Protein structure prediction for HoloScript — part of the HoloScript ecosystem.
Brings protein structure prediction into HoloScript scenes. Supports the AlphaFold API (cloud) and local ColabFold (GPU). The plugin targets the AlphaFold API; ColabFold compatibility covers local runs.
- Cloud protein structure prediction via the AlphaFold API
- Local prediction via ColabFold on your own GPU
- pLDDT confidence coloring in VR
- Multimer prediction for protein complexes
- PAE (Predicted Aligned Error) heatmap visualization
- Batch prediction for comparing variants
npm install holoscript @holoscript/alphafold-plugin
pip install requestsobject "My Protein" @alphafold_predict @structure_confidence {
sequence: "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVK",
mode: "api",
color_by: "confidence",
}
See examples/protein-prediction.holo for more.
- Node.js 18+
- Python 3.10+
- AlphaFold API key (for cloud mode) or ColabFold (for local mode)
Experimental. Core prediction and visualization traits are implemented; expect API and interface changes.
MIT © HoloScript Contributors