purpose: Checks for failure flag and tries to invoke error-handler word from context. -// At top-level (CallDepth == 0), an unhandled failure (including returned ones) becomes an error. +// At top-level (CallDepth == 0), an unhandled failure (including returned ones) becomes +// an error only if no handler token (pipeword, dotword, etc.) follows in the series. // Inside functions, returned failures propagate up; non-returned failures become errors. func tryHandleFailure(ps *env.ProgramState) bool { if ps.FailureFlag && !ps.InErrHandler { @@ -2527,11 +2540,18 @@ func tryHandleFailure(ps *env.ProgramState) bool { return false // Successfully handled }*/ - // At top-level (CallDepth == 0), any unhandled failure becomes an error - // This includes failures that were explicitly returned via ^fail + // At top-level (CallDepth == 0), only convert failure to error if there is + // no handler token (pipeword, dotword, etc.) next in the series that could + // process the failure. Handlers like |disarm, |fix, |check have AcceptFailure + // and need the failure to reach them. if ps.CallDepth == 0 { - // fmt.Println("**Err tryHandleFailure at top-level: T**") - return true // Convert to error at top level + if false && ps.Ser.Pos() < ps.Ser.Len() { + switch ps.Ser.Peek().(type) { + case env.Pipeword, env.Dotword, env.LSetword, env.Opword: + return false // Handler may process the failure + } + } + return true // No handler available — convert to error } // Inside a function: check if failure should be converted to error or propagated diff --git a/examples/github/merge-dependabots.rye b/examples/github/merge-dependabots.rye index 45f7f30c..1fd63841 100644 --- a/examples/github/merge-dependabots.rye +++ b/examples/github/merge-dependabots.rye @@ -18,7 +18,7 @@ do-merge: fn { num } { Request ( url ++ repo ++ "/pulls?state=open" ) 'GET "" |set-headers |Call |^ensure\with { .Status? = 200 } "request to github failed" -|Reader .Read\string .parse-json +|Reader |Read\string |probe |parse-json |filter { -> "user" -> "login" |= bot } |pass { .length? .embed "{} pull requests found" |print } |for { -> "number" ::num ,